3WA7A

Crystal structure of selenomethionine-labeled tannase from lactobacillus plantarum in the orthorhombic crystal
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
467
structure length
467
Chain Sequence
RLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDTNRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLQLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords tannase
publication title Crystallographic and mutational analyses of tannase from Lactobacillus plantarum.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 154
structure length 467
sequence length 467
ec nomenclature ec 3.1.1.20: Tannase.
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wa7A00
4I4CA 4DIUA 2H9YA 4N8SA 2GYWA 4QEKA 4FLFA 2AJ8A 3LS2A 2GBIA 2XQJA 1AC5A 2ES4A 3BXPA 1QIDA 2V96A 2BUBA 3H04A 4GLBA 3KDAA 3QH4A 1R9MA 1K6EA 5LKRA 2E3JA 2H7CA 4MWTA 4M0FA 4P9NA 4TPKA 4QDZA 4Y2SA 2QOEA 1LPNA 1MX1A 5JALA 5LZ2A 4KE7A 1ODCA 2QMQA 4AN0A 4Y2XA 3IIIA 1ZJ4A 3IDAA 4WFJA 2DHDA 5ALGA 4EUSA 3WL7A 5ALRA 3IULA 4YPVA 1H22A 2DSNA 4HAIA 4ITVA 1TK3A 3C5VA 3DYVA 5HFAA 3ANTA 2W6CX 2VAVA 1CUXA 5KWJA 1N1MA 4J0JA 1XZJA 4UBKA 2XUOA 4ZRDA 3ZLVA 2ORYA 5JARA 4C89A 4GDMA 4X00A 4NMWA 4L3WA 3WL5A 5FPQA 3O0DA 4M0EA 3ZLTA 5A7HA 1MO2A 3ZPXA 3G0DA 4WDQA 2EDCA 2HA5A 1AGYA 2OCIA 2PSEA 2EDAA 4G1FA 3V1LA 2RHWA 5KREA 1G66A 1LPPA 2WSLA 1YASA 3WZLA 2J3QA 2JGFA 5LIPA 2QT9A 1UK7A 4W63A 5HKBA 5C8ZA 4OUKX 3WL8A 4U2GA 2VT6A 4OB7A 2JEYA 1ISPA 5ALSA 3TEJA 3I28A 3BJMA 5AKZA 3BDIA 3PI6A 1H2XA 2YASA 5AM5A 4PW0A 3STXA 3BIWA 4BDSA 2VEOA 2QJWA 1QFSA 3RKSA 4AXBA 4GI1A 1ZI6A 3EQ9A 1UFOA 5AKHA 2HRQA 4H7FA 4N8DA 1LGYA 1XZCA 3I2FA 5DJ5A 1BU8A 1OCEA 4ZWNA 1WB6A 3C8HA 3C6BA 1F0PA 4KE9A 1QGED 3B5EA 4OCZA 2C5GA 4Q82A 5D6OA 1SC9A 1R4ZA 4PSUA 2QTBA 5I9IA 1GQSA 4O08A 5JIBA 3DKKA 1Q84A 3GBSA 3FSGD 3BIXA 1EI9A 3SX4A 1QTIA 5ALFA 5C8VA 1VE6A 4INZA 5DNVA 3DOHA 1YR2A 4RPCA 3VJMA 5HF9A 2PUHA 1UK9A 3VJKA 3FAKA 3RLIA 1NX9A 5EI5A 4FHZA 5AKYA 4OPMA 3EQ8A 2HHAA 2DCMA 5A6VA 3SWWA 1EA5A 3OOSA 1P0IA 3V1NA 4UPDA 4HS9A 4GECA 4BDTA 4ZREA 1ACJA 3IBTA 1TIBA 4NS4A 1I6WA 4BATA 2PSFA 1ZIXA 3T52A 3FVTA 3V1KA 3H19A 5BWBA 4QZVA 4U2FA 2I03A 3FLEA 3AJAA 2XMZA 2WU3A 1TCBA 1PFQA 5E4TA 2RIPA 3C6ZA 1ZOIA 3W04A 4RE6A 5FUMA 1MX5A 5FRDA 5CW2A 3CCCA 5AK3A 3W05A 4QWWA 5DYWA 3R3YA 1C4XA 1JJBA 4C01A 1GXSA 5AKXA 1TCAA 4B9EA 2HA0A 3RARA 1CQWA 4DGQA 3H2IA 2P8SA 4PV7A 3ESCA 2G4LA 2VA9A 5IKXA 1UOQA 2Z5GA 5AI0A 2QS9A 4B0PA 2WG2A 1BCRA 4BAZA 4TVKA 1XQXA 3AILA 4IH9A 4DMHA 3VKFA 3KWFA 2XMCA 3IUMA 3WWOA 1X70A 1XZEA 1A7UA 2XUFA 1A88A 1G4HA 5ESRA 4MYDA 3WQHA 1CUSA 2PSDA 1P0QA 2VJCA 4UBLA 2WKWA 1QZ3A 3O4GA 4EBBA 5FLKA 1CR6A 2AXEA 1JMKC 3W9UA 1MNQA 2BUCA 4X85A 1YA8A 5CT5A 1A8QA 4WFIA 1ZI9A 3H18A 5HF6A 4DM7A 3GZJA 5D3KA 2QR5A 1FFAA 1JU3A 1LPOA 2PU5A 3WWPA 4IQ4A 3E1GA 1T4MA 4CI9A 5SYNA 1N8SA 4Q1VA 3X3HA 1GPLA 4CIAA 2HA4A 2XQGA 4FFWA 3FCYA 4KRXA 1PJAA 2IX9A 4QLOA 1FSSA 3RM3A 4OSEA 5ISMA 4J0IA 3OG9A 4QDTA 4QDXA 1EXWA 1EVQA 3WKAA 5BWCA 2VSQA 3CXUA 1R3DA 1E5TA 1JT2A 5BV7A 4UBNA 1Z68A 4G4GA 1ETHA 4BB0A 1L7AA 5EHZA 1XRPA 4UHFA 4Y2QA 2DR0A 2RHTA 3LLCA 1MJ5A 4DMCA 5DLPA 1CUZA 4X6XA 2LIPA 2JBWA 2BGNA 5AM1A 4AZ0A 3FYTA 2DHCA 5H3HA 2WHPA 2BCEA 3BJRA 1ZD5A 2XUAA 4BE9A 3WLAA 4EB0A 1U65A 3HI4A 4Q05A 1XZGA 3PDCA 3N2ZB 5AM3A 1OXMA 4BVLA 3PICA 1BEZA 3H1AA 3QBJA 3D7RA 3O4HA 3I1YA 3KSRA 3RK4A 4BRSA 2GYUA 5CMLA 2RI6A 5FXMA 1EK1A 2FJPA 4HTAA 2CUTA 3EQ7A 1XZLA 1B6GA 1CUYA 1WHSA 3ESDA 2YH2A 3QITA 3IUNA 4CG1A 4W9RA 3CN9A 4J0DA 4UHBA 5JANA 2FUKA 4PSCA 4MQLA 4C4ZA 3SC2A 2ZVDA 1XZIA 2YXPX 1FFDA 5JZ9A 4DMKA 1EX9A 2QVBA 4G8CA 1DU4A 4EY5A 3GROA 5HCUA 3QMMA 4ZGBA 1CUEA 2C4HA 4DSZA 1NU8A 4LHEA 3KWJA 4GXNA 1J2EA 4FBMA 3VISA 1DINA 1TKRA 1IUPA 2PSJA 4KAAA 2HIHA 1MN6A 2ACKA 3MUNA 4MJ3A 5DYTA 1N5MA 1SCKA 1BEEA 3E4DA 5K3CA 5ALVA 1BROA 1J07A 6YASA 4G9EA 1M33A 3H2KA 4N5HX 3QMVA 4OU5A 2PPLA 4PQEA 4V2IA 4H7EA 2VJBA 2ZYIA 2XB6A 4CFSA 2DQYA 4BP9A 4Y2UA 5CXXA 4BAGA 3G8YA 1QFMA 4QWMA 1ZD3A 1BRTA 1W75A 2WUEA 1X2EA 4E15A 4EY4A 5HK8A 3DKRA 4KRYA 4G4JA 2JGJA 4B7ZA 3D59A 4OYLA 5ALZA 1ODTC 4XX1A 3WYNA 1XQYA 4FDMA 1EDDA 5C8XA 4LKOA 5AI6A 3FWHA 1THTA 4UBMA 3I2IA 3HLKA 3HZOA 4IH4A 5KBYA 4Z49A 4MQMA 2I3ZA 2HA6A 2GYVA 4KJXA 4AMZA 5DYYA 2HM7A 4H0CA 2ECFA 5J3JA 2Z8ZA 5DWDA 3AIOA 1CUFA 3HRHA 4AO7A 3I2HA 4LXGA 5ALXA 3DQZA 2W22A 1IMJA 1GKLA 2JEZA 2QXTA 1K4YA 2G5TA 3G02A 2B9VA 5ALLA 1WOMA 1USWA 4HRXA 1ZJ5A 2JIDA 1R50A 3I6MA 3WJ1A 5CBKA 1UK8A 4KE6A 4X6YA 4B82A 4HVTA 1ZGCA 1QO9A 2OPHA 5ALHA 3I1IA 5SYMA 4F5ZA 2B4KA 3NGMA 5HQ3A 1GZ7A 1XROA 2BJHA 2PU7A 4UHHA 3OURA 3S8YA 2BUAA 3TJMA 5AOBA 4IHAA 1E8NA 2XQKA 2VT7A 5EHXA 5JD4A 4A16A 3WA6A 1J06A 2WTMA 4XVCA 1CUGA 3NWOA 1CUDA 4Y2RA 1R1DA 5ALUA 4K5QA 2WQZA 1AZWA 1BN6A 1QIFA 2H1IA 5K3BA 3DL4A 4L0CA 1PV1A 3EF3A 3IUQA 3V9AA 3GFFA 2HA3A 5CRIA 1YS1X 4X90A 1H2ZA 4CCYB 1ZICA 1XKTA 2PVSA 3TGLA 3F9CA 4G5XA 1JMYA 3LCRA 3K6KA 4X93A 1YB6A 1CV2A 4C88A 2R11A 5CT8A 5AKJA 3IB3A 4Y9SA 3QVMA 1E8DA 3FYUA 4I3FA 1WCYA 3D2BA 2HFKA 1QLWA 4IH1A 4J7AA 2Q0XA 5ALJA 3I2GA 3G0IA 2AJBA 5JAPA 3G9XA 2PL5A 3R3WA 3R41A 4JYPA 4OU4A 3MUOA 5AKKA 4CG2A 2XQFA 3WYDA 4EZIA 3I2KA 4B0OA 1ORVA 4BRZA 1Q0RA 1UKCA 4FKBA 1WM1A 1CPYA 3B12A 2DHEA 3WK8A 2OLEA 4UFOA 1XRMA 3S2ZA 2Y2VA 4U2EA 4W1SA 4EHBA 3QM1A 5K3AA 1YSCA 1JJFA 3FBWA 4QDOA 3FCXA 5HZGA 5AH0A 3D0KA 2ZJ6A 5JAHA 5CH5A 3UUEA 2WTNA 4UBOA 4G8BA 5DTJA 4P08A 2X76A 3V1MA 4FNMA 2XUKA 1XFDA 2IITA 3B3QA 1XLUA 5A62A 3WWCA 1HBJA 2OGSA 2XI4A 5IVKA 3N0TA 4NZZA 3STUA 4XJVA 4PF1A 3ILSA 3PFCA 3DOIA 1EDBA 3G0BA 4BCDA 1WPXA 1T2NA 1EHYA 1P0PA 4DNQA 3PUHA 1VA4A 3HYSA 2OXEA 1DWPA 3HJUA 5E4JA 4P92A 5FOQA 4Q3OA 1GKKA 2XUDA 1VZ2A 1DTEA 1MTZA 3BF8A 1XQWA 1XZBA 5ALTA 5DTIA 5ALMA 3AIMA 4QLAA 3C87A 4BAUA 3OTQA 1LPMA 1P0MA 5EHNA 5CURA 1E89A 1H2YA 5D3ZA 3QPCA 5IVHA 1R88A 5LZ8A 5LZ5A 4DNPA 5KWIA 3M82A 3VXKA 1J1IA 1CUJA 2PX6A 2QJRA 3L1JA 4KE8A 4JH0A 3F97A 1EINA 3O4IA 3A6ZA 5E2IA 2WIJA 4QA9A 1SCIA 4C6HA 1YCDA 4UFNA 5AIBA 1Q0ZA 4X6UA 5HKAA 3AIKA 2NW6A 3TRDA 5AKLA 5AK6A 1YAJA 2Z3WA 4FBLA 1UXOA 3HXKA 1QIHA 5LKAA 3DLTA 5CH8A 2CZQA 2AJLI 3O4JA 4X71A 2O7RA 1BE0A 2OCLA 2JGKA 3WK5A 1H23A 1DWQA 3H1BA 2JGEA 4HRYA 1QONA 1D07A 5EIHA 4F21A 2XMDA 4GHWA 1JU4A 3T4UA 4U2BA 1IUOA 5AI4A 1A8SA 1CIJA 4B83A 4CCYA 3H17A 3STVA 5AM4A 3Q0TA 3JYHA 5HF5A 1X2BA 1JI3A 3STTA 2XQIA 4BTLA 5LZ9A 5ALQA 4DYHA 1K63A 5LP1A 1QIEA 2VJAA 2R8BA 1EDEA 4MEBA 2QUBA 4W1RA 2WJ4A 3UMJA 4U2CA 2H7XA 1ZGBA 3WZMA 3R3ZA 4L72A 1AQLA 3D3NA 4H7KA 4WFKA 4W1QA 5EHQA 2PSHA 1WPRA 3GELA 2XLCA 5AK5A 5BOVA 4YK7A 4N5IX 1XRNA 2GBCA 1GPNA 1CVLA 1DT3A 2HU5A 4AO6A 4E46A 2G5PA 4F0JA 2WUFA 5AP9A 3U0VA 1UOOA 4B6GA 5CT6A 2WU4A 2XT0A 1VE7A 1K5PA 1LBSA 4J0GA 1ACLA 2WG1A 1Y7HA 5F4ZA 5ALPA 1CUIA 1R9NA 2RGUA 1WB5A 2RONA 1B41A 4AMYA 3DCNA 4X97A 3WWEA 4B85A 4BCCA 4KR0A 1UKAA 5FPPA 4CIBA 3NOXA 4UHCA 5C81A 5K3FB 5IH7A 5A7GA 5ALWA 1XZKA 3FLAA 3H2JA 3L1IA 2WJ3A 5JADA 4ARAA 1LZLA 2O2IA 3AFIA 3H2GA 5YASA 4X7BA 2AJDA 3PF8A 2GBFA 2Z3ZA 4UHEA 5CT4A 4FWBA 3I6ZA 4A23A 2HL6A 4EY6A 2H7YA 3LIIA 4PSDA 4C4XA 1IZ7A 4UFPA 3A2MA 2VJDA 3FSGA 4H7HA 1YB7A 5ALKA 5ALIA 4RNCA 2PKYX 3ZWQA 5LZ4A 2DQZA 5CXUA 1VXOA 2ONCA 4I19A 2PBLA 1QIIA 2WHRA 5JAOA 3KOOA 1FFBA 5AOCA 2C0QA 2I78A 3DEAA 3E3AA 2BKLA 5I8PA 1LNSA 2FX5A 3ED1A 2JGMA 3NUZA 4PNZA 5AO9A 3BDVA 4FMPA 2OGTA 2D0DA 3WI7A 3WK4A 2BGRA 3WK9A 5T4FA 1RP1A 3DYIA 5AKIA 4AN1A 3STYA 3E0XA 4Y2VA 2XUHA 4G4IA 3M81A 4M0MA 2WILA 1EH5A 3ESAA 2X5XA 1FJ2A 4WDRA 1N5RA 5JAUA 3BF7A 1CQZA 1DQZA 1MPXA 4GWLA 3AZQA 2XMRA 2ZYRA 1QOZA 4B81A 4QE3A 3FNBA 4GBGA 4ZV7A 2HRRA 5FDFA 2XLBA 2C0PA 3ZLUA 4BE4A 1XKLA 4K6KA 3WK7A 5FKJA 5JD6A 3UUFA 2GBGA 2WJ6A 3QMWA 3H2HA 2G63A 5K3DA 4LYDA 3F67A 2I3DA 3C6YA 4HXGA 2FJ0A 4DNOA 4C87A 3WWDA 3HEAA 3Q8WA 5DNWA 2CB9A 1CUAA 1QTRA 4KAJA 2C7BA 3A2LA 4DMFA 2WIKA 3HACA 1LZKA 1LBTA 4JNCA 2CKMA 3LIPA 5ALNA 5ALYA 3WA7A 2XUIA 1AUOA 3ANSA 2HDWA 1OILA 2WLSA 3GA7A 4UBJA 5CH3A 3DDUA 3OM8A 1G42A 4H77A 3MVEA 2ZSHA 1TAHA 3HABA 5I7UA 4YX9A 2V97A 4OYYA 3WMRA 4BZZA 3BL8A 2OG1A 5CT9A 3WKCA 3STWA 4UHDA 3C5WP 4E14A 3AINA 4BTVA 3PF9A 5A71A 4XIIA 3ZI7A 4PO3X 1A8UA 3EBLA 3W2TA 1XZMA 4FFVA 5JD5A 5T4BA 2RAUA 2VAXA 1ZI8A 2K2QB 5FV4A 5AK4A 4JUIA 2OQVA 3I2JA 4KEAA 4BC0A 1XQVA 4H35A 2HA2A 2ZJ7A 1LPSA 2O2HA 4K6HA 2WFLA 4Q3LA 4CCWA 2WIFA 4ZV9A 4BYMA 2CJPA 1AMNA 1F0NA 4Y2JA 3G0GA 4H7JA 3FOBA 3O9VA 1HQDA 1UK6A 3BE8A 2XUQA 4W1PA 1VXRA 2OGZA 1CRLA 3PFBA 4WY8A 5HFNA 3IURA 1QIGA 2ZYSA 3GUUA 3ZV7A 3ESBA 2XE4A 4BBZA 3CCBA 5AIAA 1U8EA 2XMGA 3G9ZA 1VA5A 2WIDA 3HC7A 3VVMA 4GEGA 2AJCA 4FLMA 1TRHA 1Y7IA 1EB9A 2Y6VA 4IO0A 3ICWA 4QNNA 3OPMA 3WK6A 4ARBA 5AICA 1U4NA 4DLNA 2XUGA 1W76A 1LPAB 3FYUB 3EIOA 2HADA 2QUAA 5CTAA 1FFCA 2DFPA 4AZ3A 1ZD4A 2ACEA 3WIBA 1TCCA 4X3CA 4QDUA 3KD2A 4L9AA 3O95A 5ALDA 1VOTA 1L7RA 3V48A 3VJLA 3M83A 3JW8A 3FYUC 7YASA 4KACA 1Y37A 1E3QA 3R40A 1FFEA 1CLEA 2JF0A 1W4LA 1XZHA 2B61A 3DNMA 2IIVA 4JEIA 4E11A 2ZYHA 3QZUA 1WB4A 3YASA 4X95A 2OCGA 4OD0A 2XMQA 1XZFA 2VQ6A 1HKHA 1AURA 5FP0A 3O9MA 5ALOA 5LLSA 4AX4A 3WIOA 4J0CA 1K8QA 4K2AA 4MYSA 4YASA 4N8EA 4MEAA 1IVYA 3H0CA 3G7NA 1S8OA 4H7IA 2X8BA 1XRRA 4ZXFA 1XZDA 1UWCA 4BCBA 1NU6A 3WKEA 3W9BA 2ZJFA 3QPDA 1E8MA 1GGVA 1O6GA 3R0VA 3CN7A 2WUGA 1JJIA 2HFJA 1SFRA 1VZ3A 3ICVA 2VATA 1YS2X 1L7QA 2PUJA 4DTCA 4WY5A 5IVDA 2C58A 5AHXA 4LIPD 5K5EA 1BCSA 1KEZA 3C8DA 4FOLA 4H18A 3A70A 1VKHA 4BZWA 1W6RA 1W52X 2YYSA 5AM0A 3WL6A 1AKNA 3LP5A 1DWOA 5EFZA 5D7BA 4Y2YA 3IUJA 3WKBA 5AM2A 2PM8A 1MNAA 4X94A 4LYEA 2O7VA 5HQ3B 4OB8A 4H7DA 1HDEA 2OQIA 3F96A 2GZSA 1XZAA 3DD5A 3A2NA 4LXIA 5E4YA 4FNGA 4GW3A 4ZI5A 3SK0A 1MAHA 1MU0A 1VLQA 3DJYA 2CMFA 1HLGA 4MWSA 1ODSA 5DNUA 2WHPB 3D2CA 1BS9A 1Q83A 2HA7A 1ORWA 3D4LA 3VVLA 5HK9A 3I6YA 1HL7A 1CUCA 2WG0A 2QXUA 5LZ7A 2WIGA 1WHTA 4Q3KA 3FLBA 2CEKA 5K3EA 5AI8A 2EEPA 2JGLA 3L1HA 1JFRA 3KXPA 2OAEA 3OC0A 4UBIA 3PUIA 1YAHA 1UT6A 4P93A 5AKGA 2D5LA 2BFNA 5JZSA 1KU6A 1H2WA 4HXFB 2V9ZA 1W1IA 2WFZA 3IVMA 2B20A 4B84A 1QIMA 1U2EA 2Y2UA 1DT5A 5C7YA 3IA2A 1SCQA 4X91A 4FTWA 4EY8A 3F8SA 2Z8XA 2WFLB 2J4FA 1GPKA 4J03A 2WUDA 3VDXA 4EA6A 1C7JA 4K6GA 5AI9A 3PE6A 3C70A 4DNFA 1AX9A 5A2GA 5EIEA 3G0CA 2XMBA 3QPAA 5ALEA 1G5FA 3D2AA 3W06A 4DSAA 1GQRA 1DQYA 5JASA 4AO8A 3D5EA 1VJ5A 1KU0A 1QIJA 1GT6A 1ZD2P 5K3FA 5AOAA 2OAGA 3R3UA 1UZAA 1QIKA 4C4YA 2JGIA 2C5FA 2Y6UA 1DX4A 4RE5A 1THGA 4JYMA 3MGAA 1MT3A 2XMSA 1EK2A 4XWGA 1F6WA 4WJLA 2O2GA 1ZIYA 1IUNA 2QKYA 3G9TA 4BVJA 5EIAA 1TQHA 1RWQA 3R3XA 1QE3A 1YA4A 4Q34A 3AZOA 1EB8A 4AB1A 3U1TA 2VTVA 1F8UA 4J3JA 4NVRA 4RGYA 4UUQA 1LLFA 1HPLA 2V98A 3BWXA 1CUHA 3WJ2A 1CUBA 3JWEA 1XRQA 2UZ0A 2J4CA 5JZBA 3AZPA 3C43A 2ROQA 4F60A 5EGNA 1E66A 4Y2PA 1XLWA 4BP8A 3C45A 1DX6A 2CBGA 3DS8A 3G9UA 2XUJA 3K9BA 4AQDA 4FLEA 2OCKA 3P2MA 3QYJA 4HZGA 3M3DA 4Y7DA 4D9JA 2WHQA 4G8DA 4A5SA 1CEXA 2XDWA 1QO7A 2XUPA 4WCVA 2HU8A 5JATA 1UKBA 2ZSIA 5T4EA 1LPBB 5JYCA 4G9GA 3FVRA 3AUKA 1MX9A 3DL7A 1UOPA 1XRLA 1EVEA 4ETWA 2VF2A 1JKMA 4X92A 2J3DA 5HF8A 4TGLA 2Y1KA 4KAFA 4MXDA 4S0XA 3C6XA 2QZPA 1CUWA 4BC1A 3F98A 4OB6A 4CG3A 1C7IA 4J0HA 1QJ4A 4ROTA 1CFJA 1SOMA 1XLVA 1CUUA 4B80A 4LXHA 1CUVA 5AKEA 2QM0A 4U2DA 3HSSA 4BVKA 4B9AA 2WM2A 1O6FA 1MAAA 2BAGA 1IZ8A 4J0KA 2GZRA 4Y2TA 4EY7A 3R3VA 5T4HA 5LYYA 1RYYA 3WKDA 5AJHA 1BN7A 5AI5A 4HXEB 2HU7A 2QRUA 3K2IA 2WFMA 5IVIA 4KYVA 5A7FA
chains in the Genus database with same CATH superfamily
5JH7B 1C14A 1UZNA 1YB1A 2H9YA 1QRRA 4FJ2A 2GYWA 4QEKA 4ZCMA 4CMCA 4OH7A 1C7FA 1YJ8A 2IHYA 1RM5A 3F78A 2LDXA 1PTJC 3Q3IA 1SO8A 2XQJA 3S68A 2VQFB 1AC5A 1VQ1A 3BAFA 5DZSA 3TZ6A 1RPAA 1DAEA 5BSVA 1TC2A 2VTBB 2DKNA 5KU1A 3X1YA 1GU1A 1XR3A 5HOEA 3H04A 1RKXA 3IMCA 5GINE 3IJEB 2DBYA 2JVIA 3P32A 4K6CA 4NE9A 4C7VA 1HFKA 4HNRA 3VSCA 3QE9Y 1O94A 1A2QA 1QGOA 3S8MA 4H6VA 2ZGVA 2FOIA 3QH4A 4M7RA 4ZMRA 1YQQA 5LKRA 1XZ8A 4AJ9A 4EA8A 5JNTA 4S0ZA 4F6CA 3ICQB 2BE7A 5EE1A 1MPTA 3GB9A 2WWHA 4O4JF 3S6JA 3JZAA 4KR2A 3QOYA 2G88A 1V41E 3HU5A 4EHDA 2F8MA 4M38A 2OWEA 1J7KA 5JSFA 3I2YX 5EINA 1T9KA 3EMKA 4Y2XA 1C81A 2CUNA 3SJ7A 4HUQB 1DO2A 1C7RA 3IKLA 4JIMA 1AS3A 5EIFA 4B6JA 1J9GA 5KINB 1V95A 3NTOA 1S3SA 5M04A 1KDTA 4MPJA 1P1HA 4YCAA 3WLIA 2B4AA 3K2QA 3IULA 4YPVA 4P3KA 4HAIA 4I1PA 1XTJA 3GD5A 3IP9A 5ITWA 1WMAA 1WCWA 3CZ9A 4DJ5X 4PZPA 1XTIA 3URKA 3N6XA 1Y8RB 5CJPA 3NFRA 3DKIA 3DXFA 4KIWA 2BFEA 3WGTA 4AZVA 2ZT6A 3GAAA 3K72B 2YTZA 1C9KA 2EW1A 4JT2A 2XB2A 1IDN1 3CEPB 1V9CA 3CQ9A 2QE7A 3DXZA 4F2DA 4PPQA 2I4MA 4ZU1X 3V8BA 1KMHA 5JHGB 2CHGA 2IPXA 2XCSB 3IT1A 1NIPA 3ZLVA 4EEXA 3DT9A 1YB5A 5JARA 2Q4BA 4LRQA 3HXTA 2I33A 1T9GS 521PA 2FMFA 3NHLA 2ZWPA 1ZEMA 3WL5A 1J5EB 1T4GA 1U0LA 2GXSA 3O0DA 2GHQA 2PJDA 4KFSA 2WEKA 3EIFA 5A7HA 3I5MA 1MRZA 4GC5A 3NH9A 2GLTA 1V25A 4LTNA 3ZLTA 1SQGA 3ZPXA 5AVRA 1NP7A 1AIPA 1Y1TA 5JSUA 1Z25A 3QVTA 1M74A 1OLUA 3HR4A 3FE2A 2EDCA 2I1LA 3FIUA 3IUEA 3QX9A 4EVQA 4AQ7A 5BR1A 2EDAA 5TEWA 1DARA 1ZDMA 2D06A 1LQ2A 1JEJA 5GV7A 3V1LA 1G66A 2ADOA 2JAHA 1VLJA 2FZGA 2VP5A 5SYAA 4MIKA 5KVVA 2WSLA 2FPOA 4LZNA 1JEOA 1YASA 3REOA 5G1PA 2H0AA 1FF9A 5IXYA 2AI2A 2CCJA 3B1XA 3E84A 4URYR 4XD7A 1OASA 3DCIA 3K15A 4JJEA 4Y7CA 1CDEA 1N2BA 1G6HA 3LQQA 1H5NA 1XA0A 3IUSA 3UHPA 2NLOA 2ZRPA 1P44A 4M0LA 2EFGA 1SVKA 5L3QA 1QLJA 5LIPA 1VSVA 3UATA 1UK7A 1MVLA 5HKBA 2H4XA 1YBMA 4QOSA 6REQB 5BV2P 2VNJA 1NBWB 4I1VA 4OQNA 5BW4A 4Z3DA 4BWVA 1KK2A 4QREA 1NKSA 2BI4A 1NA5A 4DIDA 1HG1A 3BIJA 2IS2A 3JD3A 3V5NA 2G8NA 4HAUA 4QUBA 4XVQA 2JEYA 4WPGA 3TE7A 3KAKA 4ZK6A 4F12A 4CLRA 1I30A 3BJMA 4WXYB 3WSWA 9LDBA 1TM1E 4LDJA 3DZBA 4LQLA 4DXAA 3SJAA 1D5WA 3RIHA 1ZNYA 2PUBA 2FMKA 4J2TA 3PC4A 1YRHA 1F17A 3VHXB 5AJVB 3LT1A 4LQDA 2UXCB 3BIWA 1BYUA 3T35A 1N9ZA 2VEOA 2OXTA 2GBLC 2VH2A 2ZBFA 4B3HA 1O9HA 2NZVG 4N3GA 1ODFA 4XD2A 3RSCA 3CIFA 3MWGA 5CFMA 1A96A 3DAHA 4H7FA 4GWKA 3ADOA 4N8DA 2PK3A 4OV6B 4JV5B 4D46A 3ECSA 4LBYA 3EXHC 3E9QA 3PQ4A 4DCJA 3KOYA 1GA1A 2DFDA 5DJ5A 4B32A 2Y3IA 3TQQA 5KVCA 3TK1A 1B8NA 4ZWNA 1WMDA 1KEUA 1A77A 3C8HA 1R0RE 2GEKA 2ZB8A 3AF1A 2Z08A 3DQQA 1T1RA 3RRXA 4CHTA 2C7GA 4ZP1A 1NXXA 3TLAA 2G76A 3B5EA 1GP2A 1JTEA 3I9LA 1H8ED 4I1OA 2GKOA 4PBSA 1HE1C 3WE7A 4GZMA 5TPZD 1SC9A 3GXOA 3M4ZA 5I6DA 1KJYA 1OBFO 2AMVA 5K0JA 3SYNA 2QTBA 2FWAA 1VSTA 4B4DA 1BDBA 1KEWA 5JXWA 1AKQA 3TNYA 1MH9A 3AGPA 3DKKA 2QGNA 3EXHA 4KMRA 3FPHA 2G82A 4RVDA 3T1QA 2W42A 2QUIA 4KXUA 1IEXA 4H3SA 3U09A 1YR9A 3FSGD 1OX5A 2IPOA 3D0RA 3U9TA 1X1BA 2V6JA 4B8YA 5JI2E 2GBLA 4W6QA 1A9OA 1KC3A 1M34A 4W5OA 2FZVA 3P2IA 3AB3A 1KI8A 4B44A 3GRPA 3FSJX 4FEAA 1QTIA 4BGIA 5DNVA 4INZA 4E4TA 5ILQA 3EC2A 1OZAA 1T3LA 2P1DA 3I1FA 5AW5A 5P8WA 1G63A 2PZFA 4UXHA 5IDWA 1TCUA 3ZDAA 2WP0A 4FE7A 2UV8A 2L69A 4BRWA 4UAVA 2C4WA 2PUHA 2ZB3A 3NOQA 4JLVA 3TL2A 3DLAA 3O74A 1U4SA 2X4IA 1XDGA 3GLQA 3FAKA 1A4IA 2YW9A 3QJ5A 1F2UA 3HJCA 3UKJA 5DLEA 1ZM3A 3AR2A 4XCQA 2NSLA 1NXQA 4IIFA 1U2SA 2DEUA 3EGOA 1QRTA 2YN0A 8LDHA 4CTOA 4N41A 1RWVA 2HCRA 3M1AA 3C14C 2ODQA 3HA7A 4GI3A 1WD7A 1GFSA 5FPYA 4O0MA 3M2TA 1CP2A 2J85A 2UYQA 4GSYA 5FYDA 5U4QA 4D74A 4QUDA 3OOSA 4M55A 4HS9A 3B89A 2FVYA 4LI0A 4O4LA 3RC3A 3GYBA 3E18A 4AMVA 2WYIA 1WHSB 3PPWA 3D8NA 4PZ0A 2ZE5A 3LUCA 3RVSA 1O4VA 3ETGA 4TV8A 4ZYVA 3PENA 1V16A 2CLKB 3QHQA 3SE7A 3OTWA 1WY5A 3D6VA 2X15A 3HM2A 2N42A 3AOEC 2NQ2C 3OOWA 2JFZA 1ZMRA 1EHCA 1I6WA 4KWTA 4BNDB 3BBPA 4Q4AA 3CZRA 2NYRA 5DNDA 5B2EA 5A2QA 2H1RA 2VLBA 5LLDA 5B1YA 3QSGA 2CDRA 3VUFA 4TTTS 4KHPB 5DYGA 3FLEA 1VMDA 3AJAA 5JWRA 2XMZA 2Q5FA 3WGHA 1H4SA 3AFNA 1FRZA 3OOJA 2QGZA 1GYRA 2EARA 1XWIA 2X42A 3I4FA 3ZR4B 2B82A 1GCUA 4IZOA 2GZ3A 1E6KA 1G41A 5LYJA 4EUFA 4NRDA 3FKSD 2I4OA 2CNOA 2RIPA 2A0FA 3G68A 4S1VA 1NN1A 2L18A 3VUEA 1M0WA 1FS4A 4N82A 4FR0A 1IOWA 5FRDA 1A2OA 4XIFA 2A1UB 4JSTA 5CW2A 3ND8A 2Y1XA 3MJFA 4D9GA 2ZZKA 3BZBA 4O1IA 3OCUA 3CCCA 1MB4A 1P3JA 1VPVA 4A2QA 4C1BA 3KT8A 4IGIA 4MH0R 5AK3A 3WAKA 1LNQA 3A3NA 1HLFA 1PYDA 1Y9AA 3K70B 5LQCA 3CUSA 3FTQA 2O54A 3R3YA 2VUIB 3L6UA 1GY8A 3IODA 1KO5A 4OKNA 2X0JA 4AECA 3ZDYB 4RTKA 3B85A 1NUAA 3C8MA 2NV6A 1IZYA 2XCQA 2ZE6A 4UD2A 4F3RA 5AKXA 2XKJE 1CNEA 1TCAA 1RJEA 1U6KA 1HGXA 5GP1A 3WZ2A 4JXJA 2HJRA 4QU0A 3S5JA 3R0IA 4FUTA 4P6VF 5JQGB 4I1YA 3ZW8A 4GOJA 3H2IA 3I73A 4PONA 4DGQA 5DBIA 3ZHXA 3EBPA 2II6A 5DHSA 5EKDA 1NVUQ 3ESCA 1VHLA 2G4LA 3I64A 3PTAA 4WBNF 1J7JA 1WO8A 3DM5A 5HRUA 1SC1A 4CEIA 2A9OA 2VA9A 3H1GA 3PI7A 4OQZA 3VO1A 3OKAA 1VL5A 3O31A 3QYPA 5LQRA 1O94C 5JQGF 2Q3JA 2BBOA 2HEGA 4PAQA 5AW9A 1KAMA 1UOQA 2H17A 3PXDA 1K7EB 1RQNA 3T7IA 2QLJA 4WINA 4I3GA 1U7PA 1JXOA 3LCUA 2QL9A 4MQBA 1ECCA 1UP7A 2W6ZA 1LCIA 1U7XA 3CF2A 3HVJA 3N2NA 3TQCA 4J94A 2B94A 1PTJA 4B0PA 1A76A 5U4XA 3WLKX 1SNYA 1Q0LA 4CLXA 1XQXA 3CNOA 4IH9A 5KAPA 4FW9A 4NZ9A 4NABA 1DXHA 4AZTA 4DCNA 4FDUA 1CS0A 3IUMA 3WWOA 4BOYA 1XZEA 3M9XA 3GT4A 2JLVA 1A7UA 1G4HA 3ESQA 1RPNA 2C03A 3VR4H 4LI3X 3OT1B 5ESRA 4D2IA 4YMUA 5BMVF 1NG9A 4R05A 3TOZA 1E9RA 4NMLA 5IAGA 4YXWA 3T8YA 4UUNA 2MYUA 1K9VF 3NGXA 4FSDA 1LI5A 1X1RA 2J6CA 1T9GR 4J7CA 1F51E 1MGOA 3GJ8A 2BP7A 3KKKA 4K9DA 5TQVA 1Q0TA 2CV2A 4RL4A 1R0KA 1ORDA 3S1AA 5HZMA 3FUUA 3W9UA 3B53X 5HUJA 3HCPA 3N3AC 2BUCA 4GD3Q 1MOSA 3LUGA 3HB5X 3VKWA 2YWDA 1U9JA 1Y82A 2J4DA 4YGXB 5GZ6A 4BV2A 1A8QA 1X7WB 1ZXBA 4WFIA 1ZI9A 4BO9A 3G9QA 3HV2A 3RC2A 3H18A 2YFHA 2NTEA 4JKOA 4P7JA 3OY7A 3GK3A 3F3MA 1ND6A 5HF6A 5THKA 3SQDA 1LK0A 2DP4E 1LPOA 4KXWA 4OI1A 4GX2A 5C5CA 3TCNA 3EFOB 4DCVA 1WUIS 1R8XA 4R1UA 3JQPA 1QRDA 4IQ4A 3E1GA 2ZDGA 5B1IA 3KB8A 4OAOA 4CI9A 3UB3A 3ZHRA 4NECA 4Q1VA 3X3HA 1SVUA 5EPOA 4PG8A 2DWQA 3ZQJA 4N5NA 4WWHA 5C52B 1XEFA 2J07A 1W36D 4KH0A 4MR8A 1NE7A 1B2LA 1NW7A 4TQAA 2O4CA 2OQ2A 3G89A 1PHRA 1TGYA 2VHTA 1OBVA 3FCYA 1Z13A 4TWRA 1KOLA 3UOAB 1RTKA 4QLOA 1FSSA 1IY8A 4QGSA 4OSEA 4YMWA 2PUVA 2XNDD 2ZWMA 5NULA 3AONB 5ISMA 1IN8A 1X7XA 2Q4TA 1Q15A 1QORA 4K9RA 4QDTA 1K1EA 3KTAB 3VHLB 4EBFA 4V1CI 2QJOA 1EXWA 1EVQA 3EG9A 3ITEA 4J1TC 3TNJA 1GFZA 1KXJA 2QR2A 4KOEC 2VNSA 3PEVA 1N5JA 5BWCA 5K0CA 1V0JA 5KOYA 4DV5B 4EKIA 1KKMA 5FNVA 1R3DA 3KKQA 1E2MA 4V0KA 1JEDA 1RMTA 4BKPA 2W2QA 4DM3A 1JT2A 1R6AA 2HJVA 5L3VA 1AH2A 2O6LA 1NM5A 3F8TA 4UCQA 1BA2A 2DUMA 1Y5NA 4RADA 2W9XA 1Z88A 1ETHA 2XT6A 3VPFA 5FA8A 5LP6C 3DWFA 3NAQA 5HGXA 4BB0A 3A26A 5ERGB 4F72A 4Y2QA 1QHIA 1SVMA 5IULC 2AKEA 2Q5HA 3IGFA 3L43A 4AIIA 1PEYA 1V43A 2AN5A 1ZN9A 4FYHA 4HSGA 4U0JA 3UJ7A 3THWA 1MJ5A 4YRMA 4ZO9A 4JVSB 1X0XA 5DLPA 5I8WA 4OHFA 4OFBA 1WWKA 4TWZA 3ABSB 3I6QA 3GGGA 2D7DA 5CD9A 3KCQA 1Q11A 4WKCA 4E5SA 4MUYA 2F62A 2LZ0A 3KS9A 4H1UA 3FYTA 4O4JB 2DHCA 2IDMA 3G59A 1WVGA 7ABPA 5H3HA 2PYIA 5I3ZA 2ODBA 1EGAA 4MQ5A 2WHPA 2CNLA 2PQ2A 3KLBA 3CVWA 3HDGA 3G2IA 4JMPA 2ZZNA 3RHSA 5DTMA 3VI4B 1ZD5A 2XUAA 4PG7A 1QHGA 4W99A 1XDZA 4BAZA 3RV3A 3SNHA 1C9DB 1VI2A 3VR5H 3WLAA 1VFNA 1J2UA 4GMXA 3PL5A 3IT0A 1XZGA 1TVKB 2JFFA 3CONA 4TS4A 4L8VA 4N39A 1P0FA 2VEDA 3F74A 2ZYVX 3PEWA 2IUFA 4UASA 2GN2A 4ZAXA 1U7ZA 1STOA 2Q9AA 1QBKC 1Y1SA 4ZD6A 4F8JA 4PGGA 2J8ZA 1OGIA 4E22A 2AQKA 1MB3A 2ZUCA 4HP8A 3QBJA 4L8GA 3D7RA 4ZT2A 3VJRA 2B99A 1M1NA 3Q15C 4LOLA 3V3TA 2YHSA 3D9QX 1K66A 3AK4A 3T7TA 3ZHUA 5IKEA 1L3CA 2EFHB 2GYUA 4E1AA 3MLAA 4ECEA 1WCIA 1ULHA 4MIYA 3AF6A 5CCXA 3B2NA 3ZZ0A 3OT1A 1EK1A 2PZMA 1T5HX 1GPDG 4LYJA 4CMIA 1MCZA 5BOSB 2WF8A 4W4TA 2CUTA 4ZYUA 1ENYA 1FMFA 3W5CA 1A5BB 4BXOB 5CG2A 1CUYA 2XNJA 3EGEA 4NAUA 4RTPA 1IN7A 4QKQA 5JNLA 4NPHA 1KXZA 3ONDA 4MRVA 5JCXA 1D4AA 3TLKA 1P5JA 2PGLA 1LF0A 2A9KA 4GR9A 4ZTBA 3BWYA 4JZKA 4UHBA 5JANA 3AI3A 2R4TA 1CFZA 3OCWA 2V8OA 1GPUA 4ZU3A 4ZXPA 3NBKA 3RABA 4C4ZA 2YUTA 2HJGA 2Q1SA 1XJQA 1J9EA 4JKYA 1XZIA 4OM7A 2V3CC 3RS9A 1JDBB 1HTBA 1M6VA 5TF4A 1U3TA 1T4BA 4EY5A 4ZQIA 1LU9A 1Q16A 3C6MA 4HQ6A 4BNLA 2PD4A 3NVKI 1BZYA 4W7IA 4KQ9A 3Q5DA 4ZGBA 2GM3A 1KYXA 2GTHA 2QY9A 3DMFA 3W7BA 4CF6A 2O19A 4LF7B 4XQGA 3HM9A 1KFBB 2BBSA 3BXHA 3QXJA 1ATIA 4N5MA 1KAEA 3B1VA 3U7IA 3ROKA 3KWJA 2CY0A 2QMOA 1A0OA 3P52A 4J0FA 3LZDA 4P4GA 2ZBVA 1KR5A 1U3GA 4NS1A 4RMIA 4DR6B 2OKCA 1DINA 2OBNA 4TL9A 5LB4A 4R8LA 3KETA 1TKRA 1L9XA 2JCVA 5GIOE 4L5BA 1IH8A 2QI9F 2F1RA 4KAAA 1SZCA 2RHMA 3H4VA 2ACKA 1BGXT 2OM2A 3CTPA 4MJ3A 1ZG3A 1JEAA 5DYTA 2OC4A 5B4VA 3H13A 1N5MA 4IDCA 1ENOA 1P5ZB 1D2AA 2W2NA 3ND5A 1E5XA 3CUWA 3M33A 2BKVA 4TRNA 4CKCA 1EQAA 3PGLA 4MV1A 4YMHA 3IHLA 4YMLA 1A9ZA 2NO6A 3HN2A 1RXWA 2FMTA 3IAFA 2YWFA 1CQJA 1EZ1A 3EAQA 4N5HX 4O4IA 3RYHB 2FPWA 4EHLA 2QJTA 1TU4A 3TW8B 2ID8A 4CTKA 1SBTA 3AI1A 4R3WA 1H0HA 4V2IA 2J9FB 2X6QA 1LRJA 3NTQA 5A62A 1GAXA 4IIJA 4WOKA 2QZSA 2JAOA 2XB6A 2DQYA 2VC2B 4TS1A 4RGQA 4BP9A 2HY7A 4A2PA 5KC9A 1BRTA 1Q92A 4ASUD 2WUEA 4MWZA 4JI2B 1JNXX 3RVNA 4C2UA 1X2EA 2HF2A 1BVHA 2WYHA 5AYVA 4S35A 4B3XA 1AJEA 3K32A 4EY4A 2E87A 3HYTA 3CVVA 5HK8A 1IL0A 4AMBA 1IK4A 1PR5A 1ZA1A 3GJSA 6Q21A 2CUZA 5BY2A 3NEJA 4E03A 4B7ZA 1T3HA 2LV8A 4N5DA 4CEHB 3R7NA 5EEHA 2ZIWB 3WYNA 3NC0C 3K96A 5T3YA 2CNKA 1DQNA 1SBIA 1T1JA 3C16C 1XXHB 1HK7A 4J90A 1EDDA 3TRHA 1FFHA 1NJ6A 3PUVA 2CXQA 1OI3A 2NTYC 2OBMA 1V3VA 1WV0A 3U4DA 4KQCA 1EFPA 3VU1A 2WDPA 3DBRA 3IP5A 3R4VA 3T0IA 2DULA 1PWHA 3RGGA 3DWIA 2DLCX 1N0HA 1LDNA 3KJQA 1T9BA 1XDUA 1RRFA 2ON6A 3I2IA 5EIBD 3SYLA 3QBEA 4PICA 1N6OA 3DDZX 3LLMA 3KT0A 5KBYA 1OVMA 2OHHA 4KK4A 3WYGA 1E9DA 3OICA 3FPCA 4Q4HA 3OQ1A 4NYIR 4MQMA 4C0XA 2I3ZA 2V65A 3AY7A 1QS0B 2OGUA 2FSPA 4XOUA 2I3BA 1TYCA 3UYLA 3ZZUA 4LXYA 2H9IA 4LV5B 3RR2A 2O5VA 4E4YA 3OZWA 3T06B 3TLCA 1AE1A 1EU1A 2IYWA 1IONA 2BFCA 4F06A 3RSGA 1EPUA 3WFZA 4HAYA 1E61A 2NZXA 2CJWA 4HYTA 4KSCA 4AMZA 3SX2A 5KYVA 2NIPA 3ZGNA 3EG9B 5AJXA 3RBVA 1ZCFA 3AVOA 2R79A 3NYQA 1NURA 1NI4A 4EHAA 2V6GA 1YQWA 1XCGB 2C3MA 1BVYF 3JZIA 4HGQA 4IWNA 5K0NA 3RVOA 3ZWMA 3DTVB 3KQOA 5KYKA 2B92A 1TA9A 3HRHA 4KQJA 4AO7A 5DFAA 4BFSA 1PX0A 4DRXB 4TKLA 3IT2A 2VHUA 3P96A 2B8WA 1YR7A 3LYHA 3PT9A 4LXGA 4R9VA 5GMOA 5CJJA 1YDMA 2ODWA 3V1UA 5M7EA 5CEFA 2W22A 1IMJA 5ULLA 5CBPA 3AW8A 3KSBC 3U62A 2QXTA 3U4MA 1QHNA 1JEQB 1Z5UA 3OZIA 1V16B 4GYYA 4KODA 2CJXA 3ZVRA 3RWMB 1O03A 3F5DA 1DS6A 5IH3A 3TXYA 4OI2A 4FB5A 1R50A 4MQ4A 4JR0A 4MUNA 3QEKA 4D9HA 1O95D 4EHNA 2X0DA 2OP0A 2WSBA 5F21A 4EO4A 5JXHA 1G3MA 1X1TA 2P9YA 3CNEA 1YONA 4J76A 3LHDA 2JJ8A 3D6NB 1X7WA 1P7YA 1BMTA 2HMWA 3CKKA 4U3JB 3RIMA 2QTCA 2DH6A 5JBNA 3OLWA 1SOWA 4B82A 3MTBA 4GGMX 1ZRSA 5DYNA 3HP4A 1HDOA 4BQEA 2G04A 4CKWB 5CVUA 2ZEJA 4E1BA 1I01A 1KP2A 4FXOA 1TO1E 1M7GA 2G1JA 5ALHA 5WRFA 4P3XA 4D56A 4IAOA 4F5ZA 1I9CA 1AVTA 2AFHB 4KPYA 3L1KA 1KH2A 3EF1A 2VNKA 4GQIA 4IUYA 1GZ7A 2DJ5A 3HDYA 1DAFA 3IP8A 4KQHA 4UZEA 2ZSBA 3ZGOA 4R0VA 5KJ6A 1Q77A 3PKZA 2BJHA 5T57A 3C7AA 5A4KA 5CB0A 3FF1A 2A67A 3P8ZA 4B47A 1DAGA 4YLYA 4YA6A 1U0TA 2BUAA 1QR6A 3TNDA 1Z2NX 2X13A 3ACCA 3QV2A 4JC8A 1B7GO 2KQUA 5AOBA 1O6ZA 3AU9A 1DJMA 2CW5A 5EIXA 3PZBA 1SCDA 1F7UA 3NHRA 1TJ5A 3MCZA 4H7PA 4I1RA 3JSAA 5IZ4A 4CI0B 2D59A 3OUZA 4O4IB 2C07A 5EIWA 2PD6A 1VL2A 2GHIA 1EFVA 3J7TA 3OLCX 2FU5C 2VQSA 2X86A 5DRYA 3A3YA 5TQJA 5EJ8A 4RJTA 5JD3A 4NFSA 4EKDA 4A16A 1RKQA 2H65A 2OY0A 4PR0A 1OFGA 1ODJA 1J06A 1S89A 4XQEA 4HVLA 1BC5A 4Q5IA 2D62A 5AW8A 2JLUA 2KLHA 1P3Y1 1ID8A 2FR0A 4K5QA 3O4RA 3TNFA 4DTIA 4XDHA 3KVRA 1PZMA 4M54A 4MYHA 4WSOA 5K3BA 1BGVA 3WP0A 3DL4A 3QVWA 4R1PA 1TJ4A 2GVDC 3HYCA 3MCAA 4GBED 1TMGE 5GVSA 5H0IA 2XBMA 4XUDA 1U8AA 2WI8A 3SU8A 5KNBH 2UXDB 3CPSA 1XXHE 4QOHA 3V9AA 4DAOA 1JIVA 4IR7A 4PCVA 3S5UA 4IDDA 2XKKA 5CRIA 3ZJVA 3CJTA 3CB4A 2QDXA 2XEDA 1TW2A 3E48A 4X90A 5T6BA 4E32A 3E5MA 4EY3A 1X8XA 1DKQA 4QTXA 3THWB 1JDZA 1XKTA 2QQGA 3MGKA 1BJTA 1KA9H 3M6IA 4IL5A 2PVSA 4NQZA 1ZNZA 5TDHA 4GM0A 3E9ZA 1YKGA 3IUYA 4H2DA 4AYXA 5DNCA 3QELB 3JD2A 3D54D 1ZKDA 4LCEA 4MW1A 1GDDA 2RCYA 3K6KA 3RVPA 5CGZA 4C04A 1KI6B 1YB6A 3T1HB 1CERA 4LE0A 4NBSA 3I5UA 3IFSA 4Y9SA 4I9NA 4ZYZA 2UKDA 3JQ7A 2PMDA 4ND8A 4UVDA 1ULSA 2WR8A 3PS9A 5DHFA 2OZKA 4FONA 2J5QA 3C24A 1QLWA 3AF5A 3RTBA 1OGJA 2Q0QA 2Q0XA 5ALJA 2C2GA 3JATA 1N2CA 3ZW9A 1FDSA 1I6MA 4HBZA 3WBJA 3IPCA 3G9XA 2PL5A 4WXHA 4F4DA 2WT4A 3MGCA 5B1EA 2JLYA 4G24A 3R41A 5DCYA 4YB8A 3MGBA 4UJ5A 3W2HA 2HREA 4KREA 4YAOA 3FW1A 3TB6A 1W87A 5KKNB 4MDEA 2EW8A 4CF5A 4EZIA 4DLAA 1U9IC 2RC6A 5E6RA 2QVZX 4AK9A 4Q47A 4IJQA 1XI2A 4HDQB 3ANNA 4V1CA 3JQQA 2DF8A 3TTTA 2FEMA 4YS6A 4ZAZA 3UJAA 2Q2VA 4BRZA 3E35A 2GAJA 4OGWA 5DCWA 5MDHA 2D3TA 1MEEA 4WESA 4CM9D 1WDKA 4Q4DA 5ECDA 3UJ6A 1EFHA 2RI1A 4IHJF 2C1XA 2P2NA 3J81A 4OA8A 3C97A 5JRZA 1ZH0A 2OZVA 3B12A 4K28A 2DE0X 5BYAA 4RYLA 3WK8A 2EBHX 1ISSA 3P4YA 3WDMA 4Q4HB 4UFOA 1SZJG 3A1NA 3KZOA 3V33A 3KQLA 1SELA 3SSOA 4BFUA 3OVMA 3HVIA 1POWA 4GGPA 1N75A 1G8JA 2X41A 2YWGA 4W1SA 2JFXA 2VH1A 2XYHA 2BFMA 1JL3A 4WY2A 1U7UA 3D02A 3W8EA 4RA9B 3WYCA 2AOVA 2BTOA 4RTNA 4JX8A 5LMZA 2EKDA 1YSCA 4DIMA 2O0LA 4W5RA 5HFJA 3H3JA 4GPEA 5AUOB 4GX5A 1Z5PA 4HDSB 4XQCA 4R41A 3K53A 5HZGA 2EG5A 4RLQA 3R7WB 4AKIA 4HWRA 1GNVA 4PZUA 1C30B 1E3JA 1JJVA 1CG6A 3M6UA 3D0KA 4LJ5A 4RLSA 2UYOA 4JI5B 5BMVA 4YQFA 1A98A 3ELWA 1IIBA 5BW6B 1M76A 4GI7A 5JAHA 3TIGA 3FG9A 3UUEA 1N2SA 4P3NA 1IHDA 2FETA 2W6IA 4ZICA 3C0KA 4G8BA 3FUWA 3I0NA 4UBOA 1IRIA 3OFJA 4R9RA 4JYAB 4K9KA 2ATIA 3HYNA 2XB8A 2P90A 4I6EA 4LJYA 3EGWA 3WGQA 4KIGA 2O8DB 4LV8B 1KDYA 3RJ9A 3SS9X 3W1EA 4MV8A 4PGFA 2AB0A 3P4XA 3ROXA 1G6Q1 3ZGYA 2G28A 2XXAB 2PLAA 1N3BA 1IN5A 2X9GA 4KC0A 2I4IA 4XZ3A 3TW8A 2BM8A 4E5DA 4I4NA 3RYHA 1DJPA 3BJZA 1Z2OX 5A3JA 2LR0A 3UNXA 2C2BA 1RU3A 3WRVA 4YPOA 3RFVA 1HBJA 2OGSA 2C00A 2AEEA 3FZYA 4DPLA 1MD9A 2WKQA 3CZQA 3LQ4A 3AYZB 3BXGA 1X7DA 1JMVA 1Z37A 2B5WA 2W6MA 3NKFA 3U3KA 5FTLA 1UC8A 2PKXA 4KSYA 3M70A 2I7VA 4PF1A 1BE1A 2JAXA 3ILSA 1GQYA 5L45A 3DOIA 4X1YA 2GNAA 2P79A 2OILA 5MFZA 4IRXA 2E4AA 5IJZA 2BLNA 1CEEA 4IZIA 4PTYA 3N7TA 2C78A 4INPA 4DNQA 3K9QO 5FWYB 5FX2A 3BCRA 2JZNA 2WJAA 2AG8A 3WBBA 3GNLA 4K2HA 1E5VA 3PC3A 5DEIA 4BE7B 5DK4A 1ILWA 1JYSA 4EW6A 5CVEA 1NMQA 1TZBA 2CXOA 5CDUA 3KKMA 3TYXA 2J0UB 3MM4A 4N7BA 4TZTA 2J31A 4M1EA 1TEXA 3ICOA 3JQBA 4NZPA 4C78A 4EJMA 4P2GA 1W25A 1F60A 5ELMA 3E9YA 3D43A 5K8TA 1QDEA 4P92A 1I14A 1W0CA 1TJPB 4Q3OA 2NVUA 1OC4A 1QVWA 1UKEA 1NIJA 3C1UA 3QK7A 4KWEA 4US1R 5IC5A 4OSOA 5ALTA 1FDUA 4TX1A 1YZFA 1L6RA 5HKKA 4XM0A 3SSNA 2H0RA 1PL8A 3NKVA 3MS4A 3HBNA 5DCLA 2ZETA 3IKVA 4S04A 1A9XB 3NORA 2V1XA 2Z1MA 4NU6A 3ZBUA 4F97A 1E1CB 4BAUA 4YFVA 3JQAB 5DHUA 4KX3A 6ADHA 1Z74A 1JKIA 4PZ9A 3O4VA 2A9RA 3DFIA 3H3FA 1KKUA 3SJBA 1NN3A 1YQDA 3ZHZA 3AERA 3F9RA 3KM0A 4J49A 3THXB 5E9WA 1ZY2A 3EX7C 2MYPA 2OQRA 5IX8A 1RSZA 2M98A 2QRHA 2XYGA 3EZYA 5KWIA 3H1TA 2IXEA 1MVOA 3PNVA 1T91A 2O4UX 3ESYA 3RS4A 4R8SA 3U56A 3EPHA 2NGRA 2PWBA 2QRKA 2EFCB 3KZCA 4X41A 4IG4A 1Q0UA 4LRTB 4Q48A 1KAQA 2P6NA 4BN4A 3F8WA 2QJRA 4URFA 2E4VA 4Q93A 2W2XA 4E5NA 4U9UA 5F12A 3KHKA 1RZVA 2OORC 5EZYB 2X4DA 4BLPA 3Q9SA 2WIJA 2Y05A 4N6NA 1DXOA 4LV6A 4MUJA 2ZLBA 4Q4LA 4D4LA 4QXRA 1MR3F 1UAYA 2GJ8A 2ZBUA 4ERXA 2PUCA 1SCIA 3KIPA 2RHJA 2J0QA 3MGGA 1LTHR 3PPXA 1Q7EA 3GEDA 4NC9A 2ODPA 5EWJB 3V7YA 3PXCX 5HKAA 3AIKA 4XVRA 3RPEA 5CLJA 3SD7A 2YWRA 5G3YA 2JFPA 4D57A 3U4QB 3NDBB 3L01A 1JH9A 4S1OA 3TRDA 1FVOA 3ZD6A 2XNDA 2VK4A 2ZS8A 1FJGB 1EK0A 4C05A 4I4TB 1NYLA 3ZH9B 3TZHA 5HHTA 5A5EA 2NP7A 1ZZGA 1UXOA 1NI5A 2HIMA 2PGAA 2PMBA 2FSSA 5E1BA 3DLTA 3K35A 3BT7A 4QM7A 1ZC3A 1V8PA 4I7EA 3DR5A 2V6MA 4E3WA 3GAFA 1QG4A 3OIYA 3KYDA 2O7RA 2W2LD 2OCLA 2H9AA 2JGKA 1H23A 1GRRA 4L57A 1K5HA 4O5OA 2PRJA 3L7CA 5LUAA 3H1BA 4JIGA 2JGEA 4BNFA 4RKWA 4JL6A 5CCDA 4OREX 4RH3A 3Q7RA 1D07A 4M8LA 5DYIA 1YL6A 4F21A 3ZS8A 3OX3A 4DVJA 1J39A 2E37A 2UZ1B 4BL5A 1E7SA 1T9AA 5DI3B 1VPTA 2GARA 4MR7A 1OZGA 2IXBA 4WK4B 3HVKA 4KR9A 1JU4A 1UWKA 3AESA 1PGQA 4IHQA 3T4UA 2F67A 2CUKA 5AI4A 1A8SA 3QKWA 4GM4A 1U7OA 1F9AA 4B83A 2ANBA 2GRJA 2QPOA 3OLVA 1N2GA 2BM1A 4S3MA 5IK2A 4MKFA 1YZLA 2V7PA 3W1VA 4E5KA 2VZEA 3GDWA 1LRKA 3O8RA 5CA0B 3ER8A 3X1JA 2CDBA 2BVNA 1QYRA 5LQSA 3ZDRA 4OH1A 1PK8A 2EYQA 1GTVA 3JYNA 3VR5D 5A1TA 1I7QB 2FN9A 1H1LA 3ZEIA 2BTQB 4HAVA 4R98A 3UJDA 1IK6A 4Y18A 3Q6IA 1P9RA 1R5BA 4BTLA 5F2OA 2CVPA 4C7OA 2YWHA 5HKKD 1QZZA 4OJQA 1FZQA 3M6LA 2VJAA 4H3HB 1RC0A 1KL7A 1EDEA 3E3NA 3IRUA 2EWWA 4ON9A 1IOLA 4WW0A 5EWMB 2YRFA 2J33A 5JJBA 4W1RA 3OMXA 5E3HA 4UQOA 4DG5A 1LX7A 1MQSA 1A4UA 1V7ZA 5EMNA 3WTCA 1ZGBA 3P94A 3WZMA 9GPBA 1DBWA 3LXMA 3RTAA 4LMRA 4EG3A 3HUDA 4YAIA 3ABQB 3D3NA 4NZMA 1XCBA 3Q0IA 1WPRA 4LOJA 3F7TA 1BH6A 4GVXA 3MAGA 4WZ6A 2B3TA 4PHGA 1X9HA 4N7JA 1KFKB 4YK7A 4N5IX 2B83A 3ZYCA 2X8JA 4JJZA 4QEZA 1KVSA 2O2SA 3IOCA 3F49S 2IEBA 1WXXA 1QS0A 1CVLA 1DC5A 4Y6PA 2WD7A 3KPWA 2JK0A 2VF4X 3M2PA 1R8JA 1FDOA 3VOSA 2FPIA 2RGNC 5KOJB 1HEIA 3TSAA 3SIXA 1I7NA 3MG9A 1W8IA 1ZONA 2KE5A 4GL2A 2J3MA 4J4HA 1LSSA 4RVFA 3ERCA 1TPZA 3G85A 3FWNA 4F9TA 1WD5A 2IYEA 5J47A 1LBHA 1IXYA 1ZEJA 4J0GA 7AT1A 4QSMA 3HJBA 1I4OA 2EKQA 2VYCA 1D8TA 1ZWKA 2BEVA 3L7NA 2R7MA 3N2EA 4DLPA 1CUIA 2PGIA 3G8AA 1T3SA 2AOUA 3HO6A 1ULAA 4R01A 4Q7LA 5T8KA 1Y8RA 4BJ3A 3RYCB 3K92A 4TXNA 3QA3E 1L4FA 1B41A 5JBIA 2FUG6 3NH6A 2ZIXB 3ADPA 4DBVO 1DNPA 1I3CA 1KYYA 1TVMA 3DCNA 4MSUA 4X97A 1Y3FE 5CW1A 2JB9A 5I9MA 2CLIB 4H6WA 1EXDA 3N2LA 1SUEA 3OZGA 4PLTA 2GEJA 4L0DA 1LFAA 4U7TB 3ZI0A 2P4SA 1WAMA 1TYBE 9ATCA 1XPOA 2YNMC 1N6NA 5E4FA 5JYBA 4FOTA 3M6VA 4BCCA 1CQPA 1R8QA 2R47A 4JLWA 1SB8A 2NU9A 2Z5VA 4QC2A 5D1HA 3O90A 4YCNA 4US2R 1FNSA 4HWOA 5T41A 1OWMA 2FHSA 3HCWA 3UT5A 3ZDFA 2J3IA 4PFKA 5B55A 1NXTA 3S27A 2A5FA 4AJOA 2IIQA 5AHRA 4Z5XA 4Q6WA 4C7BA 1CDDA 1O9BA 1P9LA 2DPHA 1M34B 2OXRA 3AQIA 3GJTA 4HQKA 2EV9A 3B8EA 2ZUVA 1DO0A 4DB2A 1MX3A 3TL6A 3ROPA 1JHRA 3L1IA 2KJQA 2WJ3A 1XP5A 2PG3A 3ANLA 2E4YA 4GOMD 4OXQA 4KFRA 2YJ6A 4G63A 2IYXA 2O2IA 5DM1A 2QTVA 4LHSA 4CKXA 2PMCA 4EJFA 3VAYA 3C7DB 1NJ8A 5JWOA 4X8HA 1S2DA 1QUEA 2X4LA 3RFXA 4D26A 1USGA 1AKTA 3DD1A 3PF8A 3DBLB 1CY7A 1K3TA 5BR7A 2P9EA 2Z3ZA 3DOEA 4I9GA 3M6XA 4PLFA 2FP4A 2JLXA 1QPZA 4UHEA 5CT4A 2AFHE 1OX6A 2NZYA 4RGVA 5DGIA 4FWBA 3ECAA 5EQDA 4B46A 4CDNA 1EDZA 1PJ8A 4DKJA 3T1OA 3PNLA 2UVDA 3QPWA 2GT1A 4O4HB 4MVCA 1BWSA 1O7JA 1QOPB 4MMZB 4JA0A 3GC6A 3WNQA 1UR5A 4A23A 5BSMA 4EY6A 4RV4A 4AY6A 3UVEA 2AYZA 3EUFA 3SM9A 1E2LA 3DZKA 4LWOA 2BISA 1I24A 3HNPA 4LC1A 1PW5A 1FB5A 1X94A 4K6FA 4MGZR 4MUFA 2XWBF 3G2JA 2SHKA 4WLOA 4UFPA 1BJRE 1KJ9A 1Z0FA 2PWPA 4O4LB 4KR6A 3TINA 1M10A 4XIJA 4WOBA 3FSGA 4ZZ0A 2C2XA 3GF4A 4H7HA 1MBZA 3I30X 4G0PA 3R0JA 4RSHA 2I91A 1YB7A 3C3DA 3CLUC 3EXG2 5ALKA 3GH1A 4D44A 2QRNA 2YBEA 5EJ7A 2OG2A 3HWX1 3BAZA 5LZ4A 1NJFA 2DQZA 3MWYW 1YL5A 2PWAA 4AJKA 1M6EX 1VXOA 2AFVA 4CEHA 5B3KA 5JNRA 1O96B 2JPDA 1E94E 1ZUNB 3BQNB 1Z07A 1QIIA 1ZMTA 4HNGA 5JAOA 2FSFA 3OAAD 1MO4A 3TBFA 5IPFA 1FFBA 1TAQA 2HF7A 5AOCA 2Q9UA 3DEAA 2BKLA 2L0XA 4I4LA 2Y4OA 3KLNA 4HH4A 4UU0A 1SG6A 3ED1A 4FGKA 3H5LA 1KI2A 4MUAA 1RP7A 4PNZA 1T6YA 3BDVA 3DO5A 4FMPA 1CRZA 2GXUA 2OGTA 2D0DA 5NLLA 4EJ2A 3W9YA 2JGRA 2ZBPA 4IPTA 1X8KA 3OFND 1YU9A 2NVUB 1ZA2A 1RP1A 4NBKA 4D9MA 1KDRA 4P35A 1YGYA 3MIZA 4HB4A 3STYA 1C41A 4D9EA 4K40A 1TIKA 3ZIAA 2XUHA 5B3AA 5CA1A 2QD5A 3VAZA 2XQVA 1P7WA 3CLRD 1IY2A 1EP9A 4INOA 3ESAA 1JLLB 5EVCA 2HK6A 3QW4B 1V8OA 2P68A 2IXTA 5DGCA 4IQFA 4P4SA 1R10A 4AKEA 3LKDA 5K4HA 1SBQA 1M9NA 1CQZA 1MPXA 1UJMA 5K4AA 3RSHA 2BM0A 4M1TA 3UAOA 4KUGA 1H8EA 1GD1O 2GPSA 1TNDA 3ND9A 5BR4A 5AVQA 4E2ZA 2ZSKA 3FN4A 5CNMA 4OP3A 4QE3A 3K5HA 1B0UA 5GOTA 1FMJA 1ZM7A 1T5TA 4GOXA 3IOMA 3GLFA 3ELUA 4HDKB 5FUWA 2JC3A 5FJIA 4CM3A 5AVUA 1KQNA 4YAFA 4ES6A 3QBVA 1KHTA 1G55A 1PV4A 3UTDA 2AVDA 3TR5A 4BQPA 3GFPA 2PKWA 4LZPA 3Q72A 2WMDA 3NANA 2C2WA 3SYKA 2XXJA 2GD1O 5B6PA 4B4WA 1VCNA 4WERA 2LVBA 4RACA 4TLMB 2J08A 1E9BA 1Z35A 2B36A 4KQWA 1HX7A 2HI0A 3ISVA 5EIOA 3TM5A 1SEPA 5I7RA 2XXAA 1OT5A 2C5SA 3QMWA 1PJTA 5ARCA 4ZVQA 1FDTA 3CX8A 2IOQA 4LNUA 1XHEA 3H2HA 5TY0A 1I1OA 2WLTA 4FT2A 5CFZA 4CLOB 1Z9BA 3T38A 4B3JA 1VL8A 3O3MB 2ORIA 3ONFA 5FBQB 5K3DA 1ISGA 2H3EA 2I3DA 2XJ9A 5FNZA 3UMMA 3AEUA 2EKBA 2L17A 4YC7A 4BO1A 3TTSA 1YVEI 2YHBA 1KZ4A 1LBQA 1NE2A 1OJLA 4L5IA 1M8PA 1D0VA 2NU6A 3JVVA 2A2ZA 4PIMA 3CGWA 4B4UA 1YKSA 3SF8B 2G70A 5F4BA 4BMOB 2AC7A 4B3DA 3SVLA 3GLRA 3QVUA 1QTRA 1W47A 3KYDB 4JFAA 4KAJA 4RKRA 4ZRNA 2Q6TA 4E12A 1DIGA 1L1EA 3KR1A 4MUGA 4OHBA 3RLFA 3SG0A 2PGXA 2OENG 5FTJA 1OZHA 1P1KA 4F5WA 2C7OA 1SUSA 3GPIA 3KVVA 4ZZIA 3LRTA 1YZQA 2HMYB 5KSYA 5L3QB 2A9FA 3L1VA 2CHVA 4UVEA 4LEIA 4Z7JA 1AUOA 3ANSA 3CTMA 3MCTA 3R6TA 4Y6SA 1IRXA 2D54A 3K71B 3D7MA 1R7RA 4C06A 3OOHA 1L4NA 4HX2A 3EULA 4M99A 5KNBD 4O33A 1J97A 1OR8A 1I2CA 2I9PA 2YC4C 4RJKA 3UV7A 3JZDA 5JJCA 3F7OA 3DVAB 3GDOA 3QMPA 5EN4A 5FO0A 3ZYZA 2PX4A 2HBYA 3ZGXA 3OLQA 2ZSHA 3A1CA 4M8KA 4OBXA 1SIBE 1TAHA 4RNDB 2CN1A 3KUDA 4YJFB 4RF5A 4LGMA 1RLJA 1DKRA 3W9SA 3GMIA 3NRJA 5IT9A 4E5PA 4OYYA 3WMRA 4FI3F 4NU0A 3P97A 4IJWA 1VE3A 3UCFA 1VBFA 4GWGA 1PLLA 2E1RA 5KDOA 3W34A 3PRHA 4EDFA 3LH5A 1AK2A 1NF2A 3QKSA 4FFNA 3KR2A 1UMCA 1HKUA 2A1TS 1UP4A 1RBQA 2CHEA 4JT4A 4NCIA 4R2IA 2BHRA 2W93A 5L3ZA 3ZWYA 4BFCA 3QIVA 2NXNA 1VLMA 1JHDA 4YACA 2X40A 3QU4A 4UUOA 3ZI7A 1XTRA 1PL7A 1JIXA 4JENA 3GRRA 2P0EA 3CX4A 1NQ5A 3IAAA 1E1MA 4MMXB 2BHLA 3RROA 1FQJA 3RD5A 2OZEA 1DIOB 1N2CB 4IQGA 3CEMA 5T64A 1IQ0A 1RLTA 4E5UA 3LQFA 5A05A 1P7PA 4U6QA 4AKSA 3M9LA 1HC7A 1YE5A 4FWTA 2OWDA 3PXBA 3PHIA 5T4BA 2RAUA 2VAXA 3COVA 1ZI8A 2AMYA 4AJHA 1SXJD 1ZMOA 3H5OA 4BO2A 2OV3A 2FEKA 3V8PA 1JZTA 3DF7A 4OFZA 4RA6A 1NX6A 4OX9B 1Y98A 5BQ3A 1SCUA 1M5RA 1A1SA 4OAQA 3NDJA 4X84A 5AK4A 1Z34A 4MAMA 5FL7D 3FIJA 1W0JA 4BC0A 3JVIA 1G3QA 1OXBB 7MDHA 1P91A 2FK7A 3GVCA 1QG2A 1GLGA 1XQVA 1MQ8B 1UDWA 1Z6YA 3KSMA 5E38A 2V7EA 2I71A 1W4ZA 4NF2A 2ZJ7A 4H3VA 4KQ1A 3O8QB 1RIIA 1D4OA 3FWKA 2LPMA 2WFLA 1RVDA 4BZQA 2Z9CA 1SWWA 1PDWA 3BHJA 3TI7A 1XNJA 3VKGA 4YJGA 4GI2A 4XYMA 3FUXA 3WICA 3HTXA 4QYWA 3B52X 1JR3E 1QWSA 3VYRB 4A8JC 3PYXA 5SZJA 4BYMA 3ASYA 3OM9A 3VPCA 5LL6P 1N3IA 3L8EA 4UAJA 4DDWA 4P38A 4Y2JA 1KC1A 2XVYA 3HJAA 4H7JA 3ZE0B 1B8UA 4W5NA 5HIMA 8GPBA 3KQSA 2AMFA 3A6HA 3D0QA 3O9VA 1M72A 3JYQA 4CMEA 3ENKA 1EX7A 1KI9A 1C0IA 2BSXA 1CCWA 3II6X 3PR1A 4OQDA 3RWBA 3REFA 3ZHSA 4G97A 1O6BA 1U31A 3BMOB 3GFGA 1NVMB 2YC2C 4YREA 1KYIA 1CZHA 4O02B 4OJKA 4QOJA 4QXQA 4KN5A 2FEOA 5IANA 3ORSA 2FPPA 1V39A 1TD9A 2G6TA 4WY8A 4G36A 4LE2A 4PS1A 1GG8A 3IAS1 4UDXX 3UF0A 2SKEA 2XZLA 3L40A 3VR3D 2GPWA 3L8FA 4MLZA 3EOAI 5KDDA 3U1BA 3QNUA 2JLRA 1GPWB 1GTL1 1IPFA 1MOPA 3ZWOA 3GP5A 3H5IA 4BBZA 5DI3A 1UDBA 3B9RA 4F5YA 5IF3A 1W2WB 1U8EA 2ZSAA 5AIAA 2WSIA 4ARCA 4YONB 1NBME 4DT1B 3NBXX 4DB4A 5L4LA 4GEGA 2O8EA 1OE0A 4EYSA 1GITA 4Q00A 3COJA 1VB5A 4RVGA 1QGZA 1PZXA 4XJSA 5M29A 3ICWA 3EEBA 2AFHA 5DM2A 4D6PA 1XKXA 4KZPA 1YE8A 4ZANA 1S6YA 1W73A 2HLPA 3IIEA 4ARBA 5AICA 3EZ7A 1BSVA 1E0AA 5CIQA 1U4NA 4ALMA 3DXXA 4CRWB 2XUGA 1V71A 3QF4B 2PGDA 1IAQA 1KMCA 4GE3A 4P7GA 1FFXA 3UUGA 3FYUB 3ABZA 1KZ6A 5TR9A 4IINA 2JNWA 3TUIC 4P31A 3SMQA 3IQEA 5BSKA 1CWUA 4MYTA 3GUCA 2E4WA 1NOKA 2IKQA 1YTLA 2DFPA 1HFEL 2A88A 4HDNB 3RRZA 1KP3A 3L8DA 4G4SO 4AZ3A 1W85A 2Q4RA 1PD0A 3EXIA 1QO0A 1SJ9A 4C29A 4B3GA 5C51B 2DU8A 1Z6QA 1UBLS 2AYYA 3FBTA 3ZOZA 1G59A 3KD2A 3C3JA 4L9AA 3E1SA 4F9FA 4C3ZA 4CM4A 1FRQA 1DFGA 3P0JA 3A8TA 4PU0A 2X14A 3DFUA 5AJZA 4NG5A 4MICA 1S9DA 2BM9A 4P2BA 4V03A 3ENVA 3EH1A 3M83A 3UGJA 2JCGA 4YUWA 1T0IA 4V0OA 3JAKB 1R8SA 5JS2A 3KQKA 3R2JA 2XJ4A 3INGA 1TT5A 1Y37A 1CU1A 2ZTUA 1S1MA 3R40A 1FFEA 1NTOA 1E0SA 1Q3TA 1W4LA 3CHYA 4TTJA 5BNTA 4RSRA 1OU0A 5DMXA 5BVHB 4D4IA 1VBMA 2J1LA 2QTFA 3CURA 3ZHBA 1FSZA 2IOYA 2ZYHA 1SKBA 1J99A 4IV5A 4YJ2B 3YASA 3BCUA 3N6RA 4OD0A 5EJGA 2XMQA 2W5UA 1PR1A 1IBSA 5AD1A 5JRDS 5A9TA 4BVEA 1FMLA 3I32A 4E94A 1U0SY 4LNAA 2CFCA 1QE5A 1Z0UA 4GL4A 3C5CA 3DR3A 3RFUA 1R4NA 3AHFA 2DCUA 3B3FA 4C4OA 3UXYA 4J0CA 2TMKA 3EGXA 1CNFA 1PS0A 2B30A 2EOAA 5ITZA 3VBCA 3CPJB 5CFQA 3AL0C 2HAEA 2XSZD 3HXQA 1EJBA 1K8QA 3L07A 2R751 3QEMA 3ZWXA 1NRIA 4K2AA 4AF6A 4D9BA 5HM6A 4QVKA 2W2TA 1KTVA 1L1RA 2XGGA 3WQBA 5DH9A 4MEAA 3WO0A 4H7IA 1XRRA 3CFYA 4ZXFA 4K05A 1L4UA 3G2HA 1KZYC 3D8TA 1T0UA 2YN4A 1SVNA 4OQLA 4EABA 4EJ6A 3NBYC 4IHJB 1BTOA 2A9PA 3AHCA 4PRKA 4BCBA 1DPFA 1LDEA 3DPIA 1NU6A 3I9NA 1DCTA 1H93A 2ZRBA 3QPDA 1E8MA 3A4MA 1T9HA 3K5IA 3PNYA 4Y9UA 2WYUA 5AW7A 1O6GA 2C5EA 1ZGHA 4L27A 4ZO7A 3CN7A 1O8BA 3WV4A 3GWZA 4X1KB 2WT8A 3HMKA 4MTLA 1SCJA 4J4BA 1XEAA 2ZANA 4TTVA 1YI8A 2VATA 2GPJA 3MB5A 2A84A 2PDAA 5BURA 1E64A 5FLEX 2C58A 4GBJA 1JG2A 1KWGA 3DOFA 3C8DA 3U4AA 1XHFA 3N70A 2TS1A 4JHLA 1D8AA 2AGVA 1QCZA 2J9RA 2B8TA 4H18A 2CNWD 4LWPA 2NP6A 3M89A 3A04A 1TQ6A 3DOCA 4XI9A 5J59A 2ZOSA 1DEOA 2HJSA 1W52X 1AQ6A 4G5YA 4UCFA 2GK7A 1NQVA 4A7PA 1PUIA 5AM0A 3MAAC 4QU9A 4EO7A 1NKTA 3G3EA 1HQCA 2QG6A 5EKUA 3CO5A 2CNBA 4MPDA 3VZDA 4GE0A 5CVCA 4V0LA 4FCCA 3QVKA 1PT8A 1WF6A 4RZQA 5FWAA 3X1DA 4AP5A 4U9IS 4EGJA 3PXAA 4EO9A 1DWOA 3LBYA 4QRIA 2J46A 5EFZA 3SBXA 4AG6A 4E5VA 3A27A 1D2MA 4XDYA 5F2EA 3BGSA 3IUJA 4QPDA 2X9VA 2QTNA 2ZQ5A 1F8GA 4UARA 4Y1GA 4ZPJA 2GOYA 4EF6A 2C29D 3DPSA 2MINA 2R86A 1Y4UA 1IDOA 4CKZA 1TEHA 1USUA 2PM8A 3U19A 4RENA 4MRSA 1MNAA 3RG8A 2AK3A 4ZAWA 5BMVB 2HWKA 3LZCA 3NYRA 1H69A 3RVKA 4L4XA 1JR3A 1QV7A 3Q3GE 3VC7A 3L0IB 1HDEA 2ZITA 4HYQA 4Q3NA 4CIWA 2OQIA 3D4BA 1GQ2A 1N57A 2G83A 5JO9A 3F96A 3SQMA 1SZPA 2BCGY 1NUTA 3G82C 3DD5A 4B73A 5F3WB 2VZLA 4I99A 1Z39A 1LXCA 2OYRA 3CVUA 4P8RA 3FMGA 5BN1A 5A3VA 4LXIA 2L82A 2R00A 1DXYA 2F43A 3BILA 2C9BA 2WF6A 3HH8A 4KN6A 5LD2C 2ID4A 3DL0A 1ZGGA 3TMKA 3LW8A 4FNGA 5CLLA 4EHHA 4ZI5A 4QHSA 3NWPA 1DL5A 3R6LA 1MAHA 1OV4A 4M76B 3TIFA 4DLZA 4GXTA 4B7UA 2GN6A 1L5QA 4PAOA 2QVYX 2CMFA 3PP8A 3UH1A 4AY3A 4MWSA 4NAHA 1ODSA 5DNUA 2LTAA 1M2VB 4RY8A 3LDGA 4AJ2A 3NAZA 3S70A 1DB3A 1E18A 1F2TB 1ESDA 3E3LA 1RWXA 1ORWA 3D4LA 3EA5A 4WOCA 5AVKA 3TFQA 2JA1A 1IULA 4FE3A 1N34B 4UCWA 2OO5C 2R6CA 3O8CA 5CA0A 1M73E 2OP1A 1GPYA 3ZI4A 3P9NA 4TTSA 2P0YA 2VHCA 1UAGA 4RHYA 1WHTA 1WTCA 1EIZA 4WEOA 2YWBA 3TTWA 4ZJPA 2MHCA 2CEKA 2GM5A 5CFNA 3E7XA 4ZV4A 5H82A 4BBJA 3G2NA 5AI8A 1E3WA 3IAM1 4IGEA 4A73A 1R0XA 1TTPB 3L1HA 3OO0A 4WCFB 5JWHA 3ZHQA 4CV0A 1VRVA 3JQGA 2QROA 3NEPX 3UOGA 1WXWA 4HZUB 2OHOA 4HCJA 2GN0A 1F20A 1J1UA 3FDZB 3PUIA 2ZYGA 2NMVA 3VSEA 2ZUUA 3JSXA 4BMSA 4RDCA 1TVKA 4MVJD 5FWXB 2FNAA 3A9RA 5AKGA 4UW9A 2H1VA 3BEOA 3MHPA 1EAYA 1VPLA 4BQOA 1KU6A 1XDDA 2JA2A 2DERA 5CEEA 4HWPA 4RJJA 1HNZB 3GLGA 3NBFA 4PS0A 4X85A 5JYDA 2FG5A 3AUUA 3QELA 1R6UA 3WGLA 2WFZA 2QTHA 3NV7A 4TMZA 3A05A 4XA8A 4YCLA 1KI7A 3C48A 1WULS 1GG2A 3Q7TA 1JWBB 3QFRA 4DIKA 4KUEA 2W6OA 3G7SA 4DDKA 1D2GA 2Y2UA 1DT5A 5KO2A 1R6BX 2CE2X 5EJ2A 2R8OA 3K0FB 4TYPA 1SCQA 4CIYA 3PPYA 4MLCA 5T5QA 3M6FA 4JOSA 1WP9A 4GOND 5IT4A 4TS9A 2SICE 3F2VA 4N18A 4IUCS 1P2TA 1JSZA 1E79D 3A6DA 3CX6A 4EMSA 1YO6A 1B6TA 2ZUFA 3U3MA 2AOXA 4PPFA 3CLSD 4LFBB 1RBMA 4J03A 5I7VA 1JLSA 1DUSA 1R0BA 2A33A 4MQ6A 4ARIA 3MUFA 4EA6A 2IHZA 1DRWA 2Z1NA 2ZG6A 4P4LA 2FCAA 3KBOA 3DO6A 4F7WA 1T0JB 4G1CA 1XWWA 3QEOA 3GO4A 2R85A 3LQKA 4NYJR 3V8MA 3NNDA 3ILHA 4E4RA 1G8HA 1MC5A 1AX9A 2I2WA 1C9MA 2XMBA 3O3OB 3ZU5A 4KYTA 4NJMA 4OUDB 4YCDA 3SJZA 2QSUA 1IIRA 4BQNA 4ENTA 5I47A 4CETA 4BFTA 4HZIA 4GR4A 5CNKA 2GWHA 5AJYA 3B2QA 4CR7A 4DSAA 1GQRA 1H1DA 3R76A 1FMCA 1LKZA 5JASA 3CKYA 4AO8A 3LUFA 2PEZA 4MCIA 3D5EA 5IKMA 3PJGA 3DW1X 1CZOA 5LBIA 1N6HA 3IJRA 3QYAA 1OIWA 4A0HA 2ZPTX 4E0BA 4OBEA 4EPYA 4B3TB 2XOEA 4TV9F 1PO7A 3HA3A 5K3FA 5AOAA 1OWLA 2OAGA 4UUAA 1F12A 1UZAA 2D1QA 1GQQA 2YV3A 3CE6A 3FPKA 4NBTA 3ESXA 4OY3A 1BMFD 2L19A 1KEPA 1EM6A 4A92A 1EZZA 1B16A 2WB2A 1QIKA 3OEWA 3S2UA 1MTOA 2AZ4A 3HY3A 4PRYA 1PVDA 4INAA 1V2GA 3C15C 2WICA 1NT2A 2Y6UA 5TXGA 4DMLA 5BT8A 3DE4X 1Z0KA 3CSSA 3EPKA 4XE5A 1HORA 1FDWA 2FG6C 3F5SA 4JYMA 2X5NA 2D0OB 4QASA 2VBIA 4TLDA 1GNQA 5EXEA 1BE6A 2BJVA 2XMSA 3WWZA 4QELA 4RTLA 2BMJA 1GEEA 2ESRA 2TMDA 1VYVA 1P61B 2BIFA 3OCXA 1MEJA 3L7KA 4HVAA 4JA2A 4Q7MB 5B3LA 3CNNA 1TAGA 4HFJA 3R7SA 4UC0A 3L5KA 2GBPA 1KTIA 3C3PA 5EIAA 1AUPA 2PH7A 1TM7E 3PV0A 3LXXA 4RJIA 5DASA 4AULA 2EYUA 3DTTA 1QE3A 1YJ5A 1A5ZA 1W4RA 4Q34A 3A6EA 1TXGA 3KQPA 1GGEA 1EB8A 2YHUA 3HB7A 3PDHA 3QLUA 1G98A 2QX7A 4QBTA 5B12A 4JSRA 3DKVA 2BMDA 3NGLA 2N46A 2WWXA 1VL1A 2UXBB 2P5SA 1UIMA 1YJCA 1CYEA 3QXSA 4Y0NA 3SIRA 3AW9A 3A1EA 3HB1A 3B1KA 4MPRA 5J2TF 2QLTA 1GIAA 4WHMA 3GEPA 2A92A 2P62A 1XAJA 1YIDA 4S24A 4YDHB 3E22B 3NAMA 1OXTA 1Y4ZA 1VLVA 4Q02A 3PNQA 3TW0A 4DSOA 2HMAA 4PYQA 4EGCB 3SQXA 2NV0A 5KNDA 2X22A 2GZ2A 1KEEB 2GYYA 2DPLA 4BP8A 4EL5A 2VPQA 1D0SA 4OVKA 2ZJ8A 1DZIA 4AQDA 1P0CA 2QU8A 1BQ4A 4Z8YA 3QYJA 2D13A 4YHBA 4AYWA 3HHPA 2YBDA 3BKWA 1N0VC 1NVXQ 1DG9A 3A6LA 1BCSB 1JR2A 1B15A 1GWNA 3OESA 2ZI4A 1JFFA 4EW2A 1Y3DE 3HPRA 4RQUA 4A5SA 2XDWA 4XUCA 1GADO 2B7CA 3E2IA 1BW9A 1NUHA 3SC4A 2XUPA 4RJ2A 2BCJQ 3OKPA 4FKZA 4JCOA 2C95A 3RE1A 3ESRA 2WPDD 4Y6GB 3EIWA 4LTMA 2GZMA 4MQEB 4LZOA 5LQUA 1PP4A 4IDAA 1CC1S 4LUCA 5H1YA 3UXMA 4J07A 2JFWA 3EAFA 2JHPA 3FVRA 3K0FA 3TZLA 4QJ3A 3BH7A 2GFIA 4PBTA 4EHJA 1YDFA 1SQ6A 1ZGAA 3HZZA 1XNHA 2H2WA 3DL7A 1T43A 2NUAA 4U3JA 3OCCA 1QK3A 3KYBA 1L5FA 2GN1A 4HWKA 3U40A 4PN7A 3RC9A 3JQFC 2HLHA 1NVFA 2DSTA 4ZI2A 1IBRA 5JTTA 3HR7A 2H11A 5KYXB 1E92A 1DVRA 2ECOA 2Q8QA 3KLPX 2IBTA 4Q9HA 1BHQ1 2G25A 3ORQA 1K4KA 3RV4A 1UDRA 1GPBA 2A14A 2AN9A 3WQRA 3DZFA 4TN5A 1XLTA 4WK6A 2P67A 1FU4A 3CIOA 2X3FA 5DDIP 621PA 4YIHA 2PS1A 1KHHA 1TGVA 2PYZA 2IC5A 2PVCA 2H4ZA 4LDNA 5DP1A 1LB1B 4CG3A 3OMWA 3TECE 4NSNA 4Y1RB 3G5AA 4BJHB 1MIHA 3QYFA 5IT5A 1SOMA 1XLVA 3CS3A 1ESZA 4BVHA 1W0KD 1KI6A 1WPQA 2Q8PA 1GTMA 3L0PA 5AKEA 1GDHA 3IL2A 1SQFA 1JVNA 1V11B 1U8YA 4NY1A 1CLUA 5F5NA 5GJWC 3PHCA 3BXEA 4JI6B 1Q0QA 4E2XA 4NE7A 5FBWB 4DZTA 3AFGA 1NVWQ 2G0TA 2PGNA 2DFKB 3UJBA 1CF4A 5KVQA 2YZNA 2WM2A 3DEKA 3DDNA 2IDZA 2AWOA 5EJFA 1JYEA 4RKYA 1TM3E 3L05A 3L84A 4J0KA 3VSDA 2GZRA 2WOOA 3P1JA 5JFGA 1N7IA