3WR5A

Structural basis on the efficient co2 reduction of acidophilic formate dehydrogenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
401
structure length
401
Chain Sequence
AMGSMAKILCVLYDDPVDGYPKTYARDDLPKIDHYPGGQTLPTPKAIDFTPGQLLGSVSGELGLRKYLEANGHTFVVTSDKDGPDSVFEKELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHVDLQSAIDRGITVAEVTYCNSISVAEHVVMMILGLVRNYIPSHDWARKGGWNIADCVEHSYDLEGMTVGSVAAGRIGLAVLRRLAPFDVKLHYTDRHRLPEAVEKELGLVWHDTREDMYPHCDVVTLNVPLHPETEHMINDETLKLFKRGAYIVNTARGKLADRDAIVRAIESGQLAGYAGDVWFPQPAPKDHPWRTMKWEGMTPHISGTSLSAQARYAAGTREILECFFEGRPIRDEYLIVQGGALAGTGAHSYSKGNATGGSEEAAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formate dehydrogenase
publication title Structural basis on the efficient CO2 reduction of acidophilic formate dehydrogenase
rcsb
source organism Thiobacillus
molecule tags Oxidoreductase
total genus 137
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.2: Transferred entry: 1.17.1.9.
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A01
3U4CA 1Q7BA 1K5HA 3CSDA 3AY6A 2BH9A 2HCTA 1Y81A 4J91A 4LMPA 5EQFA 1K3TA 4WNIA 4ND1A 3DQPA 2J6IA 3JQ8B 2FMUA 2HRBA 3BTVA 1QV6A 3G3EA 3JQ8A 4R9SA 1BGVA 3OA0A 2P5UA 4GH5A 2EERA 1T4BA 1ZMOA 4IIUA 3CEAA 4LRSB 1I3KA 3D4PA 2DLDA 2UUPA 3G1TA 4G81A 5L95A 4JGBA 1EE9A 1LLUA 3M1AA 5I7FA 4I1IA 5FWNA 1ZBQA 4CM3A 2WYUA 3BTOA 4LSMA 3WGOA 4II2A 5COQA 1A9YA 3FTPA 4BQRA 3FRJA 4BKQA 3R0IA 1A71A 4RCVA 3BMCB 4GMFA 4HV4A 1FDVA 2VYND 4BNNA 2BLLA 3ZN2A 1Y8QB 3EGOA 4YJGA 2RIRA 5EERA 1J49A 3ABIA 2BFPA 2O2YA 3ROPA 2X6TA 3ENNA 4XGIA 5KWEA 4A73A 3U5TA 4XIYA 2BFMA 5GZ6A 3WYEA 3PK0A 1ZK0A 4YJDA 4BNUA 4DTIA 4UEJA 4XIJA 3SXPA 4XKJA 3ZW8A 2HLPA 1C0IA 3DTTA 1YDWA 5AXBA 2C59A 4YJFA 5U4QA 1TA4A 4BO4A 4YR9A 3G17A 4XD2A 1DC3A 4DBVO 4W82A 1KVTA 1XEAA 2BGMA 2CNBA 4PG4A 3ZH2A 4LW8A 4IPTA 3HE3A 3AUTA 4D7AA 1EFKA 2P4QA 4LK3A 1XELA 3V2GA 3DBRA 1VJ0A 1A7AA 1ZSVA 4Z6KA 5CG2A 5JDIA 5HS4A 4BMSA 4D44A 1EK5A 5G2OA 2QG4A 4DUPA 2GDZA 4R51A 1VPDA 2PFGA 3BMNA 3LYLA 4U6QA 4TVBA 2VUTA 3MJEA 4Q3DA 2DPGA 1HDXA 4RF5A 4D0SA 3RVDA 2GD1O 3BMNB 1OOEA 2DTXA 1K6JA 1B8VA 3NDIA 2A92A 2JCXA 4BHTA 2IXAA 3N58A 5DULA 4I5GA 5DBIA 3GLQA 5TT0A 4E13A 1K89A 1V9LA 4E2XA 1C0LA 3FPCA 2CVQA 1PIWA 4OM8A 1GCOA 3BAZA 3GVPA 1EK6A 4MKRA 4A2CA 1FMCA 4PG5A 2Y1GA 1UZMA 1ADFA 3OJEA 4FFMA 1TB4A 3ONFA 1DOHA 1LDNA 1XYGA 4N18A 1F06A 3M2TA 4BKRA 4HADA 4J6FA 4Y67A 4ZQEA 1BVRA 2ZKLA 3GQVA 3OBBA 4AJ2A 3ETDA 4R1UA 1X1EA 3SLKA 1VSVA 2Y05A 2Y68A 4MVJA 2OMEA 5JDIC 2NU7A 5KNLA 1J0XO 1P1JA 4FSHA 4FC6A 3H5RA 5GZ1A 1EDZA 3D7LA 1ZMTA 3ZWAA 5JXWA 4D45A 4IS2A 2W2LD 1GEEA 1HTBA 3AUSA 3GN1A 4PG7A 1CDOA 4IMRA 2HMUA 1E1MA 2O23A 2Z95A 4AG3A 5HBRA 3ITKA 3RU7A 3AI2A 5F3RA 3KYBA 2WDZA 4R54A 1N8KA 1K2WA 1GUZA 4KTTE 5JCJD 3GG2A 1NPTO 1GEGA 3RU9A 4J0FA 3U9LA 5CEFA 1A5ZA 5BQFA 1D4FA 2D59A 3QVWA 1UP6A 2AQHA 2NTVA 2QHXA 3CINA 4MKXA 3FCOA 1KVSA 3H3JA 3PHHA 4I9NA 1IE3A 3P2YA 4MVJM 5JDCA 4BB5A 3PJDA 2NTNA 4F46A 2RH8A 4OXKA 4E6PA 1TEHA 3ADOA 4EJ6A 2AQIA 4PLZA 1XDWA 3UAGA 1PEDA 3BYZA 2G76A 3ZV3A 3MTGA 4IUYA 1X7DA 2UAGA 1I8TA 1SPXA 3ONDA 4RF3A 1LBEA 1YH3A 1HRDA 5BNFA 2GN4A 1QLHA 1ZSNA 3H2ZA 1X1TA 1NFRA 2XXBA 3R3SA 4L75A 3WGGA 1A4IA 4MIEA 4B8ZA 2WM3A 3ZU4A 4CM7A 3GH3A 3P19A 1JTVA 1O5IA 3O9ZA 2HMTA 2IZ1A 2I3AA 2GYYA 3E9MA 1NAIA 3L6DA 2OOSA 3K96A 4DLBA 3D4NA 5A1TA 1EVIA 4XQ9A 1B15A 4ND3A 2EWMA 4HFRA 3V8BA 5JSFA 4UREA 3QW2A 1E3EA 2JAPA 4B79A 2FZWA 3CMCO 1LU9A 2Z1NA 3DDNA 1NBOA 1PJQA 2DBZA 3SVTA 3GRPA 1GZ4A 3WICA 5IXSA 4NR0A 2VZ9A 1DC4A 4N7RA 3F5SA 4PRKA 4FC7A 3B6ZA 5K9ZA 2PH5A 3MOIA 3ONEA 3ZV5A 4DMLA 4MINA 5K0ZA 1M67A 4JX8A 4L4RA 1HWYA 4QSMA 4RV9A 4WNCA 5BSHA 5ADHA 1G0NA 1ONOA 1NHWA 5JFOA 2JAHA 2EIHA 1OBFO 3GZNA 3PVZA 3ICCA 1PS9A 3WSVA 2DUUA 4D43A 3H9JA 2J3HA 2YYYA 3ENKA 1LQTA 1HYEA 2A35A 3I3OA 1T2DA 4XQCA 2POQX 3ZWVA 4QXMA 3DONA 1O94A 5JDCC 4IDBA 3WIEA 1JDJA 3TNLA 4XR4A 4EJMA 4NDNE 2YY7A 4YT4A 1E3WB 2LDXA 3TDKA 4NHEA 3H9GA 4LCEA 3JQGA 2X4GA 2DU8A 4XJTA 3AWDA 3HZZA 4IDEA 5ITVA 1I2CA 3JSAA 3U09A 3DZBA 3MWEB 4ZU3A 4D79A 2Q2WA 3HB5X 1LSUA 1T26A 4GLLA 1K6IA 3GMDA 1ZJZA 5T6BA 1BTOA 3DBLB 3I4CA 3PQFA 5TSDA 2GN8A 4ND2A 3EZLA 1GAEO 4EYEA 1Z7EA 2OZPA 4ZA2A 3L6EA 4PIVA 4WLNA 1GCUA 3D0OA 1GUFA 2QZ9A 3EUWA 4M89A 3LQFA 3DC2A 3H4VA 4KWIA 3VH2A 5LDHA 3UKOA 4I8XA 3EK2A 5MGBA 4JCOA 3WDSA 1LLQA 2Q99A 3NRCA 3GHHA 4NFHA 4FGSA 3Q6IA 4WCDA 2ZYGA 2VN8A 2C07A 1N1EA 2PWZA 2R00A 2ZB4A 3VZSA 1LSJA 2B5VA 4XYEA 4GBJA 2Y0DA 1MA0A 5G0VA 9LDBA 1N1GA 1YGYA 1R4MA 1HLPA 1U3VA 3G1UA 4TRJA 4J1QA 2ILTA 1LC3A 4EW6A 1QYCA 4TRRA 1KC3A 4CPDA 2XF8A 1RYDA 4PZEA 2B4RO 2OHXA 1R0SA 5A04A 3IOYA 1HDYA 1DDOA 3ZU3A 4OQYA 5T64A 2RAFA 3IP1A 1LDYA 1P9LA 2NVWA 5U1PA 2B69A 2AEJA 1LI4A 2EV9A 1ZXLA 3VH3A 4BO6A 1X13A 2NU6A 4OKNA 3DOOA 4CJXA 5L7WA 3EYWA 1Y8RB 3NT4A 4FFOA 4CMAA 5T67A 3DBHB 4E31A 3FD8A 3GDGA 2IZZA 4NBRA 5F1KA 2JFGA 3HHPA 1U4OA 1DB3A 1CWUA 3N7UA 4DYVA 3SX2A 3PHIA 2E6UX 4NI5A 2AE2A 4GPD1 2HAEA 2QYSA 3RSHA 4C4OA 4M8SA 4E5NA 4NJMB 2PZJA 1NQOA 2IEBA 1ENPA 2Y0CA 2Y99A 4E3ZA 4OGWA 3WWZA 1ZFNA 2Y1EA 2O3TA 5FI3A 4AJJA 1IY8A 3BHIA 3OF2A 3PWZA 4R5HA 3FWNA 5EJ2A 3L4BC 5EIOA 3E03A 3SBOA 4B3IA 3S2EA 2YW9A 1LQUA 3VVCA 2BD0A 5C7OO 2NTJA 1MFZA 1H6BA 4OOEA 1UR5A 3MJCA 1E3SA 1DIBA 3LU1A 3P5SA 4XYBA 3QVSA 1ZSYA 4DYDA 3OEYA 1NVGA 4RF4A 5B4UA 2IRWA 2OP1A 4CV2A 2DBVO 3DBHA 1A4UA 1J5PA 1JQBA 4WEQA 1LRJA 4NFSA 3BMOB 4LGVA 4B4UA 5KKCA 1UP4A 2JHFA 4GWKA 5A03A 3M6IA 3IAHA 1BG6A 1ARZA 1CYDA 3JQFA 1XIVA 1H2BA 2X58A 2WWRA 1PGNA 2BELA 2YV3A 4QECA 1X7GA 4K26A 3S1LA 3VAZA 1I5RA 1Q0QA 4BNHA 3K6JA 3IKVA 4LMRA 4CQMB 2GGSA 1S6YA 4JQCA 3JQ7A 3ROQA 5C3MA 2VHWA 4NJOA 2CUKA 3GGPA 5JAZA 1JKFA 4YYZA 1UUFA 2CFCA 3WGYA 4FJ2A 5AQ1A 5I7VA 1KBZA 3TF5A 3AW9A 3OH8A 1DJQA 3TL2A 3NAQA 1SZJG 5IZCC 4TZTA 4D3FA 3D5QA 5BR7A 2JL1A 1HZZA 5TIIA 3I23A 4FS3A 4C7KA 1L7DA 4Z9YA 2Q2VA 3AM4A 1CRWG 5IDYA 2TMDA 3UH1A 4BS9A 3DBLA 5TQVA 1VSUA 4PLWA 3JQBA 1T2CA 3GAFA 2H63A 1IZ0A 2EKQA 2NQ8A 3OJFA 1SC6A 4GSKA 1WVGA 3A9WA 3L4SO 3DZFA 1NWCA 3DZJA 4HFMA 2C5EA 3RROA 5JAMA 1T2EA 2P9EA 3JYLA 5I8WA 1E5QA 1Y5MA 2AA3A 4WGGA 3W6UA 5G0WA 2B36A 1CQJA 5H82A 4CQMA 5H81A 3I4FA 1FDSA 1EMDA 4RQUA 1C0PA 1LXCA 3E48A 3WFIA 4QQRA 4WASA 4RVFA 5ICMA 2AG5A 1PQUA 2YHUA 1XU9A 3I5MA 4CR6A 1E1LA 4XB1A 3OQBA 4BIIA 1X0XA 4A10A 4QX6A 2BGLA 5A3JA 1FDUA 3F1KA 3KYDA 4I5EA 3GNTA 3O8QB 4W9NC 3IJPA 1QYWA 5LC1A 2BKAA 2X22A 3PJFA 2VNSA 2YV1A 3JYNA 4PLPA 3ROMA 1ADCA 3L77A 2X5KO 2WTBA 3LT4A 1N9GA 3KSUA 4RPGA 2I66A 2AW5A 3EZYA 2W2KA 3IDSA 4BNZA 4BO7A 2FR8A 2W4QA 3H2SA 1LRLA 2X0RA 4CMKA 4MPDA 1O8CA 4L74A 3S55A 1R16A 4GKVA 3IKTA 4R69A 3WFJA 3LT0A 1E3JA 4WLFA 2OXIA 2OL4A 2B35A 4CUKA 4UEOA 4IZHA 3V1YA 4IIVA 4JP2A 4R1TA 3UW3A 3NUGA 3PYLA 3T4EA 4DQVA 1LDEA 4CLRB 4Q3NA 2ZATA 1U1IA 2XOXA 3N74A 1A27A 4HKTA 4RDIA 4CMEC 4MIOA 1WP4A 3VKVA 5MDHA 4QFCA 2EJWA 3I9NA 4RQTA 5CP8A 5L4SA 1O0SA 2J5KA 1DIRA 2EHDA 1HDRA 3JQ6A 4BMVA 4FDAA 4DPMA 2P9GA 1ISIA 1F17A 4R41A 2IODA 3DZGA 1KYQA 1JWAB 4M55A 3WJ7A 2Q4EA 1DLIA 1X15A 9LDTA 3CXRA 1PZHA 3A4VA 4KQXA 4OMUA 2DTEA 5LCXA 4A27A 4Y9DA 4J1SA 2H9IA 1WNTA 3KYCB 4CODB 1FXSA 3G0OA 5C7LO 3DR3A 1E7SA 2W8ZA 4B7UA 4KTVE 4YDRA 4P38A 5TS3A 2RHCA 1MC4A 1CIVA 3IQDB 2BFOA 2X23A 2CF6A 3F6YA 4IDCA 4K9DA 4CM4B 1B26A 5JNLA 1I30A 5L4LA 3NV9A 2B37A 4II3A 1QV7A 1VKOA 2BGKA 2Q2QA 2HMSA 2JD1A 3EDMA 1N9GB 1JU9A 1WXDA 4RVGA 1H5QA 5G4LA 5CDUA 3QWHA 1QORA 4XRRA 1X14A 3ZZNA 5L7TA 2H1SA 3VH1A 4FQ8A 2X9NA 4YWJA 4CM9D 4Q3BA 2J3KA 5A4DA 4R9RA 4JNKA 1RM0A 1VL6A 4AJIA 4E33A 1I3LA 3GFBA 4Z9FA 4O1MA 3EC7A 4WCFA 5EN4A 5KJ6A 3NTQA 3EMKA 1XR3A 1KVUA 1ZKMA 4TRNA 3RBVA 5HM8A 1D8AA 2YQ4A 2C7VA 4WPGA 2NUAA 3H8VA 4YB8A 1ADGA 2P91A 3L9XA 3LC1O 4QO8A 2FSVA 4TKMA 1Y8QA 3AI3A 2HK8A 2EKPA 1NXQA 4CMEA 1UDBA 1EVJA 5KJFA 1YBMA 1QP8A 2VRBA 2HRZA 4RPHA 3PI7A 1DC5A 5T5QA 4CUJA 1U2GA 3BXXA 1BSVA 4PN3A 4DBZA 3GGOA 3QE3A 3INRA 5C37A 5AXAA 4AJ1A 3TOXA 3WOHA 3WMWA 3O03A 3HDQA 3KM0A 3OMLA 4NPCA 4ZN6A 4PLGA 5B4VA 1QLJA 3HDHA 3ZWWA 5AYVA 5G4KA 4DIOA 3GNSA 2FZEA 5KVVA 4U8GA 3D5TA 3DBRB 3UGKA 1YL5A 4OKIA 4UUOA 3FR7A 5I7SA 3U3XA 5JE8A 1HE4A 3D64A 3GVXA 2B83A 2V6MA 3Q9UA 3RFXA 5KOIA 1RM3A 1YB5A 4IMPA 3FTNA 2D2IA 3PLRA 3I83A 4UVIA 4XX0A 3TFOA 2BI8A 2GNAA 1XG5A 2E82A 1YBVA 1UP7A 1YKFA 5IN4A 3TL3A 1PZEA 4UVHA 3AOGA 4E5KA 3UFXA 4FFNA 1VJ1A 1BW9B 2CY0A 3L0DA 1SBYA 4AL4A 4M1QA 1A9ZA 1U28A 1I32A 4KMSA 5F1PA 3R6DA 3ASVA 3DAFA 4IY1A 4MO2A 1P77A 4MVJD 1HDGO 2GSDA 5ENVA 4PFJA 1E7RA 1SB9A 3MEQA 1JAXA 4MP3A 4IQGA 4J4BA 2NSDA 4IINA 1YOVB 2W2KB 4RL6A 4U0JA 4DVJA 4BNLA 5THQA 3KXDA 1EUDA 4GL4A 1U3TA 2X0JA 4OL9A 2PLAA 1NFQA 4IJUA 4KWHA 3PHLA 4H16A 3DZIA 1BRMA 5TF4A 3W6ZA 5A9RA 4ALIA 4J2HA 1AUPA 5GMOA 2QQ5A 4FW8A 5L9AA 2RHRA 3QP9A 4BO0A 5IZCA 3W8DA 2AHRA 2J3IA 2VHZA 3F4LA 3H9QA 1PS0A 2J5QA 3I52A 4AJPA 3I6QA 1V0JA 1Y9EA 2Y1OA 3G49A 2ZTUA 3WQQA 2NVBA 1NP3A 2OUIA 4E2YA 3KEOA 2QRKA 4FGWA 4UAGA 2V6FA 5JAQA 1DJNA 3MJVA 4D0RA 3HSKA 3BMOA 2WE7A 3IUPA 3H9UA 3GDFA 4IDFA 5EPOA 5JAIA 4AJEA 4AJLA 1PQPA 4RVDA 1YOVA 4JBGA 1T1RA 1Y8RA 4XZ3A 1ISGA 2YQ5A 3OQ6A 1I2BA 1Y7TA 4R5MA 1HE3A 1PL7A 1E7MA 4XGKA 1ENZA 1W4ZA 3WGIA 3UCFA 1I33A 3GA0A 3UHAA 4QT0A 1B16A 4KZPA 4PLCA 1NQTA 4WCFB 2UV8A 4R3NA 3WJAA 1WLYA 4A0SA 2YFHA 3CZRA 5DT9A 4AJNA 5U9CA 3ASUA 4K28A 4PLFA 3CIFA 5AXCA 1XQ6A 2X1HA 2FN7A 3TZCA 4BNIA 2WMDA 4LRTB 3WYCA 3B70A 4NBTA 4NQZA 4DGSA 3U49A 4FFLA 2AQ8A 1C14A 4QEDA 3DFUA 1PJTA 2BI7A 1HE2A 4MVJI 3IP3A 3L4BA 5I9MA 2G5CA 2Y67A 1QYXA 1DHRA 3RBZA 3MJTA 1FDTA 3BA1A 5THKA 1SEVA 4EUEA 5IDWA 1BDBA 4J9VA 2QX7A 3FNFA 1YQXA 4UUNA 3DHEA 1LC0A 1MG0A 1EVYA 3AOEC 1YB4A 1ML3A 3KSZO 3WLFA 4ZHSA 4EUFA 3K31A 1PS8A 3ROKA 1M2WA 5A9SA 5CAEA 4NK5A 4Z0HO 5AVOA 3K8ZA 3PFWO 4HP8A 4W7HA 1DIAA 4D3DA 4CQMD 3RC9A 3OHSX 1PWXA 3HN7A 4N5NA 5L4NA 4JP3A 1C1DA 3TQHA 4ROSA 1XA0A 1U4SA 1P45A 2EJVA 1LDBA 3KYDB 4PLHA 1ZW1A 2DT5A 4JLWA 3JYQA 3HJAA 2B4TO 1MLDA 1DAOA 2YJZA 4BVAA 4XB2A 1N7HA 3DOCA 1BWSA 2ZB3A 5I8ZA 2PNFA 1OC4A 1R4MB 2Y0EA 4RGBA 4CLXA 4E2ZA 2V6BA 1YONA 4YAGA 3S2FA 4D41A 1LJ8A 1LA2A 4GVXA 4I5DA 1AE1A 1HL3A 3QJ5A 1PJCA 1MV8A 2NU8A 4WOKA 3PQDA 3GG9A 1GYRA 1ULUA 5JYDA 3UUWA 3GNQA 5TJ9A 2BFAA 1PZGA 2Q1TA 1QYDA 1VJTA 4XYMA 1VRWA 1D7OA 4F6LA 3H7AA 2B4QA 1K0UA 1XCBA 2EP7A 2X7HA 5A05A 5CEJA 1T1SA 4CM4A 4XYGA 4XDZA 1WZEA 4BNYA 2X8LA 1ISJA 3IMFA 1FF9A 2VQ3A 5BSFA 1QRRA 3U4HA 1ZK4A 3MJSA 3VPFA 5HRUA 4DPLA 1LEHA 4O5OA 5CFZA 4PG6A 1P1RA 4MVJP 1MX3A 3CMMA 1WPQA 3OJOA 1LNQA 2PA3A 2RH4A 2Z5LA 3JYPA 2SCUA 1NVMB 1MGOA 2VRCD 2PKRA 4TVOA 2GF2A 2PKQO 1YXMA 3QWFA 5JO0A 4PZDA 1J4AA 3GR6A 4WKGA 3F1LA 1D1SA 4CMIB 1WDMA 3ANLA 4M54A 1ISHA 3WNQA 2CDCA 1UZLA 4YTEA 2O7SA 3DHNA 3O8QA 3GDOA 2I9PA 4OXYA 1B8UA 2VT3A 3OIGA 2VNAA 3U4IA 1NTOA 4J4TA 3TWOA 4P4GA 4A5OA 1AXEA 3AU8A 4MVJF 1MUUA 4YRAA 3LT1A 3VVBA 3AFMA 4MVJE 4J49A 1L7EA 1LRKA 5I9NA 2Z1MA 4GAEA 2FOIA 2V7PA 1YL7A 1R37A 6LDHA 3ZNNA 3VC7A 3WIDA 4DPKA 2R2GA 1V35A 1HZJA 4YRBA 3FWZA 4ZRNA 3PJEA 4KUEA 1GYPA 1Q2XA 4BNJA 5BT9A 1E7QA 3NKLA 4M87A 2V6GA 4S1VA 1E5LA 4P8RA 3K92A 4NMHA 1I10A 2C29D 5COAA 1PU2A 3INTA 4BO8A 3FBGA 4X54A 1JKJA 3GFGA 1WWKA 1H94A 4BNXA 3OJLA 3E18A 5ER9A 2PGLA 3ON5A 3ZU5A 1NASA 3F5QA 1NNUA 3ANMA 4WE3A 4E2WA 2V65A 1LDMA 1ZEJA 4NH4A 5TJHA 1H6AA 1IHXA 3F3SA 4B7XA 3SEFA 2FPGA 4YQYA 2X0IA 3K9QO 4U5QA 1RJWA 1YWGO 3WLEA 3WB9A 2PGDA 3NYWA 1Q7GA 1QKIA 1VI2A 2AQKA 2VYNA 3QSGA 3D1LA 4QUKA 5J23A 5G0TA 1E6UA 3V2HA 1ISMA 2HU2A 4OIMA 4W6ZA 3EVTA 2GZ1A 4FFRA 4ZQHA 5AXDA 1CERA 1L1FA 1PGPA 3K30A 1C1XB 4CM9A 2DAPA 3RFTA 3ZW9A 5IFLA 5A9SB 1PTJA 2IDZA 3E6AA 5IDQA 1ZH8A 3CPSA 3P2OA 3IC5A 1Y9AA 3ETEA 3F46A 3PIIA 1EBUA 3T7CA 3H6KA 2PK3A 2ZJ0A 5A3VA 2NV6A 5JC8A 4RVHA 5IN5A 1WMAA 1ZJYA 2C82A 4PVDA 1XHLA 1Z82A 3DZHA 1ZZEA 3LF1A 3S2IA 4CQLB 1PSDA 1CETA 3NTOA 2HK9A 1GPDG 3LLSA 2D8AA 5FF9A 5TX7A 3FBTA 4CLOA 5F1OA 4RZHA 5JLAA 3TJRA 4G2NA 2I65A 5DN9A 3CZMA 1F8GA 1XWFA 3NT2A 4BL5A 4A03A 1U2DA 4JIGA 4Q3AA 5KTKA 1ORRA 1DIHA 5ITWA 4KDEA 2GR9A 1R4NB 2EW2A 2ZCUA 1AGNA 3PDJA 1SEPA 3AY3A 3RUFA 3A06A 2Y1CA 2E37A 1ZIDA 2Q1UA 1GADO 1DRUA 1MXFA 1R0LA 3OA2A 4YAKA 1Q1NA 4G5HA 3JQDA 1TLTA 4CMGA 1GD1O 3AFNA 2WYVA 3VPSA 2W98A 3D3EA 4MVJG 3RUDA 4YEDA 3KVOA 3R1IA 5DDIP 4XWYA 3RAJA 4E32A 1V6AA 4R01A 2DUWA 2WYWA 3JD4A 4R68A 4YBZA 1H9BA 1HF3A 2XAAA 4NU6A 3Q9NA 2TMGA 1QG6A 3ZNQA 1GDHA 3NDJA 3LF2A 1QR6A 1Y1PA 4CV3A 3ANNA 3HFGA 4QFDA 1EQUA 3RQSA 1WW8A 3QWAA 1ZNQO 4UUPA 1H6CA 4E30A 2A9FA 3AM3A 3QY9A 2G1UA 1ONPA 1A72A 1K6XA 1ZUD1 4IXTA 1MB4A 2O3JA 3TZKA 3NT5A 4MDHA 1GZ3A 3A28A 3JD0A 2JCYA 2R00C 3E9NA 3D4OA 3KOUA 3VDQA 1YB1A 4DMMA 2FP4A 1UH5A 3M2PA 3MOGA 2C2XA 2OBNA 3Q0EA 2NWQA 1WMBA 3U62A 3H9EO 4BNKA 1H2HA 3QVXA 2O3QA 5F5LA 3INGA 3RKUA 3KSDO 3LC7O 1EE2A 4DRYA 2Q45A 3ST7A 2P4HX 3RWBA 3SLGA 4ALNA 4E0BA 1NR7A 4NBVA 4XYLA 2Y93A 1Y6JA 1PJLA 4H3VA 2IXBA 5A02A 2E4AA 1F12A 3EVNA 3JV7A 4Z3DA 5KJ1A 2PR2A 3I9KA 4W99A 1E0DA 1E6EA 1P1IA 4KUHA 2W2LA 2EF1A 1SCUA 3QV1A 2OGUA 3W4JA 1LDGA 2VT2A 3VZRA 3ZWXA 5GZ3A 5ILGA 3OP4A 1ZXBA 3KUXA 2GUGA 2PV7A 5I7EA 1IPFA 2JJYA 3WNVA 2I99A 3I1JA 1EEHA 1DFGA 1IZ9A 4YCAA 1R0KA 1BDMA 3RJ9A 4ALMA 5A5EA 1HT0A 1IULA 1PZFA 1U7HA 1BMDA 3WQSB 1PGOA 1M6WA 4TRMA 4H15A 1I0ZA 2JCVA 3VHRA 2VHXA 2ZB7A 1PGJA 4DC1A 1G6KA 1U9JA 4J7UA 1FDWA 3K2BA 2GCGA 3ZNPA 1E7YA 2D5AA 1ENOA 2ZK7A 1PQWA 1TT5B 1UAGA 4NIMA 5DCUA 2EGGA 1JKIA 3WX0A 4BGUA 1TT5A 3RC1A 1RYEA 1Q0HA 4DQXA 2EEZA 4BNGA 4EZBA 1IL0A 1SO8A 3VOSA 4HY3A 3ZWBA 1N7GA 2JHGA 2O4CA 4GMGA 3STHA 4L73A 1NPDA 4Q3CA 4YPOA 3RBXA 1VL8A 2EP5A 1ULSA 4BV9A 4EUHA 4OSPA 3NEPX 3ZU2A 2W90A 3F9IA 1EBFA 3GF4A 4TMFA 1LUAA 4CM1A 3RIHA 1M76A 4ZD6A 4ALLA 4YQZA 1W0CA 3VPGA 4C7JA 4XCVA 3RJ5A 3FSRA 2AE1A 2IZ0A 3JCZA 4AICA 4L8VA 3HDJA 5DZSA 1R6DA 4HFNA 4U6SA 2VOJA 3BMCA 1NVTA 4HBGA 1GL3A 4FCCA 2DFVA 1HETA 2Y66A 2OFPA 4IJWA 3SJ7A 1B2LA 3WYBA 3IS3A 3MCVA 3DZKA 3FR8A 4ZVVA 4ZQGA 3RC7A 3SC6A 3QA9A 5DBFA 4PCVA 2ZQZA 3WQRA 5IZ4A 3FF4A 3TPCA 1P1KA 4MP8A 1KY4A 2UYYA 4XQGA 3CKYA 2HSDA 3OSUA 4Z0PA 1UZNA 2ZQYA 4YJHA 5EMHA 1X7HA 5JPIA 3C7AA 3C1TA 3DTYA 3QRWA 3E8XA 4J7XA 4WLEA 5H83A 4BKPA 4DREA 4YAIA 4XDYA 5T8KA 2D4AA 4GGOA 4I9UA 4LSWA 4QO7A 3IL2A 1T25A 2O3UA 4HWKA 4CM8A 4BNWA 1ZO8A 4XEHA 5JY1A 2VTDA 3C3XA 2NU9A 5CDYA 2VZ0A 3V2UA 1SAYA 4PZCA 2JD0A 2ZTVA 1VL0A 2ZTLA 3Q2KA 3ZWPA 1E6WA 1OZAA 2Q1SA 4R1SA 3JTMA 1IOLA 2O3RA 3RKRA 2HUNA 2CVZA 2UDPA 5KIAA 3UOGA 3AJRA 3GY0A 4CL3A 3DB2A 2BF7A 1C3VA 3KYCA 4J16A 1GFSA 1RM5A 3HFSA 3RD5A 3SJUA 2BHLA 3QWBA 4PLVA 4WLOA 1XLTA 3B20A 1PR9A 3QIVA 1PGQA 3WTCA 4NK4A 4MIYA 1X0VA 3EAGA 2XXJA 4BB6A 1U5AA 2OBYA 4Y6SA 4D46A 4YT2A 4IJVA 4ZGWA 1J6UA 1EVZA 2Q1WA 1LTHR 3KZVA 4GX2A 3ZDFA 1AHHA 3C7CB 1N2SA 1EDOA 2WE8A 2VUSA 2C5AA 2O2SA 4Z0TA 5EINA 2YHIA 4IJKA 3NX4A 1JW9B 3BMQA 1I3MA 5DOVA 2EXXA 4I5FA 1YE3A 5FFFA 3GUCA 5F21A 2QRLA 3PWSA 4WLUA 2J8ZA 3EHEA 3KTDA 2VTEA 4GI2A 1U3UA 4GX1A 6ADHA 4NJMA 3WWYA 1MC5A 3RI3A 3W4KA 1I3NA 3GPIA 1P33A 3Q11A 4INAA 3OECA 4YRDA 4MKZA 3DXFA 3TZHA 1R66A 3FPLA 4FJ0A 3KETA 1F8FA 5L3ZA 4BNTA 3LSYA 1C1XA 1GV0A 3RCBA 1HYGA 4RF2A 4FOSA 1CF2O 1GPJA 2H6EA 1B3RA 4J3FA 1Z6ZA 2FPIA 2PD4A 1PJ4A 1VLLA 2X5JO 4ESOA 3KBOA 4GKBA 3GMSA 1PJ2A 1CQIA 1NX6A 3AOEA 4XA8A 1E3WA 1B8PA 4WECA 4IBOA 5C7IO 1LLDA 3HQ4O 1RWBA 2HDHA 1OI7A 4CUZA 2ZYDA 3BHMA 4J1NA 4DA9A 3TRIA 3E1KA 4IGFA 4J9UE 4JN6B 2UUOA 1M66A 3UXYA 4EDFA 3E5RA 4IDGA 4CLDA 2IYOA 2EW8A 3BMQB 4IS3A 3WTBA 2NADA 3DMTC 1UXIA 5A9TA 3DBVO 4FJ1A 1Y5RA 2XPCA 1E1KA 3C1OA 3D3WA 1CJCA 4DLAA 2WSBA 4FBGA 3DAGA 4FIZA 1OFGA 1E3LA 2QZZA 1B7GO 4KDFA 1ISFA 4N5MA 2FHSA 1FK8A 1C1DB 2WD8A 2Q46A 5T57A 4CMBA 1DXYA 7MDHA 1B14A 2B0JA 2X86A 4GX5A 1HKUA 3PJGA 5L7YA 3JQGB 3VTFA 4E5MA 4EI2A 3I9OA 3MJ4A 4IXWA 3MTJA 2E49A 4O59O 3OM9A 3PRJA 4XRGA 4A26A 2C54A 2E48A 1P3DA 2PZLA 3KHUA 2O4UX 3ETGA 2Y1FA 3NGXA 3JQEA 3PDUA 5CDSA 1LLCA 1XSEA 3V1UA 4BNFA 1UXJA 1Q7CA 1SNYA 4E12A 1LSOA 3PYXA 5CG1A 4LN1A 4KOAA 2DTDA 4M86A 3UICA 5TGDA 4XJSA 3WG9A 2AXQA 2F1KA 4BV8A 5DCWA 3Q3CA 3PP8A 4U7WA 4WK6A 4CMJA 5BSGA 1T4DA 3COSA 4IDDA 5A06A 4DLLA 3ZCXA 3ZNOA 2HJRA 2DKNA 4PVCA 1S7CA 3GN2A 4I08A 2WJPA 5CPFA 3CH6A 3VZPA 2PKQP 1ZK2A 2C20A 2QW8A 3DOJA 1GR0A 4JBHA 4OQZA 4BGIA 1AXGA 3DFZA 3O4RA 2WEKA 2HO5A 3ZV6A 3JQCA 1H93A 2OORA 1O95A 1SOVA 3A14A 4JROA 4R4JA 1DFHA 1ENYA 3LDHA 3PXXA 4CLRA 2FSSA 4EBFA 4ONEA 2DPHA 5B37A 4RZIA 1I2ZA 1I01A 1O6ZA 3L9WA 1H9AA 2CDBA 1XQ1A 8ADHA 4TQGA 4EITA 5I9LA 1E1NA 5KJEA 5JYEA 2H5LA 1JVBA 2D3TA 2ZIZA 5IXYA 2GLXA 3VTZA 3LC2O 4ID9A 3U4DA 4BMNA 4DL9A 4TROA 1HSZA 3H5AA 4CL8A 3I9JA 4FFPA 4OAQA 5BNIA 1DC6A 4UVEA 4IM7A 2J3JA 4B3JA 3DAPA 1F0YA 3GGGA 3H3FA 4BO3A 3C7DB 4URFA 2PY6A 4NFYA 4WUVA 2HQ1A 4Q39A 5ILOA 4FN4A 3E9QA 3M1LA 5DOZA 4BKUA 5L53A 1H6DA 4H7PA 3WS7A 3NGLA 4RPJA 2VYVD 4F3YA 4NBWA 4YJHB 3WBBA 2ZJ1A 3ZGYA 4J2OA 3DEYX 3W8EA 4RVUA 3ZHXA 1GU7A 1GQYA 4DWVA 5L45A 2G0TA 2VYVA 4HFJA 4ZICA 3JQAD 1P44A 1P31A 3AU9A 4S3MA 3RUHA 3UCEA 3ZWYA 4YAEA 4AJOA 5B12A 4NNJA 3L07A 3GUYA 1I24A 3KEQA 2FY8A 3PQEA 4L4SA 3PIDA 5ES3A 4OH1A 4BOYA 3ZHYA 1G0OA 1HE5A 1IB6A 1KC1A 2RCYA 4Q3EA 5ER6A 4CV1A 3AM5A 1OC2A 4R1NA 1ZK3A 1UXKA 4RLHA 4YXFA 2PZMA 5G4KB 4J0EA 2QIOA 1DAPA 2IEDA 3ITDA 3RFVA 3UN1A 5TT1A 4NBUA 4OXNA 1ZEMA 1ZVMA 3UCXA 1VKNA 3B1KA 4NU5A 1CEQA 1DHTA 3QQPA 1H0KA 2D5CA 3ZWOA 1BW9A 1ZK1A 4AJKA 1BHSA 4IDAA 5KKAA 3IIEA 5JO9A 2I67A 3WGTA 4MVJH 3JQ9C 4P4LA 1EUCA 4MOWA 4U0KA 4B4OA 2EKLA 3Q2IA 4D42A 4EEXA 3PZBA 1N92A 1YQDA 1IHYA 3AI1A 4HNGA 2DFDA 4JJIA 5DNAA 3U0BA 4JJGA 4ND5A 2A4KA 3P7MA 4MJLA 4NG5A 1T24A 3CUKA 1TXGA 3H65A 1PJSA 4CLEA 1W8DA 1NR1A 3HB4X 3QHAA 4TWRA 1BVUA 4J90A 3IUSA 3B1FA 2G82A 4EEZA 1TI7A 3PGXA 1M75A 1KETA 2VOEA 2DM6A 1KVQA 3ADPA 3DHYA 2CMDA 4UEKA 3RUCA 2C7GA 3FNGA 3DWFA 2AG8A 2VWGA 2VHYA 4YT5A 4BO1A 2AEFA 1GYQA 5B4TA 1EFLA 4YJGB 3TN7A 3K5PA 4M49A 2X9VA 3ZV4A 3ZHBA 3V5NA 4IQ0A 4Y6RA 1GQQA 2VCYA 1SOWA 2CVOA 2NVUA 5K6AA 5JCXA 4ILKA 1KEPA 2X0NA 5DCYA 1U7TA 1XKQA 3HN2A 4RLSA 1DFIA 3KLMX 1WDKA 4Y8VA 3E5MA 3KB6A 1NFFA 3KV3O 1HDOA 5CPBA 1DO8A 1HXHA 1RM4A 4RVSA 2PD3A 3DO5A 1KEWA 1YVEI 3HDYA 5BNTA 2YZ7A 4E5PA 1DLJA 2YHIB 2HK7A 4ALKA 1R15A 4F6CA 1PJ3A 2B5WA 3ZWMA 3PPIA 2GERA 1V3TA 2NNLD 3WGQA 1GUYA 1O89A 1NQAO 1GTMA 2C0CA 2DBQA 4FB5A 2YDXA 3ULKA 4AVYA 3FNHA 4FPXA 1Q0LA 4OO3A 1P0CA 1DPGA 4UVDA 4OHUA 3JQ9A 1P0FA 4P22A 4PG8A 2NM0A 4J43A 3WSWA 3TFQA 2O3SA 1NM5A 5HS6A 1QSGA 2Q4BA 4IQ8A 4TKLA 1JVSA 5KVCA 1HSOA 4O6VA 4RDHA 3GK3A 3FNEA 4YA6A 1B3BA 3RUAA 4ALJA 4N54A 5FYDA 4DXHA 4BGEA 2JFHA 4GVLA 2NACA 2VZ8A 2PTGA 4FOOA 4GWGA 2FRDA 3KO8A 4W4TA 2BRUA 4EJ0A 4BNVA 4WJZA 5CDTA 2P5YA 3QVOA 3PTZA 5CEEA 3CE6A 4B8WA 2O7QA 4W7IA 2GRAA 3EY4A 1NAHA 1PL8A 1A7KA 1HEUA 3LT2A 3MZ0A 1SB8A 3O26A 4L4XA 3W1VA 4ZQBA 4D3SA 5F5NA 3S2GA 2DQ4A 1BXGB 2YDYA 3OIFA 4W9NA 3KRTA 2YUTA 1YJ8A 3AK4A 4XR9A 1V3UA 1JA9A 3GVHA 2CDAA 4R16A 4E5YA 1YRLA 5A5FA 3ZHZA 3OFSA 3RASA 4E4YA 4XQEA 2PZKA 4PLTA 3I9MA 3OQ1A 3AY7A 3WMXA 3MWDB 3X2FA 1VM6A 2GZ2A 1UXHA 3HG7A 3WXBA 4BGVA 1JAYA 5L40A 1QYVA 5JBIA 1DSSG 2FWMX 3EW7A 4J7CA 5L51A 1JLLA 5C5IA 4QTZA 5JS6A 4GX0A 2FPPA 7ADHA 1EUZA 4CR8A 1F14A 4L76A 2IYPA 3R3JA 3W8FA 3BTUA 3JQBC 4OJNA 4BKOA 4Z9XA 2GASA 2VUUA 3JYOA 3NDRA 2PH3A 4J4HA 3RUEA 1JWBB 4TSKA 1VC2A 1PWZA 3H5NA 2BMAA 4RPLA 3T4XA 4AJHA 3X2EA 3GT0A 5EL0A 4CR7A 3PYMA 4IZIA 1HLDA 3D3WB 5JCJA 3TZQA 3L6OO 3G79A 4GGPA 4K1LA 1MXHA 2HKIA 5DF1A 4LVCA 1Z73A 1EZ4A 1GQ2A 3GVIA 3HWRA 1P74A 4GSLA 5EESA 3FI9A 1E3IA 1E92A 1LX6A 4R3WA 1DRWA 4B3HA 1BXKA 2I5PO 5TC4A 3NJ8A 1DEHA 3NTRA 4Y98A 2JD2A 2EG9A 2NQTA 3E82A 4JXKA 4CMIA 4A7PA 3JQ7B 5JW6A 4RO0A 1GV1A 3JD3A 3SC4A 2VHVA 4DQUA 2GZ3A 5COBA 5IF3A 1WAMA 5G0UA 4Q9NA 4KQWA 1T2FA 4XGNA 3BTSA 3PZRA 2NLOA 2QYTA 4LISA 4WOJA 4CM6A 4DIFA 5IAAA 3VPXA 1KIFA 3GZ4A 2I76A 4F45A 4FD3A 3JQFC 1WZIA 5IJZA 4WLVA 5JC1A 1SMKA 1R12A 1W73A 3I9LA 2Q49A 5DP1A 1KEUA 1D1TA 3WBFA 5HWSA 3ZI0A 3LZ6A 3OJ0A 4WEOA 2VWHA 2CF5A 3PGJA 4P4NA 3Q1LA 5KVQA 1QXSA 4LVUA 3HADA 3FN4A 2DVMA 4WCFC 1UDCA 4IGEA 4B7CA 5DBGA 3GRKA 5CHEA 4L0QA 3GHYA 4HUJA 4B4VA 3OETA 3NJ4A 4YT8A 1V3VA 4RORA 3K2EA 1YS4A 1U3WA 5IDXA 4MP6A 1G1AA 3TOZA 3VZQA 2WD7A 3VPHA 2O50A 1U8FO 3GC6A 4CMCA 2JKVA 3C85A 1PL6A 2O48X 4JK3A 4LCJA 5B1YA 5K6AC 3DMTA 5HTOA 1TT7A 5JMWA 1GY8A 4BO2A 1E7WA 5JY6A 2P9CA 5KCZA 1ONNA 3IJRA 1DBVO 1U5CA 1YJQA 1Z74A 4YACA 4BO9A 2C2YA 1OAAA 5G0SA 3QLJA 4EGFA 2LDBA 4L9RA 3OIDA 1YDEA 3AUUA 2X9GA 3W4IA 5IG2A 3A1NA 4TZKA 5TLSA 3TSCA 1HDZA 1NYTA 1O9BA 2PGJA 5JMPA 1XU7A 2CSUA 2PD6A 3PHGA 1ADBA 4G65A 3QVTA 3BZUA 4PGFA 1VE9A 3OEWA 3C24A 3ZWNA 2RBEA 3WGZA 4CV0A 3GVCA 5CDGA 2P68A 1XGKA 1PJBA 3K73O 1NWHA 4E21A 3B1JA 2GN9A 1HDCA 5KJCA 2ZTMA 2FR1A 3PHJA 3T7EA 3UVEA 4CM8B 5ICSA 2DBRA 3F47A 4BUCA 2OO5A 5KVSA 4RJTA 4AFNA 4NZ9A 1IUKA 3FHLA 3VKUA 2OP0A 3QWIA 3JQAA 1MFPA 1UJMA 4KP7A 2Y1DA 3VDRA 2AEMA 1BXZA 1PX0A 1IPEA 4K6CA 4BQPA 1EQ2A 3JQAB 2G17A 2I3GA 2ZCVA 2I6TA 4OOFA 4ZJUA 1YO6A 2F00A 3LVFO 4Y6PA 1ZCJA 2R6JA 2ZYAA 4JJFA 5LDGA 5ENDA 3GPDG 4FR5A 4BO5A 2Q3EA 4O63O 2HJSA 1R4NA 5EQDA 2VWPA 3HNPA 4OSOA 2P2SA 1E77A 2YFQA 4CLHA 2NVUB 4UVGA 4PLYA 3C1AA 3S8MA 2Q50A 4J1TA 1KERA 1M6HA 3GEDA 3PFFA 1KY5A 4YAJA 4JBIA 4GLOA 2AMFA 3GEGA 3GEMA 4DC0A 4Z3KA 5GY7A 4UUMA 1AN9A 2CZCA 5DP2A 4ZRMA 1DRVA 1YBAA 2EGHA 2VRCA 3PWKA 1FJHA 2D1YA 3ORFA 1Z45A 2FR0A 3GOHA 3LLVA 3WR5A 1U8XX 1KOLA 2CD9A 2HMVA 2X5OA 3KLPX 3JD1A 1PR3A 1N5DA 1NHGA 1C0KA 2J5RA 2ET6A 2DC1A 1KEVA 3AUAA 4O0LA 1UDAA 5FI5A 1Z75A 1Z7BA 2VWQA 4HNHA 2JFFA 2GPTA 2HMWA 4ND4A 1I36A 1DIGA 5FEUA 2WD7B 2D0IA 3VH4A 5T8KC 2GO1A 3C8MA 3WGHA 3HUDA 5AOVA 1KVRA 1B0AA 1IYZA 1NPYA 2A94A 3DMYA 4I9HA 5TNXA 3BIOA 1UAYA 4YJFB 5HA5A 1TVEA 2YV2A 3OICA 3PEFA 3UF0A 3TZ6A 4CLOB 1YL6A 3RUIA 3PLNA 4AJ4A 1RPNA 1V8BA 1RKXA 4CQLA 3BHJA 1JN0A 3GZNB 1LSSA 1WDLA 4GQAA 1D3AA 4OYRA 1UXGA 2QRJA 3JD2A 4HXYA 4HX5A 1HYHA 4CM5A 3O38A 3F4BA 5BSEA 1QMGA 3RC2A 3ZWCA 4B4WA 1KS9A 8LDHA 4KUGA 1YQGA 1P1FA 3GAZA 1GZ6A 4YVFA 3LK7A 1AHIA 4N5LA 4CMHA 4RPKA 3CTMA 1MP0A 4DIBA 4PRLA 1MG5A 3V1TC 4UULA 1NQ5A 3I6IA 2ZB8A 1P1HA 1ID1A 5TRTA 4ZQFA 1T2AA 3ICPA 3DL2A 4BNMA 2GN6A 1W6UA 1BXGA 2UVDA 4ITUA 4K6FA 2IE0A 1OMOA
chains in the Genus database with same CATH superfamily
4E22A 1DQZA 4LMPA 1Y81A 5EQFA 3THSA 4BNDA 3KR9A 4WNIA 3F8TA 3B52X 5IAJA 2RGEA 1BEUB 1Z5VA 2R97A 3SM3A 4TKZA 1KO5A 5IC6A 3G3EA 1K06A 1QV6A 4QT4A 1SZPA 2GCEA 3O8NA 3I0ZA 3WISA 5IASA 1T4BA 3IAEA 3KKMA 2R79A 3CEAA 1AKEA 4DAEA 1H2ZA 5D2CA 1H05A 5AMXA 4H7EA 1WNFA 3IQHX 4KW7A 3M1AA 1UBRS 2A0XA 1VOTA 3PC4A 1ZBQA 4I1IA 2WYUA 3JRWA 4CHGA 5FWNA 2AX4A 2WOJA 3B5JA 5FPQA 5BQOA 4ARVA 1GRRA 1SIBE 4WERA 5IPFA 4NBSA 1JT2A 1GA4A 4ZOLB 4BKQA 4WQMA 2H51A 3GLFB 4RCVA 4D96A 1YQEA 4UZEA 2VYND 2BLLA 3EPRA 3C1UA 2AJDA 5EPEA 2RIRA 5EERA 1J49A 3KDAA 1Y33E 3ROPA 1GOTA 2X6TA 4CL0A 1VIVA 1OHHD 3U7EB 3SD7A 1JAIA 2BFMA 4KE8A 2QGNA 3BIXA 3UOWA 4ITVA 2FZKA 1SRQA 1V8ZA 2VA8A 3IBCA 3NOQA 1ZK0A 4L16A 4YJDA 4ZXFA 4UEJA 4DTIA 4G1UC 4BV2A 1YRBA 3BXEA 3OE1A 4XKJA 2HLPA 2JFZA 3UV7A 2CMGA 2DR0A 2CLEB 3TGLA 5CNIA 5AXBA 4RIIA 4YJFA 1TA4A 1R74A 5U4QA 1OTHA 3G17A 2BKEA 4XD2A 2O8DA 2HSZA 1V4VA 2WIFA 5G02A 1QNFA 3EF1A 1XEAA 4O4LA 1RJFA 4DVGA 2IPAB 4X6LA 4ZYXA 4D7AA 4IPTA 1X1AA 3ETLA 4GXTA 3ZKWA 5FJJA 4KQ2A 4RHYA 3PTAA 3LJKA 3B48A 1Z4MA 3DBRA 5IK2D 1QF7A 3I64A 4JJZA 2MU1A 4TV9B 3JRNA 4ENVA 2UVPB 2QRGA 2WYOA 2O2EA 4QREA 5AVQA 4E46A 3IQIX 1EK5A 1TUGA 3QUCA 3RRYA 5FBHA 1PR1A 1UF9A 3R7FA 4DUPA 2WZBA 4OH7A 2GDZA 3Q98A 4LFCB 1GSHA 1V48A 4DOMA 4DT1B 1ORDA 4QGGA 4U6QA 3I6YA 2EJBA 1VA4A 4Q3DA 3WKBA 1HDXA 3BDIA 4O2BB 4RF5A 3NZEA 3HPRA 3KALA 3N76A 4UMVA 4YONB 1DQYA 1F0PA 3BL6A 2KX7A 1WUYA 2C5SA 2GD1O 2ZGVA 1FNDA 3LCMA 3N6RA 4QBIA 1S2MA 1K6JA 1B8VA 2CK3A 2DTXA 3NDIA 1BN7A 1LGYA 5EMJA 1QCYA 3N58A 1R9JA 2X1VA 4I5GA 3PIRA 4L15A 2HLHA 4KK3A 4MWEA 5G40A 5TT0A 3W5DA 1KEEB 1W5AA 4ZDKA 4YFYA 2H92A 5H5JA 4GW3A 5AW6A 4F96A 3EMVA 1NVEA 1KSJA 5SY6A 2RHTA 4OM8A 1GCOA 1QVWA 3B9QA 3BAZA 1YC5A 1EK6A 1K7XB 1YZNA 3LQYA 4MKRA 2ZPTX 4G6ZA 3T38A 1ADFA 1SD1A 3QU9A 3OJEA 1TB4A 5MN5A 1MF7A 2VQEB 3WY9A 5CT4A 3OE4A 1KPIA 4N18A 3IQXA 3N2LA 1HY3A 5DXAA 3ZCRA 2FX2A 4TV8A 3U4QA 1X87A 1A2KC 1BVRA 1Q1BA 2P9BA 2Q5LA 4Y67A 3OU2A 5IXJA 3S8YA 1NBWB 1QAMA 1TJ5A 4Q24A 1F6WA 1W2WB 4HX2A 4BC1A 2AFHE 2X8JB 2GX6A 3DYBA 1DE0A 4WKNA 1K0FA 1IJBA 3LCVB 3H5RA 3S81A 1FP4B 1R6BX 4YCMA 1XTJA 5JXWA 1UPBA 5CYGA 2KB0A 1Q5PA 3M9WA 1GEEA 2YYZA 1CUDA 1PD1A 3IALA 3RIMA 3ZIAA 3ZCPA 3BGDA 3QUBA 4NATA 1JHQA 4JU9A 2XVMA 2C57A 2HV8A 2O23A 1F7UA 3C45A 2FZ5A 2Z95A 1TTPB 4AG3A 1CYEA 3ITKA 1KJIA 1P7YA 1G20A 1ZI8A 3KYBA 3LXXA 4TTTS 1N8KA 2O0JA 1R3UA 2XA2A 3VJMA 2PCJA 2D74A 2QNRA 2GBLC 1NPTO 1R4AA 1T5TA 3GGJA 5GJWC 5CEFA 3EJ6A 5BQFA 1SHJA 4GBGA 2D59A 1UP6A 3D4LA 2C2WA 3OUZA 4RA9B 5HIAA 1X2EA 1Z2EA 4QELA 5AJTA 2A7QA 1KVSA 3JQRA 1IE3A 3IEKA 5JDCA 3KLNA 4L78A 1EAYA 3PJDA 4HVTA 4RH3A 3WLPA 1TEHA 1UDXA 3P9RA 4BX3A 4EJ6A 2AQIA 3FVQA 4MR8B 3AETA 2W22A 2G06A 3KAKA 4DM3A 5HJ5A 1FC0A 3AHEA 3MTGA 2WICA 4TSFA 4C30A 1WS6A 2VFAA 3B6EA 1QIEA 3QXXA 4G9GA 3ICEA 1HUQA 3ONDA 1CY8A 4BZXA 3ZJ4A 3NW9A 1G8JA 2GCIA 4YJ3A 3ZHOA 2QVCA 5FHRA 4M98A 1V8OA 1I7SB 1QLHA 1ZSNA 1DAFA 3H2ZA 4MAMA 2XXBA 2RJNA 4B8ZA 4MIEA 3ZU4A 5DLQC 1JTVA 4WZBA 4O0LA 3CLKA 1EGMB 1E2IA 2EBHX 1GVNB 4FMBB 5BOVA 3UMVA 1NF8A 2OOSA 3KEGA 2VJQA 2JIOA 2XNHA 4DEVA 2BHTA 4K6HA 4DG9A 3C7KA 1EVIA 4HFRA 1RRKA 4UHHA 3GBPA 2IC5A 4LWZA 5JSFA 1JDBC 4B33A 1NLYA 1J2EA 2FZWA 1D2NA 2VDJA 3TSOA 5K0BA 2VEDA 1LU9A 3DDNA 1NBOA 2DZDA 1PJQA 2DBZA 4MHOA 3SVTA 3PRKE 1DO2A 1W5EA 4KSCA 2XVYA 4TLBA 5AUNB 2Z30A 5KQSA 3WRWA 2ALJA 4JVSB 2WTXA 2I34A 4PZUA 1KI9A 4ZHQA 2VSFA 3BE5A 4JC0A 2FZVA 1K97A 3KYIB 4PRKA 4C2TA 1JJ7A 3V9PA 4FC7A 1AV7A 3MELA 5K9ZA 2H1RA 1QGUA 2G0AA 1X3LA 3A1WA 2PH5A 4OQXA 5E1DA 4PHCA 5EQJB 1JNXX 2OCXA 3N5CA 1JQLB 3A1EA 3MOIA 1GILA 3ONEA 4RMHA 4A0GA 4MINA 5K0ZA 3KB1A 4MPJA 4F8YA 4QU9A 5EP4A 4QSMA 4Q4HA 4G5GA 4GI3A 5BSHA 5I6DA 1LI7A 4Y6LA 4O2AB 4XQ0A 4EK9A 1KJQA 5EXSA 1XEFA 2W2XA 4J8PA 1FVOA 2AZDA 1PS9A 3HB1A 4D4IA 1N5RA 3HUEA 4B4DA 5G1NA 4PZYA 1WB6A 4LEIA 1SRRA 1F8YA 1JECA 2POQX 4IHKA 4D79A 4KXMA 4F12A 4AECA 1X1DA 5JDCC 3TPFA 1N0IA 4IDBA 1QZ3A 1AD2A 2CCKA 4MWDA 4O4IF 3VR6D 5ALIA 5AO9A 3HCCA 1NBME 2B5OA 4XR4A 3PE4A 3ELDA 3TNLA 4FZ5A 1LBIA 2VYFA 2IEIA 3I39X 3LY7A 3N87A 2XOEA 2ZEJA 2PX5A 3TDKA 4Z8YA 3UK1A 3GEEA 4QODA 4RW0A 3M9XA 4BVJA 3WLTA 2WA2A 1T1GA 1N5OX 1YASA 4PIPA 1GKUB 3W5VA 5HILA 3QENA 5KNBA 1C7EA 3AWDA 4QGFA 4E7OA 4EG0A 1UT5A 3HZZA 5AK0A 5ITVA 4BECA 4ID3A 1I13A 3LBHA 2H2GA 5EIWA 3P4UA 1YJ5A 1JVNA 2A5DA 3HB5X 1LSUA 1T26A 2GN2A 2Z8XA 3GMDA 3T1OA 4PN7A 3U7GA 2IPLA 4JL6A 2PL3A 5T6BA 3I4CA 3PQFA 5E2BA 2QW0X 2GN8A 4HJXA 1C9DB 3NYRA 4PIVA 2BDUA 1WXHA 5A5GA 1ZKDA 3LVQE 5DXFA 5FWYB 5SY9A 2ODWA 2OFFA 3PUKA 3V00A 2MYNA 1Z8DA 4DNPA 3FCCA 3LQFA 2PSDA 4FEEA 4ZEMA 3H4VA 1OX6A 5LDHA 5DNCA 3UKOA 3FMVA 1ECCA 1NF9A 4I8XA 3TLMA 5MGBA 5DM0A 3TD2A 3HFRA 4DDTA 4K40A 1LLQA 3R7NA 3P2IA 1PUJA 3DH0A 3UMGA 1NYQA 5FWAA 2QMUA 1FU7A 3ZCQA 4CT4B 2VN8A 2WJGA 4KRGA 1A5BB 1QHEA 2JPDA 2WT4A 1LFAA 2QL9A 1XMOB 4W5TA 2IZ5A 2Y0DA 4XWKA 2RHHA 5JSQA 3E9DA 1RLIA 4Q9IA 3PC6A 1DMRA 3TQFA 3NQ41 1U8ZA 2E0IA 4A6DA 3TCXB 3V4PB 1JKMA 1TCVA 1KNXA 3QEJA 2NU7B 2GF0A 1WY7A 4P36A 1JV2B 2ZVPX 1KC3A 1OIWA 2A1TR 2A5JA 2VXOA 4YFVA 1GRVA 1G7SA 5J2TF 1G42A 5CGZA 4DQDA 4MWTA 3ZU3A 2PT7A 2RAFA 4ND8A 4DHEA 2EV9A 2Q62A 4GMDA 4OK5A 1NVXQ 4BLQA 4EG4A 1ZXLA 3LDGA 5IS2A 5H59A 5I7OA 1O5OA 2EFEB 1C4KA 1AGRA 4M8LA 4DSZA 4ZRDA 1UQUA 3NT4A 2FRVA 4CMAA 4R7ZA 3I2GA 3UWKA 4A2PA 2ES4A 1OPRA 1L8AA 4KWTA 1M0SA 1BU5A 1L1EA 3RANA 1VE5A 2NNWB 2WTAA 2YZGA 2C4MA 4JLKA 4RCZA 1G7RA 5E4JA 1Y3HA 2J9YB 4M0UA 2ZS9A 4D82A 2E6UX 4RHXA 3VR3A 4WI1A 3LGSA 3QE2A 4E5UA 3TLZA 2YNMA 4D9HA 1IMOA 1WIWA 1OLXA 1DBRA 1E6MA 1XQ9A 2PZJA 3GNLA 4JB2A 1V71A 3CUTA 3A36A 3IHTA 4QDKA 3WRVA 1OYWA 1NMXA 2IF0A 2MTBA 3WWZA 4BTEA 3FCEA 2LCQA 1MC1A 3LWNA 3SCZA 5ALQA 5J1TB 3OF2A 3M0EA 2ZETA 3IPLA 3PWZA 5F76A 5HZMA 1DL5A 5EIOA 3K8YA 4JT9A 4DNOA 1UOPA 2QDKA 1UJ2A 2B21A 1H6BA 4MS1A 1CZHA 1U8CB 1KDTA 2GBFA 3IR7A 4PR3A 4PBSA 1DIBA 4XYBA 2Q1XA 2JFUA 2QJTA 3SQDA 1ZWKA 2BHNA 3IJEB 4YQEA 1V5GA 2KLBA 4TKVA 2WU8A 1NVGA 1V1RA 3OEYA 4XLLA 3E1GA 1TYEB 4PZAA 4FWTA 3UWSA 4M6WA 3TB6A 3EAQA 3DBHA 5CX4A 2QTTA 1YGPA 2C1EA 1LRJA 1JA1A 2PKCA 2AMVA 2FU5C 2Q4RA 3BWCA 1JJFA 4ADSG 2HXYA 2RONA 1UP4A 2JHFA 3KR0A 4KVAA 5FLYA 4I50F 3RLIA 3V8EA 3WNZA 3E2MA 1QG2A 1SUDA 3REFA 3F4KA 3LBNA 4I9FA 1QCZA 3IAHA 4NICA 2P11A 4RGQA 1FIUA 1FRQA 1CLUA 3JQFA 4LTDA 1XIVA 2VSOA 3L05A 4GDMA 3B6IA 4WFIA 4I4IA 4A23A 5A3RA 2E5LB 1O4WA 4OXRA 2E2WA 1E0SA 5GPBA 3LXRA 5KMGA 3PPWA 4QECA 2HA4A 3AJAA 4L22A 1EPUA 2QQEA 2RBGA 1NVWQ 1Q0QA 2CNLA 4WZBB 3BWVA 3K6JA 2CFRA 3JQ7A 4CIVA 3OOYA 1BXRB 1SXGA 2B99A 3RVNA 3T3HA 3Q3GE 1UBHS 5BR1A 5C3MA 2H2WA 1QHHB 2XBMA 1IG0A 2F1OA 3QY0A 4JVLA 1CUAA 1JKFA 1DUIA 4MWSA 5ERXA 1RQ7A 5LQNA 3A6KA 3AVVA 4DV3B 3AW9A 3GCGA 2JASA 4GLJA 2PX8A 4JLMA 4QWMA 1WTCA 1X8XA 4UJ3A 3ZK9A 4GDFA 4I1SA 1CB7A 3TMAA 2VBIA 2WKPA 3NAQA 4TZTA 4HTFA 3W9SA 1XCGB 5ALRA 3WKEA 2GHTA 1GPBA 2WJ4A 2G9ZA 1SY7A 1QUEA 1HURA 2A1UA 3BPSA 3WRYC 4C7KA 2C8LA 2TMDA 3UH1A 1H2XA 1G21E 4M0LA 5TQVA 1E8NA 1FS4A 3U3KA 2IYTA 2XWJI 4W63A 1T0PA 1DUVG 2Z08A 2CXUA 3MMXA 1H2EA 4A8JC 3QVGA 3I0MA 1TGYA 3KU4A 4YP5A 4TOIA 2GFIA 4LGMA 3C6KA 1WVGA 3A9WA 5JVDB 3DZJA 3IDQA 2HR1A 3CJTA 4X1YA 4EMBA 1EG7A 3AVTA 1WHTA 3G85A 4NONA 2P9EA 5I8WA 2WIBA 5M04A 1GFZA 4YCCA 3IOMA 1UINA 3IT0A 3QVJA 3QYAA 1LBTA 1H42A 1KZ4A 2QQ0A 1CQJA 3KKQA 5H82A 1UZAA 3ODGA 1JQ5A 4MX8A 2G4VA 1EMDA 1U28C 1NBHA 4HWPA 1LXCA 3WFIA 2J9ZB 5FL3A 4ZZIA 2D8MA 4WASA 1NW5A 1GU0A 2AG5A 6REQB 1DVRA 3KT6A 5MN4A 3KKZA 3L8EA 4HPXB 2QN9A 3NLLA 1AA6A 3BKXA 3EG5A 1XDSA 3R7SA 4EKNB 3UT5B 3C6XA 2Z5VA 3H6HA 4A10A 1R1DA 3ISTA 2BGLA 2REBA 4FIDA 3V4SA 1GL6A 3P2MA 3FDFA 2IYLD 2PLRA 3OE5A 4HDNB 4A0RA 5DW0A 2IP2A 4P6VF 3O8QB 3OFNA 4DDWA 5DW3A 3R74A 4EP1A 3C6BA 3PJFA 3GLFE 1TAQA 3LS2A 1EXWA 2BZGA 3H4IA 4F3RA 1C7RA 2VEOA 4TN1A 3ET5A 4EO4A 3COPA 2P9QA 3LY8A 3L77A 4GOXA 4Q6BA 1WB5A 2EBUA 3D6AA 5TQ2B 2VYQA 1N9GA 4I19A 5JU6A 1FNCA 2W2KA 3N9IA 2ZR9A 3O84A 4BNZA 1O8CA 3OESA 3QI7A 1OXKB 1T8PA 3S55A 3QLVA 1T8RA 1ZD5A 4G2TA 3WFJA 1XMJA 4TMYA 3AR6A 2PLFA 2B35A 4IZHA 3V1YA 4MW6A 3NUGA 3T4EA 7AT1A 1CZOA 3FLAA 1PD0A 1QFSA 1JR4A 4U7PB 4ZV7A 3SJZA 4DV7B 1W88B 4MMYB 5DYIA 2HX1A 2B8NA 2FFJA 4AY5A 1X8LA 3TCNA 2XOXA 4EQ6B 1NLMA 4KBFA 1A27A 1XXLA 4CMEC 2PGNA 4MIOA 4CBVA 1NM5C 1UFOA 3UJ9A 5MDHA 4QFCA 4EO9A 1GRNA 1NRIA 1P72A 2I3DA 2V7XA 3I2IA 1ZA2A 2GEVA 4H6WA 4RQTA 1PX2A 2V3CC 5AW3A 2GD2A 1IOVA 1JU3A 1PHPA 1O0SA 1J90A 1RXIA 2IY7A 3E7FA 1HTTA 3HH8A 3IQEA 3LAWA 4NFLA 2XWSA 1EWTA 4AUEA 2FPRA 1FS5A 1T3LA 3BRQA 3IQWA 4FDAA 1QVRA 4Q21A 2O8EA 1ISIA 3G2HA 4R41A 1QE5A 2NMVA 3NHKA 2R4TA 1RZUA 2X5XA 3LM8A 3EDRA 4LJRA 1KYQA 1WF3A 4F86A 5KQLA 4EW3A 2Q4EA 2PIAA 3QBJA 3VR3D 5MF6A 4EI9A 1X15A 4NE9A 3A11A 4KQXA 4KREA 3E8SA 4HN4B 2FLKA 3QLUC 1RWKA 2FF5A 3MWGA 3CCFA 2H9IA 4XWWA 1Y8CA 1G291 3H42B 3ROEA 4ZJZA 5JPCA 3R77A 1IBRA 3HYRA 4HAXA 5CTAA 3RS4A 1XZIA 2EOAA 2OD2A 2NXNA 3U5ZB 2QGZA 4IDCA 3JQPA 2JLYA 2BMVA 2D7DA 4GRIA 5FPTA 4BEVA 1TAHA 2PU5A 2Q5OA 1SCUB 4JB3A 2HMSA 5G4LA 2ORWA 1JU9A 3C4JA 1EA5A 4D4KA 5ESWA 4P58A 4QDUA 3THYB 3JATB 1WU8A 4RU1A 4DA0A 2YJGA 1E9AA 3NHBA 3ZZNA 2X0FA 1CEEA 1XQYA 1XZGA 2CLKB 2PSHA 4ZQIA 3V1LA 2H1SA 5E8JA 5K3CA 1XN4A 2CLHB 3BG5A 3LYUA 4Q3BA 2X2OA 5JZSA 4R9RA 4HDNA 1JKXA 2E9SA 2JATA 3EXFA 2XXAB 5GINE 1Y4UA 1CP3A 4E33A 3KHKA 2H1OA 4FFBB 4Z9FA 3EUFA 5DYGA 4O1MA 3BCSA 3M4NA 4WBNF 3QZUA 4FGUA 5KJ6A 1L5MA 4Q19A 3BFKA 5IUNC 4QOGA 1LF0A 1XR3A 5HM8A 1PG5A 2JA2A 2NUAA 3SDSA 5AT1A 5JUWA 3DOFA 1AF4A 1DMSA 2P91A 4BNJA 5JZVA 3I92A 4XJXA 4C7OA 2QB5A 2BKXA 3O8DA 5JQWA 5LMUB 3ZWQA 3LFTA 1KXZA 1YIOA 1YZFA 2NV0A 3MMPA 2HK8A 3FUTA 2GXSA 3A58B 2BEUB 4BIMA 3ND5A 1YBMA 5AK3A 2A0UA 3PT5A 4G8DA 4OFXA 4IFTA 4RPHA 3R5FA 4C14A 4D6PA 2WB2A 1U2GA 1KAMA 3BXXA 5LZ8A 5KNCA 3GGOA 1KAEA 3CLRD 3INRA 3D7NA 3O82A 1IEXA 1SCQA 1KP3A 2Y92A 3QE3A 4JC8A 4Q9AA 5ALVA 1TVKB 2YRWA 4ISCA 3VRHA 3WOHA 1N2IA 2C2HA 1IY9A 4OA8A 4BB9A 2I0FA 3O03A 3A6EA 2ZRLA 3HDQA 3PBKA 3ZIUA 1H4VB 1TUBB 5BRNA 3U3ZA 1J2TA 2QD1A 3MQ4A 4JR1A 3HB7A 2FZEA 4U8GA 2XBLA 4TV9A 4BE7B 3IE2A 2BMJA 3MYYA 3NIGB 3TTXA 1XL0A 1YL5A 3EVDA 5JECA 3L0ZA 3GB9A 3V48A 2VDQB 5F7OA 3U3XA 5JNVA 3WZMA 2ZYVX 1ZLYA 3D64A 3Q9UA 4ILEA 4EBBA 5AVXA 5FUVA 2BGWA 1RM3A 2C04A 2UZAA 1Y42X 4LWOA 1YB5A 3IJ5A 4CT0A 3ZXXA 1GO2A 4RWEA 5BP7A 2HWUA 3Q85A 5KYWA 1V7PC 4V02A 4EFDA 3R75A 2R4QA 1IZYA 1FNBA 1P1CA 2GNAA 1XG5A 1O3YA 1XYYA 2E82A 4AO6A 4OQQA 4YRZA 1MVOA 3H0CA 3KKEA 1JNYA 2Z1DA 3OZWA 4YAOA 1GPNA 2GXQA 4Y2JA 3RRXA 1YVUA 4ZMBA 3EE6A 4UVHA 3JW8A 4QRIA 4YP1A 4N65A 4RK1A 2C4UA 1TFRA 5EJ8A 1A9ZA 1U28A 1I32A 2CXQA 2C61A 4FNMA 4OMFG 5LYJB 5B7NA 3I9V1 4MO2A 4TMWA 1MAAA 4YRKA 4LHXA 4PFJA 2PJRA 3N86A 1SB9A 1QK4A 4UQLA 3NIBA 1T0IA 6PFKA 2HA6A 1YULA 2Y71A 4RL6A 16PKA 2Z43A 3MTDA 5JRZA 2RGXA 4DVJA 3WMEA 1NN3A 3C5HA 5ALSA 4P3OA 1YZUA 4QNNA 1S8NA 1M2VB 3V6LA 1DWPA 2JNWA 4GL4A 1QK3A 3F7NA 5KI6A 4HDKB 4DMRA 4OL9A 2VP2A 5JAUA 5H16A 1U1DA 1NFQA 3EFBA 4IJUA 2HV9A 2VL7A 4MICA 2WYIA 4BQFA 4TV9F 3NETA 4P2BA 4ALIA 2JDIA 3M5CA 4MYHA 3IERA 2XRYA 1GAJA 1QDEA 2RHRA 2RGCA 2YJTD 2J3IA 2F3RA 2Q9CA 2VHZA 4FSXA 4JKIA 1RAGA 3H9QA 1M5RA 1PS0A 2J5QA 3D4IA 3I52A 1L8XA 3RS2A 1VG8A 5KB3A 4NXNB 2AI3A 3IAS6 2WQ7A 2ZTUA 5AKZA 3WQQA 3JZIA 4ZEVA 3OY7A 3PFGA 3PE3A 2HADA 4ZTZB 5B6JA 4FGWA 4UAGA 3K09A 1CRZA 3GD7A 4ARAA 4Y2RA 4C43A 3B8HA 4NVRA 5HQ3A 4QDZA 3U3DA 3P52A 1M7BA 3HV0A 3VPDA 4FZVA 4RS3A 3EW9A 3QIAA 4MYRA 4HAWA 5I5EA 2R1ZA 3ZCUA 2XCRB 3NAMA 2XTZA 1NKSA 3WL4A 3CZQA 1FY2A 1ND6A 3H9UA 1FFEA 3G6WA 3GDFA 2YNMD 4X93A 4DMKA 2H31A 4AJLA 1KEEA 3QBDA 1WEKA 4RY2A 4XZ3A 2XZLA 2BPOA 2YQ5A 1MEEA 1WSAA 4YRRA 2BEWA 3TAUA 1I2BA 1Y37A 4GPTA 2AFHB 4XGKA 3WGIA 3G9ZA 3HCNA 2W2VA 1C9KA 2V7BA 5FTKA 2V6JA 3PNPA 3L06A 3NXKA 4LTMA 5HTKA 3LHDA 3UHAA 3WWCA 1E89A 4IIJB 4MV0A 1OYOA 2B8TA 4Y1EA 4AZWA 4K9SA 4W7SA 3BB1A 2H85A 2FX5A 3BREA 2XVXA 3WJAA 3HO1A 1DDGA 1DQPA 1WLYA 4A0SA 3KKKA 1JFTA 4QXAA 3CZRA 1GSIA 4AJNA 4KXNA 3AP2A 2VF7A 2A33A 1W46A 1WE2A 1XQ6A 1SKQA 5EY5B 1XE3A 1R88A 2GM3A 4C01A 1RAHA 3O93A 1U9ZA 4WKCA 4BNIA 3L7NA 5KOYA 2IW3A 5DPMA 4C4ZA 4ZYUA 5DTMA 1HPLA 4PZ9A 4BUJA 2JA1A 2NYUA 3P0HA 4LY9A 2F6RA 4JEHA 1C14A 1R8QA 1VCMA 1Z0JA 3HCOA 5SYAA 2VK8A 4B47A 4MZXA 1OREA 3NR2A 4ZCQA 5KOHB 1TRHA 3L4BA 3ND9A 2LCFA 2Z5GA 3MSXA 3OT1A 1QYXA 2D1QA 5AI8A 3SQLA 1KEZA 2ANCA 1FPMA 4EUEA 2ZJ8A 2Z4SA 2GPBA 4WFKA 4FCTA 1U7DA 3MAGA 5HW0A 1HGXA 3GJ4A 3WYAA 4MGHA 3FNFA 3MCAA 4RDCA 2VHTA 5B1IA 2COEA 1DZ3A 3H4MA 3UO8B 4AZVA 2BUCA 2C7OA 1XPUA 3DV0A 3OQHA 5MFZA 5C4IA 2AFHA 2DUJA 2IUSA 2V74B 3AJ9A 4W6QA 2EVWX 5I8PA 1RXWA 4JI4B 1XCLA 2QTBA 4MWZA 3GRUA 5KC9A 1M2WA 3N7TA 1KE1A 4R3UC 1MDBA 1GCGA 1RC1A 1A82A 4NK5A 3K8ZA 4QA9A 4F5WA 2W9XA 1DIAA 4C6RA 1RZVA 4KI7A 3QGMA 4PCUA 3MC1A 1WV1A 2P4UA 2NUPB 3BXFA 3T5MA 1QC5B 1WHSB 3MILA 4IWXA 2R7MA 2GYUA 2VPZA 4XWGA 4LZOA 3EDQA 4BFUA 3ZJTA 1C9JA 1U4SA 1BKDR 1Z47A 2MYTA 3WLLA 2QLNA 3W1WA 2XEDA 4DG8A 3O4VA 1WLSA 2YYAA 5KWSA 2CE2X 2JIZD 1C3LA 5C34B 4FI3F 1DAOA 4RTQA 1N7HA 4HQ0A 3SQXA 3EGIA 3Q7EA 4DY6A 3TG2A 2EFHB 4ETWA 1QX3A 1R4MB 3X1DA 1DX4A 2FI1A 4LJ8A 2ZIXA 1G5IA 2YXLA 4B6FA 4LRXA 3TBFA 1P29A 4DANA 3RYIA 4GOMD 1O0BA 4D41A 5C2JB 4IXNA 2PS9A 4YP9A 1GR1A 3A1VA 1UBGA 1AE1A 3NVAA 1QV9A 4WOKA 1VCNA 1PDWA 5IEJA 1GYRA 3M1IA 1Z88A 5TJ9A 4OHMA 4C4SA 2Q1TA 1E18A 1QYDA 1VJTA 3LUGA 3LX5A 1GCIA 1CUEA 3OFVA 1L1QA 4XYMA 3I04A 4NDAA 4CIAA 1PFUA 5KX5F 3H7AA 5A05A 2CEKA 2X7HA 3FRIA 5CEJA 3USES 1RP7A 1CUYA 1G1MA 4BNYA 2XDQB 3Q7SA 2Z6VA 1ISJA 4NX2A 3ORRA 4I3HA 2HD4A 4H35A 3CW9A 2VQ3A 2KS6A 4NOJA 3U4HA 3MJSA 2Q6VA 2B7BA 4AG5A 5JZMA 3AERB 4ZO7A 1ZJ5A 2WHRA 1FSZA 2ZXUA 1E4OA 3IUMA 5CFZA 1P1RA 3OJOA 3GMIA 2PA3A 3R23A 2Z5LA 3BF7A 1RI1A 1ZM4A 3JYPA 3R44A 2PG3A 5AW5A 4H0NA 4BMDA 1MGOA 4C76A 1K8RA 2PKRA 4HWRA 3R9WA 2AH5A 3NBYC 3QWFA 3KUUA 1E6KA 1JJAA 3OQIA 1D1SA 1ZH0A 1PR5A 1UMDB 1XRNA 4PG8A 3OWXA 1IJFA 4MPTA 3WNQA 1NIJA 4LFAB 1NW7A 3L7DA 4GYJA 1M34E 4ABTA 3KVVA 2I9PA 1G4HA 4MYCA 2V0GA 1W36C 1NTOA 3YASA 3L8GA 4HNAB 4E11A 2Z3WA 1F5SA 4H4CA 5EGNA 1CY6A 3WLSA 2P9JA 2VXBA 4EPTA 3AU8A 4TQ9A 4RPIA 2X9QA 3PDIA 1Q6ZA 4FX5A 2PPVA 3NP9A 5JEEA 3CO0S 5FA8A 4AMYA 4J49A 2UU9B 2QG6A 3P0EA 2BZ0A 2VP0A 4OB6A 4ZTUB 1D6MA 3GLHB 3ZQ6A 1RAFA 5I9NA 3FHOA 3BJEA 4BRWA 4GAEA 1GJRA 3Q7TA 3F6EX 2XNJA 1C4OA 4WADA 3V97A 2AZXA 3FSJX 3TM5A 3ZNNA 1QBKC 1QTRA 2AJLI 1XMVA 2C58A 3FCAA 3WIDA 1KPHA 2KQUA 3BD8A 5DISB 5JTUA 1TVMA 1ZL0A 3EIHA 3FE2A 4ME6A 4RK6A 1TADA 3FWZA 4L8YA 4J03A 5LQJA 2DBYA 4CEIA 2XT0A 3HM9A 1DCTA 2H4JA 1E7QA 4M87A 5ENZA 3L4JA 1Y7HA 2XHEA 4FT4A 1M8FA 1ABFA 3H84A 3KQMA 2C29D 1W4RA 2V4ZA 3GZTB 1Z4IA 2J33A 3NOVA 4JX9A 4WN9B 5F12A 4D4HA 1R9MA 1WWKA 5GGYA 5SV2A 5ER9A 3QPUA 3ON5A 3SIWA 4D5GA 2VRNA 3HACA 3F5QA 4OAOA 3M6LA 1ZI9A 3WAKA 4IH1A 2WAMA 1KA9H 4HGPA 4DIEA 3OJCA 1LTKA 2WJIA 4CDGA 5EHQA 5AIAA 1ZH4A 2J9FB 3I6MA 3TZEA 5JISA 4B7XA 3CBQA 4QM6A 1XLWA 2VQFB 1PN3A 4OB8A 3WLEA 3NORA 3WMGA 1K9SA 4TVKA 4P4UA 5EE1A 2XUFA 3O2NA 1JQAA 4KXWA 1QKIA 1VI2A 2VYNA 5KSZA 4JLSA 1BA3A 3NHLA 3LSTA 4DLXA 5ITSA 4QHSA 2R66A 3BGIA 1P7CA 3AHHA 3HPQA 1MOQA 3QKRA 3UAZA 3AEZA 1V26A 1W85B 3CZ5A 2VDPB 3JASA 3LC0A 5F7ZA 3OT5A 3ZG6A 2ZQ5A 3IAAA 3K30A 4Z4QA 1C1XB 3ZHCA 1SC1A 1VPLA 2ZAOA 3RFTA 2I7TA 2DHRA 5IFLA 3DOUA 1CY0A 5KMGB 1PTJA 3ESQA 1UODA 4X0EA 5IDQA 1H66A 2MIIA 3CPSA 2VPWA 1GPYA 3PIIA 1PFVA 4WZ6A 3OX1A 1AURA 2XMRA 1J8DA 2OYCA 4G1FA 4V1CI 1UEJA 5A3VA 2ZRPA 2NV6A 3IXMA 4B44A 3RTEA 2AJ8A 1ORHA 2W6NA 4RVHA 2FZLA 5IN5A 5FTMA 5TVKA 3V55A 4BWFB 5FPKA 1XHLA 5FPYA 4EPWA 1PP4A 1SR8A 2BFNA 4PINA 4CQLB 1JMVA 2GBLA 4GQIA 1G6Q1 4EB0A 5TX7A 1GPDG 2YZ2A 2QJRA 1JQJC 3JTEA 1V25A 4WA8A 5F1OA 5GONF 4ZEWA 3TJRA 3UKDA 2I65A 5K45A 5HNKA 3CZMA 1XWFA 3NEYA 3CZ9A 5AK4A 3T7SA 1U2DA 4Q3AA 5KTKA 4Y9SA 3EPHA 5ITWA 2CN1A 2GR9A 2WZDA 2FPLA 1RHMA 1EXDA 2Z98A 2RSLA 3PGLA 1AQUA 4XM2A 4X5OA 4OL0A 4ZKEA 1OXMA 4IUBS 4A91A 4DA4A 2ZCUA 5JCOA 1CR6A 2P3OA 5AVTA 2Y6UA 3AY3A 1USKA 4W5HA 2UYCA 4MA4A 4JYZA 3U3RA 2JHAA 2O2IA 4RYLA 1EHYA 1QR2A 1Q1NA 1MGPA 2A4MA 1UBMS 3IA2A 1E62A 3CRVA 4MR8A 1VGRA 3GLSA 3L7CA 3AFNA 2AG1A 2WYVA 2CXPA 3GIWA 1HE1C 1KR5A 2W98A 3D3EA 4UHBA 4ZOBA 4A1OA 1G5QA 3R1IA 5AJHA 1Q14A 4DZRA 9GPBA 1V6AA 4JVMA 3C5EA 4ZHQF 2D06A 3JD4A 2FMIA 1J7KA 4LE2A 3AM1A 1ZWLA 4NU6A 1VIAA 3IVXA 5DN6D 3DSRA 2ACWA 2J45A 5EJEA 3WLAA 5FR1A 2HC9A 4HMOA 4BVEA 4X8OA 1OZHA 4QFDA 3RQSA 2VC2B 1NJ1A 1ZOIA 1KYTA 2WABA 4ZMSA 1Y3AA 2B98A 5ALUA 4BQIA 4I4TF 5B36A 3RB8A 2W6QA 5LYJF 3KB2A 3QY9A 4CIYA 3E9ZA 1BA2A 1FVHA 1ONPA 3KYJB 4QFBA 4Q1DA 3S7TA 1KYVA 3TZKA 1MQSA 4TX1A 3H8JA 1RTTA 3ONVA 2ZI3A 2Q4OA 3NHSA 2AZ4A 3OIYA 2R00C 1JIXA 3E9NA 1L4MA 1WCWA 3A10A 3SVLA 5CGQB 2GSWA 5CM8B 2IYNA 4NDZA 1AK9A 1F9EA 4BLPA 4WK0B 1KQFA 1UK9A 4MEJA 1CW2B 3FPSA 4CU5A 2WYHA 3LL4A 3FMOB 3Q0EA 3QPCA 1HYBA 2PMBA 3A27A 5H9WA 5I01A 1XJ5A 4RZQA 2FPWA 2O3QA 5C8ZA 4BMYA 1XD8A 3HUUA 2I7DA 2IEAA 3LC7O 5BYBA 1BCRA 4CN8A 2QUAA 1RNLA 4ALNA 2I2CA 4E0BA 2N42A 2OV2A 3I30X 4NBVA 3R09A 5C3UA 4C07A 4TMKA 5A02A 3JV7A 4Z3DA 3TLXA 4U39A 3SZRA 5GV7A 4GSYA 4W99A 3UUGA 1E0DA 2VTKA 2H2FA 2WU4A 4IOMA 5BYAA 1C7ZA 1QWSA 1SCUA 1E2QA 2H5EA 3O2JA 5AVVA 2OGUA 4M36A 4MCHA 3H19A 1P7WA 2IHJA 3ZWXA 3GJRA 3M83A 3MRTA 3BJZA 5CUQA 2BMFA 2FKNA 3FB1A 5EIBC 5GZ3A 3U6KA 1VG0B 3OP4A 3ZQJA 3VNRA 1ZXBA 1UFKA 1K8YB 1NURA 4ZK2A 1J70A 1AMUA 5I7EA 1IPFA 1F0KA 2JLAA 5C0OE 4KL8S 2H7XA 2I99A 2VRWA 1GA1A 3EFOA 4M9UA 1ZBDA 4C3ZA 5IWAB 1QM5A 3PUVA 1IZ9A 3MT0A 4K2HA 5K6RA 3DLCA 1T9BA 1T6NA 2RKOA 1R4ZA 3RJ9A 1PZFA 3UC9A 4ALMA 5REQB 3M70A 3O8OB 1PGOA 3KPUA 4ESEA 3AIIA 3H2KA 4WA7A 4H15A 2FYTA 3ASYA 2R62A 3N2NA 1I0ZA 4DLNA 4BMCA 1NW6A 2PXCA 2VHXA 3OTWA 1LCIA 3EGEA 1EKXA 4J7UA 1JZSA 2IU0A 3UJCA 4QG7A 4B2PA 1E7YA 2D5AA 5DCUA 5K0TA 1FMFA 3CX8A 4Y1RB 3WX0A 2VJOA 2P35A 1RYEA 3PDCA 1VP9A 1ZA1A 4U7GA 3T3IA 4BNGA 4DM7A 4URVR 1I0IA 2H08A 1GQOA 3GJ3A 4AYWA 4JGIA 3A3NA 4EPVA 1MRZA 3KOYA 4GMGA 2HSGA 3PDWA 5KTYA 3HO8A 1NPDA 4WAUA 2N46A 3RBXA 1KXJA 5A62A 2IF2A 2EP5A 1ULSA 3ZX4A 1VJDA 4C3UA 2GNOA 4OSPA 3RT9A 1DDIA 3P97A 3PFIA 1R0CA 1VCOA 1BGXT 1KZGB 3ZDZB 2QD2A 3GYGA 3GF4A 5JD4A 5JCPA 1KYZA 3BQ9A 4N7JA 4YPFA 1AG9A 4NE2A 4CM1A 4BY9E 4JJKA 4RGYA 3X1YA 3STXA 4ALLA 3S8EA 4YQZA 1W0CA 2Z2JA 4C7JA 4DG5A 4NZOA 2GAOA 1E3QA 1CX9B 2AE1A 1YC2A 1AKNA 3NHWA 4TXJA 1NJ5A 5CK4A 5FOVA 5LIPA 1UC5B 1KSGA 1R6DA 2VOJA 3ZS9A 1Q6YA 2H1LA 3BMCA 3NBMA 5BW8A 3DE7X 3CPEA 2LZ0A 3DAYA 4KIWA 1GL3A 3FZYA 3IUNA 4OHRA 4WDRA 5DWVA 2DFVA 3CNQS 5BNWA 2X77A 1TJ3A 2IOFK 2CHUA 3N2KA 1T34A 4E1AA 4UFPA 5BR4A 2OFPA 4IJWA 3VNVA 4EYQA 1B2LA 2XUAA 2QPOA 3DZKA 3L8MA 4ZVVA 2F67A 2YL2A 5A7HA 2A9VA 3ML1A 1GFIA 3RC7A 1E2KA 3SC6A 2FN8A 4O4JF 4KYVA 4PCVA 3V3KA 5I3ZA 4ENTA 3COJA 2UUBB 1A5SB 1P1KA 4MP8A 2R68A 3AX6A 4IW3B 3VUFA 1S4MA 1TTTA 3ENVA 2UYYA 4KLRA 4CF5A 5C37A 3CKYA 1ICIA 1BJRE 2ATEA 3EXG2 1UZNA 4L6CA 1XYVA 4LAFA 4TTRA 3SHVA 3TO5A 3ZWDA 4QXRA 4BNDB 5GVSA 3OZFA 5JPIA 5BOSA 1PQYA 1ZOOA 3DTYA 1ZC3A 2F1RA 1KIMA 1Y9DA 2ONYA 3E4CA 3NV7A 1Y1SA 3R0JA 4XDYA 4XJVA 5AR1A 4M83A 5T8KA 3IAUA 4Z4CA 1ZIXA 1T25A 2O3UA 5KQGA 4I6GA 4BNWA 4BEWA 4KAJA 3GJ7A 2GPWA 3MTIA 2ZRDA 2YZKA 4TTJA 3WBJA 1NTRA 2NXEA 4KQHA 2I2AA 1JIVA 4B74A 1PR6A 4HEJA 3A6GA 4PNEA 3WMRA 3NDBB 3ZE0B 4ERNA 1D4AA 2QY9A 2WJYA 1OZAA 1R0RE 2ZTLA 3M1YA 4X3CA 3JTMA 5G1OA 4EEKA 2GF9A 2JIZA 1CJBA 2GEBA 2O3RA 3RKRA 5HJEA 3DLBA 2AC2A 4JI7B 1EX9A 4BX8A 3AEKB 5KIAA 5KTOA 5DGIA 1CRPA 1FXUA 3PKZA 1RS0A 1EVQA 2X3YA 3NWJA 4OK6A 5FWXB 1RHQA 1EM8B 4C0SA 1CPYA 1GFSA 4J16A 2JGAA 4Y2QA 3DDWA 3RWOA 3SJUA 2BHLA 2QR3A