3WGLA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 90
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wglA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wglA01
5JH7B 2R751 4YJ2A 4B46A 1TUBB 1W5FA 2RHOA 5KX5A 5CA1A 5LOVB 3R4VA 4X1KB 1Z5VA 4U3JB 4ZHQA 3RYCB 5EYPA 5KMGA 3JASB 1W581 4LNUB 4YJ3A 4B45A 2Q1XA 1TVKB 4X1IA 4X1YB 5IYZB 2RHJA 5JH7A 3RYHB 4YJ2B 4TUYB 4TV9B 5CA0B 4FFBA 4IHJA 1OFUA 5LYJA 2BTQA 3VOBA 3ZBQA 4EI8A 5JCOC 5J2TA 1JFFA 3HKEB 5IJ0A 5JCOA 5LXTB 2RHHA 5J2UB 5ITZA 2Q1YA 4TV8B 3JAKB 5EYPB 3VO8A 5KMGB 5CB4A 4I4TA 4E6EA 4EI7A 2XKBA 3N2KB 3WGKA 4X1YA 1W5AA 2RHLA 4M8IA 5FNVA 3HKCB 5JVDB 3RYHA 3UT5B 4TV9A 5EZYA 2GVIA 4IHJB 5CA0A 4O4LA 2VAMA 3N2GA 3M8KA 5J2TB 4O4JA 5GONB 5LA6A 2VAWA 3WGJA 2BTOA 5J2UA 5KX5B 5LOVA 5MN4A 4X1KA 5EIBC 4O4IA 4WBNA 5LP6A 5BMVB 5CB4B 4I4TB 1W5EA 3JAWB 3JARA 4YJ3B 4HNAA 3UT5A 4EB6A 3HKCA 5JVDA 3HKBB 2XKAA 2VAPA 4X1IB 4O4LB 4F6RA 4DRXB 3N2GB 4KWEA 5C8YA 5MN5A 1RLUA 2BTQB 4O4HB 5LYJB 5LA6B 4I50B 5IJ0B 5JQGA 4WBNB 4ZI7B 5BMVA 5LP6C 3VPAA 5ITZB 3JAKA 3E22A 4ZOLA 4DXDA 4HNAB 4EB6B 3HKBA 3N2KA 3JATB 4TUYA 3WGMA 5FNVB 4U39A 3WGNA 3JALA 3CB2A 4DRXA 4I55A 4O2BB 3HKDA 2VXYA 3M89A 5M7EA 1TUBA 1FFXA 4I50A 3ZBPA 4O4JB 5GONA 1SA0B 4IIJB 3RYFB 3RYIA 4O2AA 4ZI7A 5EIBD 4ZHQB 3JASA 4O4IB 5LP6B 4LNUA 5IJ9A 1TVKA 3JAWA 3JARB 1Z5WA 4X20B 5IYZA 3JALB 4I55B 4O2BA 3HKDB 3WGLA 4FFBB 4F6RB 1FSZA 1FFXB 5C8YB 1JFFB 2R6R1 3HKEA 4O4HA 5MN6A 1SA0A 5LXTA 4EI9A 4IIJA 3RYFA 1RQ7A 4O2AB 3RYIB 5CA1B 1RQ2A 4TV8A 5JQGB 3V3TA 3C8LA 4U3JA 3ZIDA 3RYCA 5IJ9B 3VO9A 3E22B 4ZOLB 4XCQA 4X20A 1W5BA 3RB8A 5EZYB 3JATA 3VOAA 1W59A
chains in the Genus database with same CATH superfamily
2GEBA 1FP4A 4FI3F 2CDBA 3BL8A 1RP1A 2E4AA 1DAOA 4OFWA 1E96A 3EQ2A 4PCLA 4CIXA 1G7SA 3RQIA 1YUBA 2LDBA 3G02A 4I9HA 1YQDA 3TSCA 2FEAA 5LZ7A 1JJAA 4BNTA 4NS4A 3QM1A 1AURA 3FWKA 5HKBA 3TG2A 4JB3A 2ZOVA 2ZUSA 1I94B 1MB3A 3ZQ6A 1AS2A 5HQ3B 4RTKA 3VH3A 1XDWA 5BORA 3DJFA 1J1UA 1YL7A 3K1YA 4YV7A 3UTCA 3HBAA 4IS2A 1GPJA 4B8YA 1V5EA 3O6VA 2MSDB 2R4QA 2ZBPA 4D5EA 3KNZA 1MCZA 5L7YA 3WNZA 5CFZA 1UC4B 4AS3A 4ZYWA 5GONF 4WESA 2FWIA 5LXTB 3B6EA 2I9KA 2ZATA 4W82A 1S3IA 2PH1A 3MAAC 1GFZA 4IIDA 4YMWA 1M1XB 3OBYA 3ERNA 1E3EA 5DT9A 1BHQ1 1NNSA 2O8NA 1VQ4F 4DGSA 3UC9A 5L3VA 5HY4A 1F5NA 3DH0A 5CGQB 4W9MC 5EUQB 4UQLA 2DHDA 3UT5B 3RI3A 3JYQA 4WHMA 3W2IA 3F9CA 1DKOA 2YN0A 3ETGA 3N2GA 5DM70 2F7SA 2DJ5A 4ZT2A 1KO1A 2MYTA 1T9CA 3TEFA 1NNEA 1V45E 1VJRA 4G1CA 1H1DA 2VA9A 4PGHA 1ZNZA 4YDHB 4KE8A 5JPDA 2HCBA 4RU1A 1P72A 3EC7A 4JMPA 1Y6GA 4I8DA 4JFRA 3N2YA 5K6RA 4YRMA 1TLFA 2O7QA 1U3VA 2TRSB 4I19A 4YAKA 1F2TB 3AU8A 5CVTA 3BB1A 2E2WA 2I8AA 3QLJA 2CNWA 4XDZA 3E82A 3DWIA 2KSQA 2R4TA 2IODA 4O2RA 3ZZNA 3JAMM 2PH5A 5KWJA 2ZOSA 4I50B 1MH9A 2XADA 1Z47A 4XQCA 5TR9A 4X64B 4BCDA 4BP9A 2OXRA 2HJSA 4UPEA 1UI9A 4B9EA 5JAZA 3JAKA 1IY9A 1JYFA 1DBFA 4ARCA 1Z2OX 1Z8NA 3GLKA 1U31A 2CMFA 4FX5A 1YKFA 3HKBA 4V02A 3MCQA 3OCYA 4FN4A 4MKZA 1PE0A 2J32A 4OXXA 3HKDA 3NBUA 1I6MA 2DFLA 2HOQA 5EWMA 3KUDA 1FY2A 2XITA 3DFKA 1VI6A 4O4JB 1QGYA 2L2QA 1VJGA 2CUKA 2WTXA 3DMGA 1QC5A 3MCAA 4NOLA 1KSGA 3RU9A 4IGFA 1KQGA 3C0KA 2Z6VA 4Z4CA 2AE1A 4IFIA 2HJHA 3R3WA 1Q1BA 4KK4A 1LU9A 1GGHA 1E3DA 4NONA 4MVJM 1QUEA 3RNLA 1OTYA 4JVOA 2OSBA 2PO7A 3THOA 3UFXA 3AG5A 1F12A 2FPSA 3RUHA 2ATVA 4FFSA 3HKDB 2PE5A 4KODA 4QFDA 4Z2AA 3ED1A 3HU1A 3JD1A 4Q24A 5K4AA 4BQRA 1L4HA 1DE0A 4BE4A 3L1HA 2NZWA 1WETA 3V2GA 3K6SB 1PD0A 2D59A 2VCEA 5A71A 1G6KA 3UIEA 1GO2A 1KAHA 1JX6A 3K9WA 1T6ZA 4BJ3A 4Y98A 1OA1A 3MJEA 3SS7X 2EVWX 2GHTA 4Z53A 1PQ4A 3GJ5A 4ETIA 5BV0A 2D74A 2DAPA 2F8MA 1LV8A 4AMZA 3EGDB 3FCYA 5CHEA 2QRZA 3ZOKA 2BM8A 4LTNA 4X97A 5IUJC 2PZMA 4UCQA 1OY1A 4MW9A 3CZQA 4BQSA 2NXEA 2CN1A 2R8XA 1XKXA 3ITEA 3D43A 2NUAB 3AZOA 4GQIA 4PZAA 3BSSA 1DBRA 4ITVA 1QXSA 2IE0A 3F2IA 5B30A 3CZ5A 1J39A 2JW5A 5IF9A 3VOTA 3VR2A 3CUUA 1Z45A 4LY9A 2AA3A 1ZY2A 3VNAA 4LCJA 3KZVA 4MW1A 7GPBA 2CLOB 2QRNA 4C4YA 1ENPA 3B51X 1QU9A 1UP4A 2GK7A 4DMMA 5HVNA 3GH1A 1BE8A 1F0KA 1UOQA 2C0CA 4FWIB 2B83A 4UU1A 5EE3A 5F5NA 3K12A 4KXXA 2V7BA 4DQ0A 1QK5A 2AUNA 2Q4TA 4HDMA 1UWKA 1HE8B 3WO1A 5JCOA 3PYLA 4L50A 2PRJA 1SIOA 3BN3A 4ETMA 3IGFA 4CV2A 2D7JA 4DMKA 3DZ8A 5T3YA 2IXAA 3WBKA 4XIYA 5IXYA 5KQLA 1DAEA 1Q19A 2OBXA 2W2VA 1GGKA 3P20A 2P90A 4PLPA 5CDUA 2NN3C 3GHHA 3U3DA 5J4LA 1LSOA 3FTEA 4P3PA 2FB9A 1OVGA 2DM6A 4KXVA 4XCVA 5LZ5A 1W4ZA 2O6HA 1Z13A 4L57A 4ZQHA 4J3NA 2CD7A 1FTNA 5BT9A 1VZ2A 1X1AA 4OIFA 4C4OA 3D59A 1ECCA 5J2UA 4HX2A 3T41A 4ESEA 2QZZA 1L5GB 3DC2A 5GIPE 5ENDA 1ADJA 2YICA 3I2YX 3EULA 4MEAA 5DI3A 1QAHA 2B9EA 3FN4A 1VA5A 3L6DA 3GEDA 4J9VA 2HHAA 2Y0DA 2SBTA 5DHFA 3TL6A 3ZCUA 2Z2YA 3E7XA 3FCCA 3DWFA 1YNSA 2HDHA 4IDHA 3VYUC 2AMTA 4W99A 4A8JA 4A2QA 3T3MB 4AMUA 5ELXA 5FD8A 1Y1PA 4QVGA 4AG3A 4BMPB 3KTOA 1OCEA 3F8SA 1R8YA 3ND5A 2NADA 4XJXA 2FPOA 3QFRA 5THKA 4BMSA 4G97A 5DIFA 1C2TA 2GXUA 3TVTA 2XX3A 1Z5UA 2PWZA 3MAJA 3UTDA 1J21A 2C42A 4D56A 4KXLA 2V3CC 1QG6A 1JKMA 3Q88A 4G8CA 3L0IB 2P9EA 1PG2A 3M1YA 4D4GA 5JJKA 4BO0A 5JDCA 1P80A 1VM6A 1D1PA 4DOMA 3INTA 3T1HB 1JH9A 1XZFA 4E0BA 1F8UA 1RYZA 2PX6A 4BNDB 1XCBA 3VSEA 2AHRA 4PY2A 3Q40A 2IZ1A 4BT7A 1KO5A 2IGBA 2XMQA 3EH2A 4FEEA 1Y3DE 1HM5A 2I1VB 1Z4QA 3EXG2 4TT8A 4DV6B 5ALRA 4NCNA 3RT1A 5KVAA 1U0HC 4TZ6A 4OVKA 2J3LA 2QG9A 1VQVA 1SRQA 2RIPA 4I4TF 3UJ9A 3ON5A 1ZCZA 5AXDA 3UT0A 1TNDA 4A92A 4P86A 2QUZA 3LX5A 5KTSA 4OLBA 1D6JA 3USES 5BPFA 3HXLA 4C43A 3NATA 1GZ4A 3D8BA 4WNIA 5JU6A 4E7OA 4GXRA 1DEXA 1HRDA 4YECA 3MTIA 5BSKA 2JFNA 4BX9A 4CU2A 3PXCX 3WRVA 2OD9A 4IM7A 1XTQA 1S2IA 2OR3A 4I6JA 4C1BA 4EGFA 1KC3A 2G9ZA 2E4ZA 3I01M 1VG9B 2G8LA 1TJ3A 3IB6A 3NBQA 3E81A 4ILKA 4ME6A 3B3JA 1A4RA 2PKQP 4LPSA 1K8QA 1WSDA 2L18A 2C99A 2ORYA 1W5BA 2WSLA 3COSA 4PG7A 3COYA 5J5CA 4C3ZA 3GFRA 1K5PA 2FU5C 1JEYA 3WGUA 4Z51A 2ISCA 4YJ2A 3FMPB 3HABA 3M3PA 2R0QC 3JZFA 3LDAA 5HJ7A 4DJTA 3HP1A 4ACAA 1OI4A 4O59O 1N7JA 4Q93A 2BMWA 2IELA 5EIEA 1Z5VA 3KAJA 1NT2A 1X9GA 3I4LA 3AVQA 3AI1A 5IVDA 4F3YA 1AF7A 1AUPA 1O4WA 1P4RA 2C0PA 4O6VA 5AK6A 5KHOC 1DS6A 3Q85A 4MLZA 4L1KA 1RRCA 2Z2JA 4NX2A 3GA7A 4BZXA 1DCKA 4CIVA 4ZP1A 4FR0A 4D98A 3P2EA 3MWEA 3LVBA 3FCXA 2C03A 1FBNA 5AK0A 3SZMA 3DP9A 3TLKA 4DR1B 4LZWA 1HFJA 2HMUA 3D2BA 1PR9A 3I2GA 3ONVA 4NVRA 4Q3BA 4WVLA 4QLBA 1V8BA 1LA2A 3BREA 5TT0A 3OQIB 2I4OA 4WACA 4PSKA 2EWWA 4PGAA 2WZDA 4ZVVA 5C1IA 3IDAA 3IHKA 2PD4A 2CLSA 2PX3A 5J4HA 2VOJA 4Q18A 3EXFB 2XCLA 3PFGA 1BJTA 2RH4A 3RUAA 1Y3BE 5A9SA 5AM2A 1CWUA 1XNGA 2FSSA 5EY5B 2AOTB 4MV8A 3MWEB 4LUCA 4L7VA 3U31A 1I2DA 4KAXA 1ZHHA 1JBEA 4OHMA 4D26A 1GZHB 1NR5A 1VJ0A 3AR8A 2C5SA 3H13A 4KCGA 3MJHA 4OAOA 4R2HA 1KE1A 4TLDA 1UPBA 4GNRA 3O4RA 4LE2A 5F5LA 4V38A 2W37A 1RCTE 2C2XA 4WUTA 1PZNA 2JGKA 4RVGA 3C7KA 1Y6RA 2O8VA 3GDWA 3K1JA 3J80A 2DPMA 5KINB 4S1WA 5THXA 3BL5A 1OBCA 5SICE 1T34A 2Z4TA 4V3CA 2QAGC 4OJQA 2G8NA 2GZMA 3EEBA 5H5JA 2RGWA 2VSFA 1WE2A 2QD4A 4MRVA 3LTNC 5EJIA 3VGPA 4WLFA 4GC9A 4GM1A 4K9KA 3RUFA 1NAIA 1V9CA 3K72B 2NU7B 4AJ1A 5FCDA 1A7JA 5ALYA 4FGWA 3NV7A 4EPYA 2CZQA 3BJMA 1NI3A 1YHZA 4X45A 2QE7A 4ZXFA 3AOEA 1KDPA 3RT9A 2H5EA 5EHGA 1KY5A 2DULA 2O2IA 4P80A 4V0MA 3TLMA 3VOSA 4E07A 4F46A 4A2PA 3R3HA 3AT1A 1KDRA 5GZ1A 1W93A 1YZGA 4L74A 5T8KC 3S68A 2R62A 3AR7A 4ZKEA 1E5TA 1GR1A 2L26A 2GCEA 5EZ5A 5AVVA 1EXVA 5L6LB 3D3WA 1WB5A 3F6PA 3OZVA 2P6YA 3E9EA 5MN6A 3UG7A 3BKXA 1Y9DA 2XZPA 3OUZA 1K73H 3AIMA 1BWPA 4JH0A 1RQ2A 3UB3A 1TEHA 1I7NA 2WMDA 4BFZA 3HDJA 3PD0A 4BKQA 1G64A 3RSLA 1OFGA 4ZO8A 1DRVA 2Y2UA 3U7HB 1CY2A 2OBLA 1URPA 1ZZEA 1JFRA 3T7IA 5KYGA 2QHXA 2ZRHA 3B1WA 4D9JA 1XK6A 1DC4A 1Y81A 5B1EA 2NO0A 3CXRA 1W5FA 2ZUVA 1XD9A 5FTWA 3QENA 3ENNA 4KQJA 4LECA 4NBRA 1EG7A 4IDOA 1UQUA 1U3FA 1IDOA 3PQ8A 4O02B 2PJRA 3QBDA 3DE6X 3DFMA 1AZTA 1I7PA 2EFDB 2P2NA 2YZGA 3D0QA 2WM9B 3GL9A 1GUBA 5KNDA 1PUJA 1IB0A 3C9SA 4URYR 1SUAA 4WGGA 1U6IA 1AA9A 4XPZA 5COAA 1GTG1 2CC2A 3KCNA 4NZYA 1RJ9B 1W4BA 4HEJA 1PI3A 5E2BA 4MV1A 2VAVA 1YZHA 2OXCA 3HKEB 2C2OA 3ZKWB 1G55A 5DB4A 1MEOA 5HFAA 3A6DA 2DFKB 4UHBA 3C5EA 3AGKA 2DLDA 1KGSA 3N28A 4IXTA 4BVAA 3FOZA 1L8LA 1UFOA 3WNQA 3BG5A 4LFAB 2GZ1A 2FEKA 5CT8A 1ICIA 2V54A 4R83A 3I0ZA 3WS7A 5A4FS 4PYOA 4ZHYB 2WILA 5C0OE 3UJBA 4TYWA 1V4BA 3DL0A 3CUKA 1EFUA 3TGPA 1KDOA 1W4CA 3ZU6A 4GI1A 3SQXA 2CBXA 3LD9A 1DC8A 3RC8A 3F7TA 4J1SA 3LUAA 4NFHA 3D6FA 2DVMA 5EWJA 1ULTA 4M9UA 4Q02A 1L5OA 2GCPA 5BR8B 1JDUA 3AY0A 3AHCA 4PIMA 3CLTD 2AT1A 2VL7A 5EQFA 4AO8A 3JS5A 4EPTA 1FYWA 3T61A 1CQIB 4PZPA 4TSFD 1VJTA 3FZGA 1CXZA 3ASUA 3M5CA 3ANTA 1E7SA 1JLLB 3OBIA 1P9OA 1AKVA 2QSYA 2JH8A 4ZREA 3L7KA 2R1UA 2VDKB 1JPNA 1WXIA 1Z2DA 2EDCA 2HDWA 3H9BA 3NIFB 4MWTA 3HJAA 1ACJA 1IULA 3IERA 4C7OB 1FNSA 2REQA 4XW2A 1M72A 4XB2A 2VBIA 3KEFA 1NPDA 3DJYA 4DDVA 1CQIA 4H31A 3KKZA 5ERXA 1Z2PX 5K0GA 4NRDA 1Y6FA 3SYLA 2PUCA 2P9ZA 3WGYA 1APBA 1N7IA 2HIHA 3VYRB 3FD8A 1VQ1A 2PMPA 3FWHA 1AMNA 2IS6A 1OLOA 1E8NA 1JHMA 1KOJA 2TMGA 4NBWA 4FHGA 5ECGC 5LUBA 3RS2A 1GCUA 3IO3A 1SU6A 4FDTA 3ZI0A 3GFQA 1OOEA 2HZBA 2PG3A 4P3XA 4D0SA 4AXBA 3FBAA 2C9DA 3W34A 1CUBA 2AJLI 4FGKA 5FI1B 5ICEA 1O0BA 2ZAYA 1SUWA 1DX4A 4GMKA 1C7QA 1PFVA 4O2BA 3GPIA 1RTTA 4GLJA 3A10A 3IOMA 2AEFA 3KTFA 2AMLA 2C8KA 1I6WA 3HADA 4IY1A 3W2GA 4AYTA 2R65A 1HEUA 1JFFB 3LC1O 3KL2A 4Q9KA 1K8XB 3WHPA 2F3PA 3RSQA 4BKRA 1RQ7A 1P4AA 1J90A 3SX4A 4PRLA 3AO0B 2WEKA 2OBMA 4ZYUA 1CY4A 5BNFA 1LJLA 1XWFA 3NT5A 4ZVOA 4B75A 1I51A 1VHQA 4GU5A 1BJRE 2QAIA 2OYCA 4PLWA 1Q2UA 4PHCA 4XIJA 5B7GA 2OCYC 4AVYA 5JHHB 2VT7A 4M9SA 5HTOA 4DLZA 1POWA 4YUVA 3BUSA 1J8DA 5EA2A 2I3BA 5LQDA 2P2GA 1VKNA 2QRKA 3D54D 3N8KA 3UK0A 2HIMA 5FYDA 4MEBA 5BQXA 5U4QA 1DWOA 5FI5A 4E94A 2ATEA 1OXKB 1H5UA 1RLJA 2IBMA 3IPLA 5ALFA 3QW4B 3LRXA 2IY8A 1XF9A 3MLAA 1MJ5A 1O95C 4Z9XA 3JASB 1DKPA 5ULLA 1OILA 3A4MA 3H1EA 1AT1A 3ZHOA 4DIMA 4Z4GA 2CMDA 2OO5C 4RVSA 2B82A 1PJTA 2ZWPA 4G0PA 4MK4A 4J4HA 3LVFO 2ZRQA 1DG1G 3QVVA 5BVGB 5LYJA 3EZ7A 4R05A 4TL8A 4UAGA 3OQNA 3CPHA 1N25A 3OIYA 4MVJG 3WMRA 3DHVA 4GI5A 3KP1A 5FQNA 2ODNA 3DTTA 1ZQ9A 5JY1A 2EW8A 3MS4A 3CISA 3B20A 5EKSA 4OQNA 3AXTA 4X95A 1ABFA 3K96A 1XDZA 3WA7A 1W1WA 2FW1A 2C96A 3PEUA 1QDEA 1YB5A 2IDZA 1ZJ4A 5F3RA 3TBKA 3FPHA 2FDXA 1UJ4A 1NOJA 3AR3A 3P4XA 3G2KA 3SZUA 4KQHA 1NULA 1WZIA 1XHLA 3ID6C 3BWVA 1EM8A 3P0ZA 2CVLA 3CYPB 3F3MA 4RE6A 1II0A 8OHMA 1GO0A 1Q57A 4YRDA 4N3AA 1I7QB 3IOBA 1UM9B 4NATA 5AI8A 4IOKA 2Y99A 1QTNA 3DAFA 3NIGB 3VU8A 3VAAA 1V5GA 2ZRCA 3FR7A 3Q5DA 3TQCA 5AO9A 3UMRA 1E2JA 4NNOA 3KJIA 3EF0A 1BIFA 1RYFA 1K6MA 1YUMA 3TD9A 1JDSA 4F6RA 4PICA 3O4FA 1J23A 2FK7A 4LBWA 4PYMA 421PA 5I6DA 6ABPA 3O8RA 3TUZC 1H23A 2FPIA 4FCCA 2UVDA 4EW1A 1YAJA 1THTA 1L9KA 5CA1F 3DEYX 2XH8A 3FVVA 3MQWA 1V3QE 3JQGA 4R9NA 2VWGA 4CRWB 3NMUF 2R8ZA 4RPLA 2LIPA 3SHTA 1OE0A 3TW8A 1AHHA 3IUJA 3B6IA 4PIPA 1P31A 2CNNA 1J99A 1YB6A 2BR5A 2OK8A 3V34A 3RAEC 4PLHA 5E6RB 1TGVA 3TW0A 1QAOA 5HR5A 2W70A 4ER7A 1RZVA 4I7EA 4L5YA 5AHRA 4GZ5A 5KKNB 5ALHA 1J0BA 4II2A 1XBIA 1MO3A 2H9IA 2P7IA 2YFQA 2F59A 2XGOA 4ZXPA 5DOZA 3Q2OA 4QA9A 1MV8A 1U3CA 3L0BA 4IUDS 2X9QA 4A15A 1WNFA 4BXOA 5M2QA 3LUKA 3MWYW 3OZTA 1G8KA 2B1IA 3ZHXA 3IT2A 1GPDG 1IK4A 3PNPA 2CHUA 5E6RA 3NHWA 5JYBA 2IBTA 2B8TA 2OV3A 1CZOA 1DEKA 1PEYA 1E2UA 3LHDA 3Q7TA 3WGLA 1QS0B 3RTBA 4AMBA 1YS9A 3G9TA 2WE7A 4TMKA 3MSCA 1IBCA 2EX0A 4NJEB 1QF9A 4P83A 1VMKA 3IIIA 4P7FA 2AN4A 4QDJA 1EK2A 5E4TA 4OFZA 3RWBA 4ZZIA 3VZBA 4E4TA 2D0IA 2PKEA 2YWFA 1ZKDA 3L43A 1RE1A 3OU6A 4GKAA 4LJLA 3HLYA 4LSZA 4OHRA 4C2AA 5IM4A 4X60A 4ZARA 1ADCA 1D1TA 3GPLA 4QU9A 4X0EA 4KEAA 4X85A 3P5BA 1CK4A 3FWZA 3EUFA 3LI2A 5G0UA 4DSAA 3DR3A 3D31A 2PMWB 4B79A 5C8DA 3PUVA 4JGGA 4ZQIA 1T1GA 4N7RA 1SUBA 2BL4A 3N7UA 1U1EA 1L1EA 2AEEA 1DUVG 2BJVA 1XMVA 2D00A 3QKRB 1M8GA 3L1IA 3LUPA 4Z3KA 1WV1A 3KYCB 3ITDA 3W3AD 2CV2A 1YC5A 2FVXA 2HJRA 5FULA 1R1MA 2VHTA 4DIFA 4DLSA 1ATZA 4Q4JB 3NK6A 4PYQA 2UUAB 4KR0A 4MA5A 2F1OA 1HNZB 3E8XA 1J2TA 2WUGA 2WJ4A 3EEYA 3MMPA 2I2XB 2QLFA 2ZSJA 3GMDA 4GE0A 4GF5A 4CR8A 1G60A 3PC2A 1ULSA 4ZD6A 5CJJA 1KK3A 3EW7A 1TMOA 1MG0A 4TV8B 2AK3A 2LTAA 4BECA 2OXFA 5INTA 4EX7A 5CDYA 2WB4A 4OHYA 2GETA 4IIYA 2OYRA 4UPDA 4PTLA 3MRVA 3WV5A 4HDRB 4W5JA 4ZVUA 1FMJA 2JGRA 3U4AA 1ESZA 5GADl 1RI4A 3LX6A 4KXFB 4MZDA 1UIRA 1ZIPA 2Q4EA 3KZNA 5DO9A 4RIEA 2O2ZA 5LLSA 3RVSA 4DHWA 1SXIA 3R6TA 1U2ZA 2VQ3A 4HEQA 4YMGA 2NO4A 2OHGA 3W5CA 3ZLJA 2XAAA 4PQRA 1BHJA 2R86A 4NMXB 2ONCA 4B33A 4DUZB 2IT1A 2P8SA 3VDQA 3DMFA 1S9DA 3HKBB 2CFSA 3N87A 1BWQA 3H11B 3KKLA 4M0KA 3ABQB 2FOLA 2DHQA 2AQHA 2FPXA 2W6JD 3B2NA 2E82A 3QXJA 4PX3A 4IINA 4YP9A 3ZWCA 1M2JA 2XXAA 4EW6A 2H5LA 4ZOEA 1BYUA 1D4ZA 1JDPA 3LKVA 3MMZA 4C4ZA 5C81A 2GCOA 3PWSA 1RQGA 4L02A 3G0IA 5ALXA 3TPZA 5H4HA 4OXYA 1DO8A 1ZC4A 3FOWA 4KXWA 1ACLA 2FZWA 2WIBA 4Z9YA 3OIFA 1RVV1 3O47A 3V1TC 1K0FA 2GYYA 3F6BX 3INNA 3EXHB 3TLAA 1IWOA 4ZMRA 1F7UA 4QDXA 1KH3A 1M34A 4QWWA 1KAEA 1RQPA 4EA6A 2QD2A 3S2ZA 2IV7A 3SIXA 3DEHA 1WWKA 1C3OB 3RVNA 1XC7A 2C29D 3KUCA 2IUEA 2I6UA 3ONWA 3AEZA 3D0KA 3SOPA 4LYFA 1AA6A 1AY0A 4EYEA 2CDAA 5K0BA 4KPFC 4UKDA 3E18A 3MT0A 4PFJA 4EPVA 5JT1A 1ZWLA 3AUFA 5FAXA 1C8VB 3DUFB 4WKCA 2A0WA 3DM5A 3K2BA 5IAKA 1PSDA 3DCJA 1RYHA 4OU4A 4TYPA 5K6AA 2YZ7A 3K4PA 2HQOA 3QK7A 1IEXA 2QTAA 3ZXIA 2IHVA 4JYAB 4F8JA 3ZU2A 5ADHA 2QBYB 1BWSA 1L7PA 3CLUC 2WD7B 5HWEA 3SWWA 2CHTA 4PLGA 4Y2SA 2VZ9A 1P2SA 3CJQA 1ODEA 3LXXA 4MVJI 1NX6A 2BE9A 1AGRA 1B43A 5EWLB 3WSTA 2W58A 3I01A 1P45A 3ZHBA 3LHSA 4BNDA 2EBUA 3COZA 2AG0A 4MJLA 1PJAA 2CF6A 4QJ5A 4KIJA 2ZBFA 3EXIB 3NIDB 4HGRA 4WXHA 1M1ZA 2P3LA 3WGGA 5ALGA 1GG8A 1BD4A 1OMOA 2M32A 2LPMA 3M6IA 3U56A 2FQYA 4Q15A 1Y80A 3EDQA 4JKIA 4DCJA 4QJIA 4IR7A 4IRMA 1XPOA 1D0IA 1X94A 4OATA 2C5GA 1Z73A 2V9PA 2XWBF 2OC4A 2Q0HA 4KDRA 2FFBA 4C8IA 2G5PA 3D7SA 5JV5A 1KI2A 1IOVA 2V59A 3M4NA 1T26A 3ELCA 2NXJA 1EFCA 2PT6A 2X6RA 3QWHA 1KZGB 3R5HA 3W4JA 3OO1A 1SRRA 4ALMA 2NSLA 2BTQA 4MQMA 2X3UA 4OJKA 3RIYA 1PVDA 3ZHVA 5F1PA 2AC2A 3NASA 4IW3B 4Z8YA 4YYEA 2V7QD 1WHTB 4WEOA 5KAPA 2C3UA 3ZUGA 2YYYA 2YVUA 5DISB 1U1GA 1VBKA 4C4TA 5F73A 5K0FA 2UYHA 3OE7D 3WNCA 4RF2A 2QDXA 1MHTA 1UBRS 2QG6A 1CVLA 3IE2A 3C8UA 3F71A 1C4XA 1I0IA 2Z3ZA 3E5RA 2WVHA 1OLUA 1X38A 1PJQA 5DI3B 3S2GA 3STWA 3T9BA 4F2PA 5BWMA 3H8JA 3GJ6A 5DGXA 4YRGA 1JV2B 1QX3A 4PLCA 3AB7A 4U2GA 4W7IA 1XAHA 4JYPA 4X3LA 3UHJA 1S02A 1JG6A 1YJ8A 2PYDA 1AKMA 4PSAA 1M2KA 5EHZA 3ZWQA 1P91A 3DVRX 5LA6A 1O8CA 2HIAA 3S27A 1U3TA 1SELA 2GGSA 2NNWB 1JFTA 1UBGA 1X86B 2GZHA 2NGRA 4QAQA 3HB7A 4ZAYA 1RZUA 4D8WA 2PKWA 1FLDA 4PSVA 4RLHA 1QIFA 4RHXA 3Q3HA 3UMFA 1SUPA 3OSZA 4DARA 1XRQA 3QBTA 2QJTA 4QYTA 1F0PA 5HE9A 1X15A 1U8CB 2JCGA 1XD2B 1GL6A 1RLUA 3BM5A 1LPSA 4LC1A 2XUAA 3VU3A 3GF4A 4YP0A 5AUQA 1JNYA 3WIDA 3DUWA 5LQAA 1PSWA 5F3DA 4YR9A 2G36A 2DBQA 4D2IA 4A7PA 5GM1A 5BMVA 1JXOA 2JLAA 3E4DA 2XBLA 5EVCA 1BVUA 3O93A 3ZHUA 1S4QA 5ESXA 4ZT5A 1Q50A 3A3KA 3G0CA 2HLNA 4O33A 4HNAB 3TYXA 2EF1A 3IEVA 4JB2A 2MDTA 3DW3X 1JDTA 4CIYA 4NS1A 4YV0A 3UOAB 2ZRBA 3AFGA 2VXYA 4TWBA 4K5QA 2WZQA 2O3UA 2CEAA 5HEKA 3IEWA 4OHBA 3C3YA 1OC4A 3C5WP 4DV5B 1UDXA 1S1MA 3NXSA 2AMVA 4R41A 5F2EA 4OB8A 3AR5A 2OLEA 2Y1OA 4RESA 3ZD9A 1HYGA 1S6YA 1T1RA 3H2GA 3QVMA 4K9SA 5A4AA 3CGGA 5E4YA 1Y8RA 1BMFD 3K8YA 1DU4A 2J0SA 1Y8ZA 2ZYRA 3J81M 3WX0A 2HU8A 1SCNE 4NZNA 5BYJA 4FWBA 4YFYA 3VH1A 2XYGA 4YY3B 3GELA 1E0DA 3GBSA 3HYCA 1QORA 5HIKA 1OFVA 2O59A 4H1UA 6LDHA 4ZQGA 1SOAA 1OQAA 3PQDA 1W46A 3QY0A 3VR5D 1VFNA 2C88A 1ZVVA 2C9ZA 1I6KA 1Q84A 1NRIA 4HPWA 4P38A 1YDHA 1J8VA 3L92A 1PDVA 3CKYA 5EMLA 2VYVD 3T95A 1DC3A 3L82B 3HO1A 2XB2A 1DQNA 1FU4A 5DNVA 2H1OA 1ZD1A 3GHYA 4J94A 1VDZA 5BOSA 4POOA 5BMVF 3TD4A 3I3SR 1X1SA 3REGA 4GRIA 2FW0A 2WM3A 3OTQA 4MPTA 4NECA 1YVDA 3AC0A 1WW8A 3MC1A 1DDOA 3BWDD 3L8MA 4FBGA 3ZPXA 1OFHA 3KHSA 2X8BA 2AZXA 2FN9A 3V4VB 3EE6A 3IA2A 2PUWA 4NBKA 4UBLA 3QQ5A 4M1OA 5E9WA 2IHBA 5TPZA 1K68A 3BSWA 1LDYA 2PGAA 3VTAA 1NI4A 4YT2A 1BH2A 2HBYA 3G9QA 2H5IA 5JJCA 4MR7A 5JNWA 2Z8YM 5FPHA 3P27A 2QPLA 4CU5A 1QFZA 2ZBDA 4J6FA 1U7XA 4TMVA 4BLVA 2WT4A 3QWAA 4BN0A 3C6MA 2Z5LA 5CLJA 5FXMA 2R6ZA 2XD9A 3HEBA 3JWJA 3JX9A 4U63A 4TPKA 3TZEA 3WYDA 1XG5A 4UEKA 2HJGA 4R1NA 1DEOA 3ONFA 3CX6A 2ZUFA 1DKRA 1M8PA 1X1TA 1XU7A 1Z06A 4OB6A 3I5YA 3KJGA 1IHDA 4HR7A 1JDBC 4AF7A 2O1WA 4YRKA 2DYYA 4OSOA 4F97A 3I30X 2EJTA 1U8XX 3ZLUA 4QPNA 1ZITA 5J47A 1QYIA 3JVIA 3ND7A 4MKGA 1A9YA 1JHOA 4X1IB 5CX1B 4P0QB 1JHVA 3GJXC 3ZCPA 4E12A 1Q11A 1OWOA 4GFDA 4S05A 4D5GA 2NXCA 2K2WA 2OGTA 2E4YA 4XDYA 5B1IA 3HN7A 2BI4A 3DLIA 3L07A 2YMPA 3O21A 4F6LA 2ZM5A 2HWYA 1A9TA 1A7AA 1UT5A 2P9GA 4HZUB 2Q5CA 1T9HA 2WKQA 1OZGA 2JLQA 5FADA 3RRZA 5C7YA 3ANMA 2HA7A 2HM7A 1RAHA 1FOEB 5E3IA 3WSVA 4YXWD 2WHRA 4ZGWA 3E9NA 3SVTA 4G1FA 5TMPA 1VL8A 1GTRA 1YAHA 1BS9A 4G5FA 3T0FA 1RBZA 1I3OA 4E09A 5M7EA 4EJ2A 5AMXA 5BSFA 2OZPA 1E3QA 4ER5A 4DLVA 2OUKA 3ER6A 3DL2A 2JKVA 4FW9A 3P9ZA 2QTVB 4BMNA 3ZDAA 3AFNA 1ZXLA 5HCIA 3SP1A 2DKNA 2WJWA 3EIWA 4G5XA 4PV7A 1XZGA 4QARA 4F2HA 1NYLA 4NMLA 5C8VA 2IYUA 1G2QA 3QJGA 3C8ZA 2XNDA 5CLGA 1FFEA 4OLHA 1L5HA 3OIUA 4XWTA 1BRTA 2EX1A 3GRKA 3DF9A 3NCHA 1V35A 4JWKA 1RJEA 2A1TR 5CA0F 5F7JA 2QN3A 4KXMA 5K05A 1OXUA 1OXTA 1SUIA 2ZIEA 3CNHA 1VCOA 3DYIA 3IQIX 4M1WA 5IN5A 3VU0A 3JQFC 1BFDA 1TYCA 4L3WA 5IAJA 1THGA 4AWAA 1IE3A 1SO8A 4Q00A 1AB6A 2MSCB 1JBQA 1GFSA 1QPBA 1KDTA 2GPAA 3IOEA 3S8YA 1JLRA 2RGNC 4MCIA 3VPBA 1UXHA 2G9VA 3QA9A 2AFHE 5EJMA 2AQ8A 4DDHA 1K1EA 1PD1A 4RK6A 5JXJA 3MG9A 1G18A 1QRAA 1QH8A 3WLRA 2YDYA 3SGLA 1JPJA 3URKA 1KR5A 3OCUA 1JHRA 1X8JA 1YU9A 1RJ9A 2GXSA 3V1YA 1SXPA 1Z8HA 2OGSA 4Z8XA 4PWZA 5EJ7A 5AI9A 4Q9IA 3UQZA 4MGIR 4BX8A 1I4WA 1G8GA 1GCIA 4QHSA 1NXXA 1L6IA 2YOGA 3LCCA 2ZJYA 4MQBA 2WJJA 5J9FA 4RFSB 1T0UA 4JUFA 4CJXA 3ZDYB 3R0ZA 4JKYA 1M76A 1NXOA 5B3KA 4CL8A 1YJNF 3AOEC 2HMYB 2B3TA 2J0EA 2ZIWB 4HFJA 1ODFA 4X1OA 1DTWA 4GQBA 2Q1UA 1L4BA 3MS2A 3BVPA 4A1OA 2UYNA 1UJ5A 2O3JA 4FK8A 3PLAE 5M29A 5DHRA 4EFKA 4Z7NB 5U9CA 4DUYB 2J4DA 3IUEA 1YOVA 1EK6A 3M9WA 1IQRA 1E7MA 3WKBA 4CM8B 2HW8A 2PKRA 3TPFA 4V0NA 3D01A 1XRLA 1FXUA 1YVEI 4U9IS 5HKOA 5LWHA 3PC8C 4H18A 3NHUA 1NLYA 3F4BA 2HXYA 3UT6A 4O4LA 3TW4A 3HCRA 4LEIA 4PHGA 4AECA 1Q2XA 4MUIA 1O8BA 4ZEMA 1WO8A 4D74A 3DOJA 3TZ6A 2FJUA 4WDQA 1Z0JA 1QFSA 1ZICA 2XT9A 3HS3A 2JFXA 2REQB 2F67A 3Q5GA 1GRRA 4G1EB 1HZZC 1Y34E 1UZAA 2OQIA 1P1FA 3IPCA 3KYDB 4UHJA 1VQ7F 3CY6A 4J03A 4LFCB 3VISA 4PPGA 2WD9A 3SM9A 3K9LA 3O8LA 4M38A 5I47A 2BFMA 4O4LB 4NV1A 3IAAA 3FAKA 2PSFA 2HNAA 2Q6IA 4MUHA 2UU9B 3FPFA 2G40A 3K5PA 3RS4A 1AVTA 1U0GA 4QM6A 1Y89A 4DA0A 5BSEA 2WSBA 3GPDG 3W7VA 2B92A 5JLJA 3UHAA 1ENYA 4GGMX 4HN9A 2CNKA 4QM7A 3B12A 3UA4A 1LSJA 2VQSA 1PL8A 3WRYA 1G20E 4MUXA 2B5VA 2CF5A 4YJ3F 4BNLA 1BDBA 1U99A 3QOFA 4ARVA 9ATCA 1PBNA 4RF3A 5D3MA 5ECDA 3N53A 4O2BB 1H1LA 2GN1A 1BMTA 2O3RA 3O3NB 2PUHA 4A0SA 3R9KA 1JG3A 3GYBA 3KEQA 1BXGB 1J5EB 1E94E 1QHYA 4G9EA 1I33A 1HTTA 2Y1LA 5ALUA 3ZE7A 2B1JA 2P6NA 2NZ2A 3G8BA 2ZS8A 3L7YA 3UMVA 4DCGA 4YLYA 4RIIA 5JZOA 1SNYA 3A9RA 3L7IA 1SKMA 1NW3A 3GLTA 3U49A 1CYEA 3M81A 4MI6A 1G17A 4LMBA 1X1DA 1TVKA 5B53A 5IEBA 1D8AA 3QEJA 1SD5A 2OUIA 5DHSA 2DY0A 3PUXA 2V0NA 4HG2A 4O4LF 1NW8A 5TLSA 4FMDF 1RMQA 4XWAA 2MYUA 2O20A 4KIUA 5HF6A 5KOYA 1P0PA 4G88A 3FSGA 4UUBA 3ZU3A 4WDRA 2ST1A 1D2EA 3VV2A 3H19A 1U7HA 4Z7OB 2TSYB 1GNPA 5AI6A 4UE2A 3V3TA 1ITZA 3V97A 2YASA 3JTEA 5G1OA 4QE3A 2HK9A 3TBFA 5CDFE 4TM8A 2JG3A 2H57A 3O4VA 3TZQA 2H92A 4DC0A 4XM0A 1NY6A 2ZJ7A 1GPYA 2ODAA 2JHPA 3QKWA 4QUHA 4BMXA 3IL2A 1SQSA 3JATA 1AKUA 3LS2A 1JG4A 4JLOA 3H4MA 4MS1A 4BLQA 3WYAA 1G5IA 3U3OA 3PX2A 5ED0A 2QJRA 1NJ8A 1TUBB 3O5AA 2NYRA 1VPVA 4G0OA 3VPGA 3OOYA 3VYWA 4ZO9A 3A1EA 3E5MA 3ZGLA 4RF5A 4ZCTA 4TLCA 4UM7A 3JD0A 4EJSC 5DASA 2F9MA 1SCBA 4DM7A 2EYQA 4E08A 1O54A 2BCJQ 3ACDA 3EXAA 4ND7A 5D7BA 5JXHA 3ZDQA 1M3SA 2GZSA 3PGVA 4MV3A 4FVTA 5BN1A 3W3AH 2PS9A 3WWDA 3HFSA 1ZBDA 4HRVA 3E1YA 2WYIA 1OFUA 1D0VA 4RUKA 2YH2A 3G5AA 1Y9AA 1EM8B 1VZ3A 2QW0X 3FSEA 3NALA 2VJKA 1NFFA 2IZOA 5L53A 2QY9A 1H0SA 3L06A 4ER3A 1PV4A 1EBBA 2XVYA 2YHUA 4ZMBA 1V16A 2Z1FA 1NVKA 3THSA 3DYVA 3MJ4A 3P45A 1I4LD 2W6OA 4TMYA 4F91B 3O8OB 4A9AA 5AW8A 5ITWA 3ICEA 3B70A 2LZ0A 5JBNA 3HKCB 4OK5A 5PNTA 1NATA 1HSZA 1TVMA 3DHEA 4FOLA 3CLRD 1LUAA 4ZT4A 4P5EA 5TIIA 3NHPA 3E03A 1CQXA 1D3AA 2D1FA 2IL1A 3ILHA 1UIMA 3R4CA 4H4DA 3G2LA 4L28A 1T0BA 1E32A 1N1GA 1MGPA 1NBMA 3KR2A 2XDQA 3HDYA 3MWDB 3UJNA 2FQQA 5HXAA 1CRWG 5IHPA 5DH9A 1TMKA 3HGMA 4IUCS 3KZOA 5FL7D 5IZCA 2AH5A 4JEMA 2W42A 1MIHA 3MGCA 1M2HA 1EVLA 2AC4A 4M36A 3HP4A 4GR5A 4Y1EA 1PG0A 3SXUA 1H2YA 4ETWA 3KYBA 4ECAA 5B3JC 3NVKI 3UWKA 1X1CA 3RWOA 4A3SA 2DYKA 4AY5A 1F8YA 4KMOA 2XDQB 1J4AA 6Q21A 4IVQA 1IXKA 4WPGA 3B3QA 1FSGA 4WKBA 4K6HA 1LC3A 1WEKA 1FE8A 1YA8A 5E7IA 2D0OB 4HAUA 3PVCA 3QW2A 4HFMA 2HJVA 2FGKA 4K3VA 3CC2F 3CCJF 4YASA 5JE8A 3W5IA 2P30A 3SXUB 1WXDA 3C3EA 3NAZA 3A6GA 4IMJB 3G85A 1K4MA 1VRWA 1HDIA 1L9XA 1PWXA 2E37A 1D2GA 3DE2X 3EIHA 5LDHA 1YI2F 3LGXA 2A9KA 4M8LA 3HY6A 5SZIA 2FPRA 4MYHA 2FZGA 1R4MA 2YYAA 4PCAA 3W1VA 5ICGA 3QXGA 2RCNA 4Z5XA 3RIEA 2WWTA 4UREA 4IZIA 4IGEA 1E4VA 5GPBA 3A4VA 1HI9A 1VKZA 4BVHA 1NVWQ 5I9NA 4UMDA 1UQRA 2FEXA 3SKVA 5JPCA 3B6KA 4KVFA 1EWVA 2CXRA 2P6MA 2Q9CA 3CUEF 4H7FA 1UXKA 4Q9AA 3WQBA 3WG9A 2YJ3A 4JXJA 5FNVF 1CD5A 1S5PA 5DOVA 3WGZA 3ELDA 1DIBA 2AFIA 1QH9A 2PS3A 2QQ0A 3AL2A 4NYJQ 5KWIA 2C4TA 5CB0A 3E3MA 1DFHA 2K1SA 2FPKA 5DU2A 4HUJA 1XU9A 3MTBA 4OX9Y 1G4UR 3ETCA 1Q82H 5LXTA 1JAIA 2AHOA 3PPYA 2D7CA 3TRIA 5KVVA 3S02A 3QWFA 2YJGA 5JQGB 1M1NA 2CFRA 2R11A 2IEIA 4H08A 5DTJA 3RJZA 3SJUA 4LXHA 2GRJA 4FGSA 2CHVA 2G9QA 2HXSA 2A5LA 4OP2A 4C0QC 4EF5A 4LCBA 4XOIA 2BO1A 2ODQA 5ALMA 1IATA 1T2UA 4DLBA 4Q7QA 3GRZA 1W36C 4FSHA 1CUGA 4M4SA 3IQEA 1ID8A 4Q4JA 1QO7A 2WTAA 4URZR 3OZAA 5CYFA 2EFJA 5C18A 5JXGA 3QEBZ 1H4SA 4URXR 2ZM6B 2NP6A 1H8HD 3VZPA 5JNVA 1X7WA 2JGDB 1JQAA 4YRZA 4QXMA 2ZWIA 3GUUA 5FPYA 3COPA 2X19A 2CHSA 1PJ2A 2VHYA 1QGAA 1VBMA 1A7KA 5A3SA 3H5NA 3VGJA 1DBWA 1RRGA 1PT9A 2XQIA 4C14A 1N0UA 3MXOA 2MMGA 2QUAA 3LHIA 9ABPA 1XVVA 4MQFA 5D86A 2XMBA 3T5DA 1CUZA 4OFXA 1RRFA 5F52A 2BF4A 1U8ZA 1J1IA 1TVCA 2E6KA 3EN0A 1GO1A 1W4LA 4M83A 2VI5A 5JAIA 3GMSA 1Q0HA 5JFTA 4GXTA 4KRGA 4CKEB 3UW3A 2A9OA 3E6AA 5CB4A 4KN8A 1R1DA 2GASA 1YFZA 2H5JA 1NMZA 1FPQA 4MVJP 1GP2A 4RHFA 1JP7A 5KIAA 3FCAA 4M8IA 1ADGA 3GZ4A 4E70A 2QE6A 3HI4A 4RVCA 1UDBA 1KVUA 2J9FA 4FC7A 2IKQA 1W85A 4FE4A 4JVLA 5EWMB 3RRMA 4EFNA 1YF3A 5GOZA 1ZNWA 1EJ6A 1C9KA 1I6LA 1VCIA 1ZCAA 1EIZA 2B21A 2Y05A 3QKSB 1J20A 2HA0A 3MRXA 4HNUA 2HT1A 4UBIA 5IG2A 1QHGA 4NAHA 1BKSB 4P3YA 5CFRA 2FWBA 2I2WA 4QXPA 4WCFC 3FNFA 4G4SP 4OHKA 4FSDA 3UFXB 1A9XB 1B26A 1MOQA 1P2FA 1T5LA 2F1KA 2GARA 3NONA 1X7GA 3KKMA 1RWVA 2RGYA 1GYRA 1MJFA 1CRPA 4PZZA 2WU4A 2LCFA 5DP1A 1N2OA 4O08A 1YDMA 4FHFA 1K0UA 3HJBA 4F06A 4FCVA 1E89A 1LLFA 4H7KA 5FJIA 1G21A 2WKSA 3L7JA 1Y6QA 3DV2A 4O5AA 4BVKA 4XFDA 3VR6D 2IH4A 2EF0A 2OTJF 3P9CA 2GLUA 3E22A 4PW0A 1HFKA 1UP7A 1XQWA 2J6IA 4GL4A 5AK3A 4R6XA 4M0UA 3GA0A 2CJFA 2OL4A 3K9GA 3D3EA 1MQ8B 1WV0A 5JH7F 2ZAGA 1FVXA 4RV4A 4V0SA 4NOJA 2PXCA 1IG0A 3ZJTA 4LOLA 5LNK6 2J09A 4CF3A 1CEXA 2GM5A 1T3HA 2V7QA 2G7ZA 3VXKA 1L7QA 4G01B 5DYTA 1DP4A 5SY6A 3U4CA 1BO6A 1QJCA 2YV5A 1BE1A 4G4VA 2WUVA 5EWLA 3OTOB 2V6GA 1A2KC 1SKYB 1C1XA 5PGMA 2RGDA 3REQA 3O8CA 2YKGA 2WF8A 2EERA 3S0HA 3E2IA 1Q83A 1TW2A 2ZFUA 3WIBA 4S24A 5BW8A 1RR6A 5HJ5A 4IIHA 1FTSA 3BC1A 5IC5A 4AYXA 4ZDKA 5BPHA 2PXAA 3UY4A 2FWAA 4BLOA 1WA5A 2MSWA 3W4KA 4X6LA 1EFPA 2NVBA 3D1LA 2XJ9A 2YIJA 5GMOA 1E4EA 5BW6B 1CUSA 2O2EA 4WOKA 3HYSA 1M10A 2H1LA 4JJEA 4EHAA 2YTZA 3KXLA 3BTVA 2FW7A 5IRCD 3JY6A 3N0TA 1ZINA 2F3RA 1W59A 1W9MA 1XP8A 2FCRA 2FOIA 2RH8A 1EFHA 2JAQA 3ANXA 1G4AE 4YJFB 4BGIA 4MGHA 3TLBA 4LRQA 3ZWPA 4W1RA 1FX1A 1ZL2A 2IWRA 1GL7A 1WDKA 2J07A 1IOWA 4B2YA 1K75A 4QT4A 5KJFA 2HP0A 2JAHA 4AJIA 1NQOA 1IN5A 1V7ZA 3ANNA 4JODA 1E4EB 3HSSA 4K9LA 2CYAA 3CWZA 3O95A 2BKAA 5KMGA 4ZEWA 4JP3A 2VK4A 4I6GA 7YASA 1QF7A 2NYAA 1WSAA 4V0RA 5M34A 2VIIA 2WABA 4ZFNA 3W4IA 1KAMA 1WB4A 1T4GA 3AV3A 3CPWF 1BXRA 1UEJA 3BMNB 3SFZA 3VOBA 3D6UA 2NTVA 1M6EX 3P26A 4C21A 5B37A 1NONA 4KZKA 4O2LA 1PWEA 3LP5A 4ZZ2A 4LDNA 4EHHA 2Z83A 3R0IA 1JR3D 2FZCA 1Y5IA 2QX8A 3LECA 2BELA 3TFQA 3EXEB 5KQSA 3W79A 3AHIA 3DP7A 1ZOPA 2B1RA 4GG1A 2IXDA 3IE0A 4JLDA 4JN6B 4OHXA 5GAJA 1BXRB 4BMVA 4ENTA 3BMNA 2J3MA 1FS6A 3F5DA 1GFIA 2HI0A 3OO0A 1VIAA 1QTQA 4C4RA 4CPDA 3P0FA 1H0RA 4AKIA 1OB5A 1DQZA 1OTHA 1UADA 3UXYA 3ZWVA 3IAXA 2UUPA 1DADA 2IHTA 3OOEA 4QYXA 5BMVB 3C6KA 1Z3CA 5CHYA 5H82A 5ETJA 2XUDA 5KI6A 4AT1A 2RI0A 5E7QA 4MDEA 4HNAA 2AIZP 2JRLA 1HORA 1RFGE 2C1XA 1W3EX 3L0CA 1D4FA 2FX5A 2O1XA 2VR1A 3T7AA 2KX7A 3DE4X 5EJEA 3DOUA 3JR3A 4QXRA 4U4AA 4LXYA 2Y3IA 1XZJA 3AM4A 5GJCA 2IEYA 3KQUA 2NPOA 1YK0A 1WB6A 3VBCA 3WK5A 3AHHA 4LWZA 3PXUA 5ITZB 2GSDA 1Y8CA 2A7XA 2EEPA 3W7BA 2QI9C 3BXZA 4QULA 3JWEA 1C8KA 2QQFA 5HG0A 3IR6A 5B36A 1TM3E 5FOXA 4C87A 2IYLD 4GMXA 1OAPA 4P84A 3DE5X 3ZHTA 1Q3TA 4DJEC 3A1UA 4QYMA 1GKUB 4V1CA 1EUCA 4I9UA 1QGDA 2GCGA 1SCQA 1GILA 1S1CA 2QJOA 3AYZB 2BHSA 4M1QA 1LF5A 2D8MA 2FC3A 4PLZA 4U7WA 5MF6A 1RT9A 3GGPA 3E3LA 4GOXA 3PGMA 4IVPA 3N8IA 1OYYA 3G8CA 2H8GA 3GH3A 1BW9B 1CU1A 2W4IA 4L75A 4PTYA 5FLEX 4D6YA 4HLNA 3S5JA 1E6KA 4G4JA 4OTZA 2ID8A 3MWGA 4WADA 1MDBA 2UZ0A 4QDUA 3AERA 3LUCA 3SHFA 3ESCA 1R0SA 4LX0A 1KKUA 2CXUA 2OILA 3MCVA 1FNNA 2IBSA 3EEIA 2AXNA 3U4HA 4GPEA 5AW0A 5GGXA 2GH1A 2M6RA 1ODLA 1EJBA 5FWXA 3L0DA 1LBHA 4GI3A 1Z83A 4WVFA 2ZBRA 1Z22A 3C6QA 4D9MA 4CCWA 5BOSB 2PEYA 1ML3A 3LCJA 5H83A 4A0HA 1F2UB 2VZEA 4QOHA 2J3KA 2Y93A 3OQIA 1L5KA 5EHXA 1WBBA 4D9KA 1DO0A 2FOXA 3RDPA 3DMHA 3GEGA 3H05A 2JKZA 4M53A 3TE6A 3W6PA 3BD6A 3ZCTA 4CTMA 4II7A 3CCMF 2WT8A 3ICVA 4DNOA 2ZWOA 3ODPA 5IAOA 4FFDA 4EF4A 1OFTA 1SC9A 5KYUB 4ZVTA 3EISA 1O95D 1NZDA 3NM5A 3ZLTA 3HWSA 3OLQA 1VKRA 1SBTA 5JATA 2M1ZA 3BIOA 3KQSA 1LDBA 2R5NA 4FZJA 3LQQA 1XZAA 4NF2A 3RLFA 1KZ7B 3UAZA 1EP1B 2W6ZA 4WNCA 4B34A 4ZCIA 4RTPA 3FUXA 1XGKA 2I62A 1UUFA 4RY2A 1NJGA 1FJXA 1Q21A 2L0XA 1UK9A 2B35A 1RQNA 2MR6A 3I64A 2YVKA 1T2AA 2I66A 4OQDA 3D4NA 4D9HA 4ENSA 1X25A 1A76A 2J6BA 1P8JA 3AJEA 3UWDA 3KVYA 1CKEA 4F5ZA 3DR5A 3P9XA 1B6SA 4R0NA 1QOZA 4OPMA 2YINC 5HTKA 1P1CA 5DRTA 3UXEA 2JHFA 3ZDRA 1V11B 3CZ4A 2W0SA 4ZT3A 3PEWA 1QH1B 3U1TA 2NU7A 3C8DA 3G1WA 2IEZA 2D4AA 2QTTA 3A25A 4YPFA 1LTKA 4C0WA 4X00A 4FNAA 3LWQC 1USGA 1QK4A 3VJRA 4D99A 2NUPA 4ZN6A 3UUGA 4JYMA 1E1LA 4OFBA 4AJ9A 1E5LA 2VP9A 5FHRA 2YXZA 1JXMA 2KGWA 3PC7A 1JEQB 5JPIA 3X3HA 2VF7A 2BH2A 1NT4A 5T57A 1ZL0A 5DTIA 3R5TA 2Y66A 1JAZA 1TYZA 2I4RA 3H1TA 4P4LA 3X1ZA 1HQKA 4EGCB 1VRVA 4XYLA 3B52X 1CERA 1BRMA 3OP1A 1BTOA 4BFYA 4BO6A 3DBIA 2NQ8A 4CETA 1U3GA 3WFJA 5HYVA 4NJMA 2RAUA 2R6CA 1EA7A 2BF7A 1LCIA 1U43A 5HIJA 1HLGA 2V55B 2CDCA 2CW4A 4ITRC 1FBTA 2J9RA 3B3FA 4KDCA 2D1SA 5GY7A 5B6PA 4YAFA 5I8ZA 3KX2A 5KC8A 1S2MA 4HLQB 4BAUA 2QL9A 3F8WA 3H5LA 2OCGA 1Q15A 3DCIA 3E1SA 1W29A 3H5WA 1O7JA 5DSXA 5MDHA 4MJ3A 5HPYB 5LD2B 5B1DA 3UV7A 3NX4A 4Y6PA 3GDHA 2HHJA 2V6MA 4LV5B 3CCLF 4HAOA 5BUCA 4ADSG 1XSEA 3BH7A 5IABA 4KACA 3WKAA 2MYNA 1N5MA 2IW1A 3N39C 1ARZA 3ND6A 4OYLA 1C3XA 2Q3EA 4HB2A 2QWXA 4PGFA 4YRQA 5K8VA 1B0AA 4A8PA 3CONA 4CKBA 5TX7A 1Y48E 4PNZA 2QEQA 3RUCA 1SQ6A 1Q0UA 4TN1A 5AHOA 1FFGA 5A5GA 2DFTA 3ESXA 2DTDA 5AVTA 2IFTA 1WXWA 3V8EA 3BF7A 4I3FA 4CGZA 4M9RA 1GOTA 1XNRB 3C8LA 3DDWA 4U6QA 1IV4A 5DEOA 3ZHSA 4DMFA 1C1DA 3LZ6A 4RAQA 1TCUA 3CH7A 2F1IA 2YHBA 4NCIA 4W6ZA 3D1JA 3OQHA 1E64A 4XVUA 2GRUA 1HC7A 3T9AA 4A0GA 3ETEA 1CLIA 1PJRA 4YEDA 3U80A 4CKBB 2GX6A 3KPYA 2M6SA 3ETDA 4C4XA 2C9YA 2XA9A 2IU3A 3KFLA 2HLDD 2VNHA 4L5AA 1IPEA 5KOHB 3D8SA 1E18A 3PVZA 2O4CA 3QMVA 3W5JA 4B81A 1OTXA 1VJ5A 1VQMF 2IXBA 1L4LA 1B1AA 3DVSX 3GLIE 3L8HA 1AQUA 4QUBA 4XTRA 3K09C 5C31A 2SKCA 1Q0LA 4ESOA 4QREA 2ZJ2A 1DKNA 1RZRD 4BE9A 1D4AA 4TWJA 5LN1A 2JCXA 1SEPA 4G25A 3DTVB 2YRFA 3PEVA 4FUQA 1VHLA 4YIHA 3LOPA 3AVTA 1MB4A 3I6QA 3YASA 3E84A 2E87A 3JVHA 5AJZA 4C7OA 2BBSA 5GP1A 3GDFA 2Q27A 3VZRA 1TVEA 3VSAA 2ANBA 2JIQA 2EWCA 4MXDA 5ALOA 2CCGA 1Y3AA 2OAQ1 2ZBQA 1JKJA 4P7GA 3TO5A 1KVRA 3GGGA 3IO5A 3VDNB 4RPCA 5T4FA 1EDBA 3S1AA 2IDKA 2G70A 1JHQA 2XYVA 3QU9A 3ZNOA 5L9AA 2ZVYA 1DELA 2XYHA 4AY6A 4OUDB 1U0RA 1FA9A 2VAWA 3CEJA 2R96A 3GXOA 3SR0A 3MQFA 3DCNA 3EFHA 4XFJA 1FJ2A 4HP8A 3M1IA 1VSUA 4R1TA 1OLXB 3T7SA 1X80B 5ALJA 5HGXA 2KW5A 4FYVA 3NDJA 4MRAA 2DFNA 4QPPA 1IL0A 4DSTA 1EVZA 2RKBA 3N3BC 3V1MA 1JWAB 1MO6A 2YJZA 5KJ1A 3KT0A 4Q21A 1K7FB 1QR6A 4MRNA 4X94A 2RHTA 2BEUA 2W2TA 1J0CA 2J7KA 2CE7A 4KU4A 4QX6A 4HHEA 3BMOA 3ZWNA 5KVQA 1EM6A 1G8JA 3OM8A 3QHQA 4JIMA 4GPBA 1JTVA 4GMFA 2ZRFA 1OLXA 1TUGA 3NKVA 3C24A 3H1PA 2QMHA 1E0KA 1YMUA 4KIFA 3AFHA 1QCDA 4RTNA 4EG7A 3PGXA 3RBVA 3HCPA 2JB9A 2B8JA 4EKYA 5JYDA 4U7PB 4AWXA 1JMVA 2BBOA 3T7RA 1QDUA 4D3YA 5IT4A 3WQRA 3ZE0B 1OVMA 2Q45A 2OAGA 4OX9B 4DCCA 2AN9A 2Y1EA 4ACBA 4HGYA 1DAHA 1DCMA 1GIAA 1PHPA 1ZBQA 3N5KA 4H15A 3RNOA 2ZITA 1Z7GA 1M2OA 5FR2A 4ZV7A 4BVEA 3BEOA 2O57A 2YXLA 1PZXA 1Z0UA 1OKKA 3QMWA 3H75A 2Q3MA 2AOWA 4Y6LA 4MVWA 3BGOS 2GN0A 4E15A 4DDWA 5B4UA 1MRZA 2I4MA 3WJ2A 3M82A 3NC0C 5BVGA 4INJA 1E99A 3F96A 4TRJA 5JD5A 4W1PA 2P2ZA 2WINI 3SVLA 1KZ1A 2R6R1 1QBGA 1QRDA 3ETLA 5IM5A 3U0OA 5KJ6A 5EL0A 2WM8A 1F4VA 3G0GA 2H0AA 4AJOA 4U5QA 1UK8A 3GI1A 2C2ZA 4KFSA 2A9QA 3WWZA 2QR3A 4QXOA 3WFZA 3O82A 3UHPA 4X6XA 3QUWA 2X0KA 3LBHA 4RW0A 3T9FA 3E35A 2GTIA 3VRHA 1D5CA 2HQRA 4CR6A 5EPEA 1XA4A 4P0TA 2C7GA 3I2IA 4HS4A 3BSFA 4D9FA 3VDXA 4EEKA 1PRYA 1Y1SA 2JJMA 3GT0A 2ZTMA 3IEUA 4LOHA 3LYHA 4MKIA 4NCHA 5H02A 5JMTA 2JCVA 2NTEA 3H97A 4OAPA 5BOVA 5KOJB 2P2LA 3GD5A 1AH2A 2ZT8A 4LWOA 3EQ9A 1ZD8A 3G7UA 3LY8A 5JI2E 3VMFA 4LS3A 1R12A 1JYSA 4UCXA 2B34A 3EVTA 5JH7A 1JU9A 1WY7A 4H0NA 3E53A 2ZUTA 3UPDA 4EG5A 5IAGA 4O3MA 1WZ2A 3N0XA 4MUBA 4IQ8A 1YKSA 3ZXSA 1HGXA 3FD6A 1IQPA 3QJYA 3N2IA 4WUVA 1P9WA 3TW8B 2GD2A 3ACBA 3EG9B 3T3IA 1A5TA 2FZLA 1KQOA 1VL2A 1BD3A 4JT4A 3V9AA 1L7AA 3JVUA 3OT5A 3CRQA 2ZG6A 2AG5A 3LQKA 4BRUA 3CUYA 4OBWA 2Z3VA 4FYHA 1CTQA 3KDPA 2FSUA 1WL8A 2G71A 1T0IA 1ZC3A 3ITKA 3LY9A 3DMRA 3TNDA 3LT0A 1BROA 5FT9A 4Y8VA 1ZH0A 2WFMA 2FXVA 4DXAA 3BMQA 4FB5A 3GLGA 3S2SA 4F3KA 4YMHA 1Z18A 2VSQA 1VI2A 2XNHA 1Z4PX 2B4QA 5AP9A 5FUMA 2GO1A 5KPJA 1ZCFA 3V7YA 2IHUA 1BDMA 2GZAA 4CV3A 2A57A 2VTDA 2FPGA 5HKAA 1J22A 1KMHB 2WLSA 2V0GA 2JLXA 3EWSA 3TMKA 3GARA 1J24A 4A2WA 1PS9A 3BMQB 5DT2A 4KYUA 3PPVA 5BNWA 3CZRA 1ZI6A 4JJKA 3R76A 3QU5A 4D0LB 3O9VA 5CJPA 4DMLA 4EX6A 2O2YA 4FZRA 3ZVRA 5KTRA 1OXXK 2UZ1B 2Y1DA 4RIHA 3PFFA 4JBLA 4EHJA 1JRLA 3DZIA 4HDOB 1Z29A 1N7HA 3EY4A 4DT1B 1MNAA 1UBSB 1S8OA 3KQPA 1KYVA 4N7JA 1N0IA 1NPYA 2ZXFA 4NQRA 4YRCA 3RHZA 2BJWA 1ENOA 2BE7A 4ZRNA 3UXHA 4EMUA 3IIKA 2VWQA 3RYIA 2JL1A 3BRWD 4GOMD 4GM4A 4YP7A 5IVHA 3IRVA 2P9FA 4K9DA 1JR4A 3F4KA 3G82C 1SM4A 3CPSA 4DZTA 1M2NA 3HB9A 5JECA 3HJHA 5IKEA 1TAUA 4HWGA 2I7DA 2OWEA 4QGHA 4RMGA 4B6FA 4RTJA 2A5YB 3K6KA 3MWFA 1C2YA 3A1FA 4TV9F 4D81A 2CV0A 2XOKD 1QM5A 4CQJA 1GLVA 4IQ0A 3AEQA 5G4VC 4A5OA 4C4PA 5AVZA 1WBJB 2QX6A 2BFPA 1DIRA 3H1BA 5TS3A 1N9KA 2WALA 3R7FA 3ZE1B 3Q8KA 4TV8A 1C7FA 1WG8A 2AXPA 5B3JA 1NBIA 5BSGA 5FAKA 1H48A 5F12A 5KYYA 2AOVA 5IJ9B 4RPHA 5KTTA 1NW4A 3B78A 1V7CA 2BGJA 4K9MA 4L76A 4Q3OA 4HS9A 4QOGA 1X19A 2RKWA 1U98A 3OUUA 1PSZA 4XOUA 1XMOB 3WLMA 2FLKA 3DEAA 1Q95A 5GAPK 1C7IA 1XCLA 3GO4A 5TSDA 3AEQB 3PEFA 1LF0A 3AJRA 3C5CA 3JQQA 1ZU4A 3L8FA 2WUWE 2C04A 5LZ9A 5A04A 1UDRA 4ZYYA 2CL0X 2HWWA 2IYFA 4JBNA 4PZUA 3RM3A 4EUFA 5JO0A 2AV6A 2ZETA 1L8OA 4BO7A 3CO0S 5BWBA 2QIPA 3BMCB 3PICA 3SKYA 3N3AC 4PBTA 2HTFA 2P0YA 1HETA 3L0OA 4KO1S 3FUUA 3M2TA 1VCNA 2XAUA 4BIMA 4DZZA 5KQRA 1YQXA 2ADFA 2Z5VA 3EIXA 4YP5A 2WDZA 2YUTA 3KETA 5JAUA 4NZZA 1QAQA 2W93A 2UV8A 4I4CA 2ZSEA 4PZLA 3QOYA 4GI2A 4LHEA 4QUAA 5CM2Z 4PLFA 5DBIA 1QVGF 4DTIA 2XB8A 5KSWB 2FGJA 1VQ8F 3PQCA 1A9XA 4JQYA 5C51B 1DAPA 1P18A 5AK5A 4E5PA 1U1IA 3NIBA 1XCPA 2OGWA 3FUCA 3WJ1A 1N36B 5A5FA 3JCMM 2RG7A 4PO1A 3SC3A 2WICA 3EFBA 5CMLA 2TMYA 1IVNA 5E1DA 3QRWA 2Q0XA 1SQGA 1P7PA 4OLAA 1M73E 3BQ9A 2HA5A 1YQUA 3MXTA 3TMYA 4HPJB 5EIHA 3PQ7A 2ASEA 4WLNA 3TMAA 5CDGA 5J1SB 2B33A 4I9NA 3NUQA 4AL4A 5E1BA 4MUFA 3W9BA 4O5OA 4R7TA 1KAOA 3OKPA 2ZSBA 1AUOA 1XL1A 3FZQA 3I4CA 1BE6A 4BFXA 1UFKA 2E1RA 4Z0TA 1WF6A 1QLHA 3H9JA 1M8FA 1V5WA 3PQ5A 4L4SA 1K6JA 4CDMA 2EP5A 2Q5EA 2PS1A 3UF0A 1KAGA 3EHEA 2Y92A 1QD9A 4JR2A 4TKUA 4WBNB 1ATIA 2GN4A 1U0LA 3OF3A 2CVOA 4ZOBA 3TH5A 3UAOA 1AS0A 1PL6A 1JYEA 1LFDB 2GJ8A 3OHPA 3Q7SA 4Q12A 1YJ9F 2OCLA 1Z6PA 4CCYB 3AF4A 1K66A 2ZYGA 4FFMA 5EFZA 2AZ4A 3EGDA 3WA6A 3EXIA 5FNVB 1JAYA 1KPIA 2R6JA 2W2PA 4NR0A 1XZMA 3M5PA 3RVDA 2XVMA 3O4GA 4DR3B 2YNMA 3A4NA 3OF5A 5GONA 1TA0A 4JLVA 2FZEA 3RIHA 1QDLB 1B6GA 1RAFA 3VYSC 1RC1A 1FUUA 1Z0KA 2OXEA 3CCUF 1P8AA 4OQZA 4RHEA 2HK8A 4JI2B 1YDFA 2FVYA 2ZR7A 2OV2A 3L04A 3K73O 3F6CA 3DKRA 1QP8A 1V6SA 5D7NA 3LM8A 5BN5A 3BE8A 2Z57A 4FIZA 3QYAA 3D54A 3VI3B 1H2BA 1J0AA 4MVJE 2V9YA 4RMIA 4BATA 2C07A 2QENA 1FSZA 3U4IA 1K6EA 4OM8A 4WAUA 4XQEA 4A8JB 3X1KA 1I32A 4HOYA 3FM9A 1QO0A 3MWKA 4UD6A 2QXTA 1GNRA 3AJDA 3P2KA 5DGIA 4H1WA 2OHWA 4NU0A 2BFEB 1EPUA 1W96A 2RBGA 1QPGA 3SDZA 2H4WA 4HXFB 4BVGA 4YT8A 3NNSA 1ECFA 5CIWA 1DX6A 4MGKR 3T0IA 4CFZA 5FDFA 1CY0A 3TX2A 1NIJA 1IH8A 3NETA 1JQLB 4KO8A 4ZI3A 1R15A 5T7BA 4N76A 4W63A 3ILYA 4UAUA 2HY7A 2P2DA 2YXNA 3NEYA 1QP4A 1A8QA 2NACA 2VWHA 2FPUA 3VPXA 4GECA 2QA4F 5SYAA 4F71A 4YCSA 1Z68A 4CWAA 1DBIA 2AE2A 4J4TA 2IV2X 1T9GS 2BISA 2PWYA 2H85A 4IPTA 4OGKA 3IMEA 2PS0A 2VRBA 3RIMA 3UXMA 1IVYA 4LNUB 1D2NA 3LY5A 4N12A 4HGQA 4RV9A 1E69A 2D8AA 2WYOA 3I9V6 3KEMA 5EG5A 2CYCA 4CODB 3PSAA 1HA3A 3ZIAD 3LTEA 4IQGA 1EK1A 3LWRC 3ME5A 3ZWMA 3B9BA 4CL0A 1XAIA 3R09A 4L3OA 3TEMA 2G0NA 3OCZA 1ESMA 4EGJA 4ZYTA 2ONKA 3RJ9A 2WWRA 2J0QA 3IV7A 1DQPA 3FZNA 3JPYA 1A5AB 4QTTB 5KYTA 3H9QA 2CB9A 1DRJA 2R25B 5CH5A 1KDYA 4W5RA 3OIVA 3RC2A 2R1TB 4HLUC 3FKQA 1Y5MA 5LQMA 3VZQA 2PSSA 4A8JC 2V7XA 4KX3A 3MTAA 2V96A 1YRLA 1VIDA 1YB1A 4PCUA 3L8YA 3K70B 4IGAA 4WERA 2DKOA 5DWVA 2BUAA 4ER6A 3CJTA 4B4UA 4BQEA 4L8FA 1RS0A 2RG1A 3A27A 4OKSA 2W2OA 1RCUA 4MX8A 1RRKA 3LKBA 2Q0QA 3R24A 1DV2A 3QE0A 2WV7A 3PHLA 4HAIA 4HF7A 1NRWA 5CBKA 2FEOA 2HS4A 4K88A 1BEEA 2OCAA 2F17A 3V4PB 1KP3A 1QHHB 1T91A 4KAJA 3CVYA 3HCBA 1P4JA 3CLTC 1Q6YA 1YE8A 4GPAA 2V8OA 5C80A 2ZCJA 4UASA 4GDMA 2JEZA 3WB2A 4L2IA 3KQQA 4A16A 4F8YA 2JD2A 1NW9B 1ZW6A 2JJ2D 2AR0A 2NAFA 3CH4B 3K8QA 3KFXA 3KXPA 4MRMB 4EUHA 3EDOA 2HS0A 1WUYA 4JP2A 2B1QA 2SNIE 3GJ3A 4LJSA 3TRDA 4UVIA 3EGWA 3E2PA 3LWPC 1U11A 3B13B 4MROA 3IAM1 3A2LA 3K2IA 1H2HA 1YZYA 4KVAA 2IXGA 4PNPA 5EPOA 5IW8A 5C5EA 2WQ7A 3E1KA 3M5DA 3FW1A 3RFVA 4G1VA 3ZY2A 2FJPA 5K0JA 5D84A 2DQ4A 1DI0A 3BZWA 1E1DA 2ZJ1A 3I9MA 5HIIA 4G65A 4EI2A 1X13A 2WJZB 2C97A 2VF4X 1XTKA 1ZPDA 1DB3A 1UBEA 3OZCA 1SVSA 4E31A 2PQ0A 3OTGA 5EJ9A 3PDJA 2XW6A 4K40A 5G1PA 5EB1B 1U94A 3Q3IA 4XUEA 4JI3B 3W77A 2OQVA 1ISGA 1Q92A 3STYA 2FQ1A 4R5HA 4DCPA 2IHKA 4LC0A 2WD8A 1T3ZA 5TJ9A 5EQDA 1RADA 3V2UA 4O4HA 2VHZA 2W6PA 5CIYA 2HHLA 4BT6A 3ORHA 4EKNB 1ZHOA 4QEZA 1SFRA 3BH0A 1ZH4A 4IGIA 3HBFA 3OZWA 5IKPA 2EGHA 1KQ3A 2W2LA 3EUAA 4MICA 5FEMA 4F8EA 4LFBB 2I54A 1ULUA 2ZIAA 3E9RA 3Q8XB 4HB0A 4DJJA 1M74A 1XMSA 5K3FB 3ZNPA 3BQNB 2FMIA 2IP4A 4BVTA 3AF5A 3K1ZA 4HTFB 3V4RA 1GPMA 5K3CA 5ADVA 1QZXA 5AVSA 1ULHA 2VHQA 4QGGA 4ZCQA 2ZF8A 3BBPA 4A10A 4H3HB 1Y5RA 2QTHA 4ZCSA 1ZKMA 4TXLA 2GNOA 2VWPA 2WA1A 4BOYA 3AVXA 5A4JA 4G0XA 3U3XA 4D8XA 4DQKA 1E63A 3EGXA 1C0EA 1XTSA 3WP0A 2IXEA 3NYQA 2C7RA 1ISJA 5K3FA 2PZAA 3UMSA 2A8YA 4JJIA 4UDYX 1TZBA 3DAOA 2XV1A 2VG8A 1L1QA 1V11A 3RYHB 1MGOA 4YDQA 4PZ0A 4FFBA 4DLYA 1I3LA 1EUZA 4C05A 1VQKF 3WAJA 4PLYA 2I65A 2ODBA 3FYUC 5REQA 3WIVA 5IAAA 3K14A 4M88A 4X8LA 2Z1DA 5K3AA 1NNLA 3H8WA 1CDDA 1GAQA 1PJLA 2OTLF 1PLJA 3N76A 3QBJA 3N2KB 1CRZA 1UPCA 4B9AA 1E0AA 3C97A 4I8XA 3RYHA 4PRZA 4YXWA 2ZODA 4XDHA 5JC8A 3PTLA 1XKQA 4BYGA 5J2TB 4N03A 5A9SB 1T2FA 4FZ3A 3HB4X 1QVWA 3OE5A 2UYKA 4EG6A 1DMRA 2XNKA 5BR7A 1C4KA 1QIEA 2ZROA 4ZAFA 2C82A 4LKRA 1UWCA 3ZUPA 1FF9A 4IHKA 3CRMA 3OM1A 5AH0A 5KNLA 1GQOA 2FYTA 1BWRA 1WUHS 2HLDA 5DSTA 1HFEL 1Z0ZA 1C3JA 2R1VA 1DRUA 2XRFA 4G5RA 2VAPA 4UJ5A 4MIYA 1KKMA 4YCBA 5DXAA 4F86A 5JTUA 4KKXB 4UHCA 1RKVA 4F3NA 1CJTC 1LPBB 4YJ2F 5A3JA 1P74A 1ZNXA 3BJRA 3RKRA 4EKIA 4RIFA 4AXXA 4RTLA 3O2NA 1ZUIA 1TD9A 3AKDA 3IV6A 4KSBA 4J2TA 1QUFA 5FPSA 1MABB 1TKRA 3PQ4A 1O4VA 1OXSC 5KDOA 1HDOA 1XQ1A 2VEOA 3IPAA 3GJTA 1JF8A 1KORA 1L7MA 4IQFA 4FGLA 5I7AA 2I4TA 5EMHA 3WY9A 4CG0A 2B4TO 2FY8A 1DJQA 2WJ3A 3DVLA 5J43A 2R85A 4AUMA 1DQSA 1X2EA 5BV8A 5GZ3A 1NBWB 1SCUA 1RAGA 1LI7A 4BWYA 1AIPA 1SKUA 5I45A 2ENUA 1HT0A 1P9RA 1VYUA 2Z1NA 3NI2A 3R3ZA 2V7TA 3KCQA 4Q82A 5EOVA 2C5EA 3AUAA 5F35A 1X7YB 2RKOA 3IP7A 3GLHE 3U19A 2PZKA 1MVOA 5IEJA 2HRUA 1EBFA 1FK8A 2GAJA 2XQFA 1HDXA 3LBAA 4WXYB 3THYA 1XZBA 2BZSA 2YWDA 2QAGA 4OQYA 3H0EA 2WAAA 4CF4A 4BB9A 1HBJA 4JP1A 1XR3A 2R6DA 1QO9A 4HNSA 3HKEA 3ZKWA 5BNZA 3QYPA 1JVSA 3H16A 4JQSA 1E9SA 3RU2A 4P3OA 3ROMA 3SU8A 3K4HA 2AKYA 1N8NA 2EJBA 1P5ZB 3AM3A 1PUXA 3UKJA 1HMYA 4KSCA 1IXSB 4LSGA 2Q1SA 1R16A 3I6MA 2CNDA 4KLNA 4XE5A 4QQKA 2J0UA 2A3NA 4K86A 2HL6A 4F4DA 3ZOPA 3SSNA 1G7TA 3PUHA 1K9MH 4PO3X 4E5NA 3ZNNA 3RE1A 5B2EA 1UC8A 3W06A 2COKA 3HCFA 4ZCLA 5KBYA 1E6EA 2XBUA 1DLIA 2J5RA 1DXYA 2FSHA 3UWPA 1QYXA 4BBPA 1XRNA 2PSJA 4U3JB 3F7NA 3FMFA 2YV2A 1RP7A 2I29A 5DFAA 5LKAA 1VMDA 4R81A 3KHTA 3OEYA 4PG5A 2Q29A 3KB6A 1XD8A 4NBUA 4NESA 1UPXA 4BWGA 1RXWA 3KC2A 4HDCA 2BUCA 5IYZB 4NP6A 4ARIA 5EUBA 3T3EA 3OA2A 3NS7A 1KO4A 3E7WA 1JNXX 2C84A 3CX7A 4HD8A 4NCJA 1GTVA 5F1KA 5I9MA 1B42A 1LDEA 4MQEB 4RVNA 1RXUA 2V3VA 5TRTA 5U4XA 4EW3A 3WE7A 4YAGA 2FPMA 4LA4A 4CQNA 1MORA 3EIOA 1NJ2A 4EY8A 3D8NA 2XPCA 3DEIA 1FQJA 4NV3A 1M2WA 3GLSA 4R16A 4BN5A 4FYKA 1VHAA 1K8ZB 3KEOA 4RA9A 4XWOA 3G3EA 4AUNA 5J63A 4IIEA 4MAFA 2QN6A 3QF4B 3MD9A 4TXHA 5FBRB 2B0CA 1NXWA 5EZYA 1EB9A 1RD4A 2OCDA 1LC0A 2XOEA 4J0IA 3FLMA 2WJVA 4KMRA 2O06A 1NGSA 1Z82A 1GG9A 4X41A 5EXXA 4K05A 4MCJA 4WCFB 2XT0A 3BXOA 4Q16A 4C22A 2E4VA 3IS3A 3EVFA 5HJ2A 3FPKA 5JJIA 3L5OA 3HHEA 3E0XA 4P81A 4ND5A 2FR8A 4NDAA 1ONNA 4U6NA 1O1YA 4EEZA 2V7UA 1YONA 2HSZA 4P3NA 4EATA 1GZUA 5BUQA 5JZBA 1QK3A 2EIHA 3DQQA 4Q0MA 2XMGA 4B4VA 5HRCA 2LBPA 1KZ6A 1V1JA 2ONZA 3SIVA 3AB8A 3RVJA 2IHYA 5A02A 1XTUA 2YOFA 4WV3A 1TPZA 4UDNA 6REQB 4KHZA 3U60B 5G53C 4QC2A 2GILA 2R8OA 4KBYA 3HVIA 4DMCA 5FOQA 2NMVA 2XRMA 1RACA 1MTOA 1OV6A 1TFRA 1U80A 3H5OA 3JWHA 4FYYA 1H9CA 5JROA 1QB8A 3PQFA 4IDQA 4C7XA 4W6QA 3JATB 1F20A 2Z6QA 4U39A 4BNFA 1O9GA 1OX5A 2OD7A 3O2SB 2OPBA 1IY0A 2AYYA 4OMCA 3SYNA 4K6KA 1KEKA 3D8RA 3E8SA 3AWIA 1R4NA 3QPBA 3VKVA 4B2LA 1AZSC 2YC4C 1I7DA 1H69A 1FFSA 3HBMA 3F74A 3WADA 5L7TA 2NVWA 5FV4A 2P5YA 3OZXA 5CB8A 5I01A 4AJHA 3TLZA 3U9LA 2V98A 3OOJA 4M0EA 4IHQA 3AFIA 3T1OA 2WTEA 4QJ3A 4YMUA 1P0QA 1EZ4A 4FR2A 4YJHA 1RQRA 2H07A 3AVPA 1V43A 1RIIA 2Y9PB 2VJBA 1UODA 3NTQA 4XEUA 5G40A 3DMYA 2KYRA 2JJQA 4RTMA 4J29A 5FOSA 1MB2A 2AW5A 1XJ5A 2REXB 3TINA 3WL5A 1Z75A 2GF2A 3GFOA 2EAUA 2KLBA 3MINA 1U9IC 5C5DA 1S96A 2IYPA 3CR8A 4EY5A 5KNCA 1SJ9A 1VPWA 2PIDA 1ML4A 3E9CA 3PA8A 1ZGGA 1NF9A 2WPDA 1P5HA 3QWBA 5JVDF 1EUYA 3AVWA 2DHRA 2G82A 2E0IA 4QEDA 3WGTA 2XCQA 3D8TA 3G2HA 5G4KB 4ARAA 4IS3A 1LWNA 1NJ6A 2QA5A 1Z2CA 3TXXA 4DGQA 3VHXB 4EFLA 1UZMA 2G1PA 3E3OA 4GAEA 4RNCA 1ZM4A 5DTRA 3RGWS 3PKIA 1G21E 4B6RA 4LK3A 1GADO 1TQ8A 4DWVA 4D8YA 1MOZA 4G0VA 2OECA 2PGOA 3FZEA 3KG2A 4YGXB 1J49A 3D7LA 3DMTA 4BB5A 1I80A 1PHRA 2V5AA 4BEJA 4CI0B 2VJCA 2CXQA 4JDPA 1T8YA 4BGDA 2CVZA 2SICE 2GZ3A 2FF7A 3PU6A 1WLSA 3C4JA 3VHXA 1WDMA 5G3YA 3RO7A 3CLHA 3TZCA 3TSYA 2IPAB 3GGCA 1NFRA 2OXTA 2DBRA 4MW7A 1P1HA 3NMUC 3FPLA 1Q74A 3ZV7A 1FEZA 1B0UA 2IYZA 1XEFA 2B20A 2PFKA 4GOND 4KJXA 4Z99A 5LQNA 5A0VA 5A9TA 2EQ5A 1JSZA 4MW5A 3L46A 3T52A 1E7RA 1QQ7A 4ZALA 3BIWA 3EY9A 2HIGA 2IYAA 3A05A 2YXEA 1H1TA 5C5IA 2VQEB 1UKZA 3DO8A 2J31A 2FPGB 4FD3A 5DX8A 3NFRA 5DYIA 3KE8A 3PRKE 3PFHA 1ZSYA 3PHGA 1ZMXA 1OPXA 4G9BA 4CM7A 4E2YA 5DCVA 3IVXA 1P3Y1 5I7WA 3NPAA 4MVXA 1U7UA 2JLWA 1WPRA 1N6OA 3L7AA 1XQVA 1LS1A 4CLRB 4ES6A 1C8LA 4YHHB 3U61B 1Q8RA 4TZTA 3D3QA 2FZVA 1TF7A 4LZAA 5CBPA 1COWD 1U0EA 1G42A 3RSFA 1DC7A 3IKFA 3W5SA 2JGIA 4KBFA 4I1SA 2QRQA 1QJ4A 4N40A 1IHXA 4MITA 1A82A 3OT4A 4X71A 4X93A 5JWHA 3K9QO 4MO2A 4LYGA 1HQCA 4UEWA 5BSHA 1LZLA 2C58A 3OPXA 4G8BA 4ITUA 4AROA 4MVJD 2PL5A 3GFGA 1RYNA 3VV3A 1GV1A 3J81A 4PEVA 2PBLA 3I5AA 1N3YA 3OLYA 3WL8A 2O5VA 3I2FA 1BOFA 1TUIA 4E3WA 1WY5A 1C4WA 1Z7BA 2OZLB 2WIAA 2IW3A 4RADA 4TMXA 1BA3A 2QU7A 3AMVA 4HDSB 5HUJA 4ZVSA 3WYNA 4FU0A 4ZC8A 2QAJA 3KOWA 4L27A 4WL0A 3X1DA 2O50A 3HB0A 2O5RA 3HXPA 2ZIFA 3MTJA 2RH5A 1X7WB 1VIYA 2VP0A 3OPYA 4BNMA 3O3MB 1UBNA 4NCXA 3DBRB 1H2FA 3HGTA 2UXBB 2CK3A 2I91A 2C4KA 2PWAA 1EFDN 1SB8A 5HK8A 3V4DA 1M0TA 3CCSF 3M6MD 2AG8A 4CI9A 4UTRA 1IY1A 3VX4A 3S29A 2PZEA 2ZI6A 4I81A 3VQTA 3HA7A 3RODA 4DWJA 4ANFA 5JNTA 4BBZA 1GKLA 1NVXQ 3DAHA </