3WYAA

Crystal structure of gdp-bound ef1alpha from pyrococcus horikoshii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
396
Chain Sequence
KPHVNIVFIGHVDHGKSTTIGRLLYDTGNIPKFAWVMDRLKEEHTKFETPHRYITIIDAPGHRDFVKNMITGASQADAAVLVVAATDGVMPQTKEHAFLARTLGIKHIIVTINKMDMVNYDQKVFEKVKAQVEKLLKTLGYKDFPVIPTSAWNGDNVVKKSDKMPWYNGPTLIEALDQIPEPEKPIDKPLRIPIQDVYSIKGVGTVPVGRVETGKLKVGDVVIFEPASTIFHKPIQGEVKSIEMHHEPLQEALPGDNIGFNVRGVSKNDIKRGDVAGHTDKPPTVVRTKDTFKAQIIVLNHPTAITVGYSPVLHAHTAQIPVRFEQILAKVDPRTGNIVEENPQFIKTGDSAIVVLRPMKPVVLEPVKEIPQLGRFAIRDMGMTIAAGMVISIQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1-alpha
publication title Molecular insights into the interaction of the ribosomal stalk protein with elongation factor 1 alpha
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Translation
total genus 108
structure length 396
sequence length 423
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3wyaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3wyaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wyaA01
1H85A 1IY2A 3GJXC 4RKEA 3W3AA 721PA 2VNHA 4WQMA 2OFOA 1YKSA 4IOLA 4QC2A 1KIMA 2A5YB 2J45A 4EQ6B 4US2R 2OAP1 1IXSB 5FOTA 5CB8A 5KNCA 3VO1A 2CVHA 3QUSA 5TXGA 1SQ5A 1E1RA 5GADl 4LDJA 2ZSBA 3SFZA 4W9MC 1X1RA 2CJWB 1DARA 2NG1A 2ZRDA 1CNEA 1N5LA 2QAGB 3FFAA 2D3WA 1KI7A 3W5UA 1QVAA 1M6NA 4L9SA 1X8KA 1G8YA 1BMFA 3RSOA 4ESVA 1QHYA 3K09C 4EKDA 3THXA 2ZYWX 3HWSA 4K8OA 1XMSA 5DO9A 1NMZA 2DCUA 2RAPA 4I81A 4B73A 5FPSA 4C2UA 5JEDA 2YVUA 2W6JA 1Q3HA 3QKUA 1IN8A 2E9SA 5KDDA 5K8LA 3CRQA 3FHCB 3EIQA 4JJZA 3OF5A 3TRFA 2ZRGA 4A2PA 2WJIA 4LHYA 1FOEB 3NC1C 3T5DA 4IDOA 5JSZB 3EA5A 2QTFA 2QRNA 3TW4A 2A5DA 4TMZA 1QHHA 1YJ5A 1K73D 3R9XA 3CKLA 1YHQB 4IKEA 4G1BA 2GHIA 4HB0A 4LYFA 1LW7A 2A78A 4P33A 2ZXUA 2H1LA 2N42A 2LCFA 2QU8A 4EQ6A 1PVOA 4TL7A 4M9SA 4XJXA 3B1ZA 2FSHA 2RGNA 1G7TA 4A0GA 1KI3A 3CCQB 1GL7A 2CEAA 4FXPA 2QRZA 4G1UC 4LSGA 3IIKA 2P5SA 4IDNA 4CF7A 1MV5A 2WKQA 5J5CA 2QAGA 1V5WA 2F9LA 3BJIC 4Z8YA 2PJRA 1DG3A 1T6NA 4JMPA 4CT4B 2V8OA 3B8HA 5F9FA 1FP6A 3BERA 4V0LA 2V4ZA 1BQEA 1E2PA 3QPUA 1GL6A 3GEHA 4PANA 4LYHA 1BKDR 2I1QA 3BORA 2PCLA 5EQTA 2REBA 5GJBA 2A7QA 4Q21A 1P2UA 4BLQA 4YMVA 3KZ1E 3ZVLA 1SXJB 1DVRA 1JA1A 4Q4LA 3AKEA 4NYJQ 1OE0A 4DCTA 2ZI4A 3CCVB 3GFPA 1G8PA 5H70A 3C16C 3V00A 3NHAA 2V6JA 2R6CA 2XNCA 1VECA 1G20E 4TMVA 1E1QA 1WCV1 1BIFA 1BOFA 1G5PA 4JT4A 4WAUA 4DIDA 2QE7D 4KSBA 3R9IA 4Q9IA 1CR1A 1DPFA 4W7SA 4TSFD 2O8EA 2Z43A 3V4FA 3IHLA 5C18A 3AVVA 2MMCA 1T5IA 3O8DA 4QNRA 4RD4A 5AJZA 1II8B 4L5BA 1SKYE 1X6VA 3GLHB 3U3MA 1IY1A 4B3GA 3WHLA 2GJ8A 3A1WA 4GT1A 2GVZC 2ZSFA 3PUWA 3AKYA 4Z51A 1DEKA 1SVOA 1S1MA 3TAHA 1EFCA 1N6KA 4PC6A 2P5TB 5DIFA 5BN5A 3CCRB 3C5CA 1W5TA 1XD2A 3LXRA 4DCNA 1J70A 2VP0A 2A5FA 2F43A 3DM9B 3W2GA 2X3UA 4RZXA 2CE7A 1N6PA 3RWMB 4BUJA 1K9MD 2Q6TA 2KBEA 2IUUA 2CK3D 2IUTA 3E5HA 4I1OA 1YI2B 1E2IA 2VH5R 4RFSB 1DAGA 2AD5A 1VQOB 4QBGB 2JASA 5DHFA 4IOJA 4KVGA 2E87A 4IRUB 3U4QB 1GSIA 3H1TA 3D7MA 2VP2A 2C78A 4NMMA 1OW3B 2FFAA 4HB4A 3GFTA 5B2ZA 2PMDA 3LRPA 4HI0E 4ZI3A 3JQPA 1JJ7A 4PFSA 1G21E 4GFDA 3LAWA 3IPXA 1ZUNB 1HE8B 1MRSA 3LFUA 5EXTA 4U7DA 1P3JA 1XTKA 1Z0AA 3A4NA 4V0NA 4URYR 2XJ9A 1LS6A 4XH9B 3OZVA 4Q02A 3K8YA 1OH8A 1W4RA 2CVFA 1KI1A 1RIFA 4QJ5A 2JLYA 3CZQA 2GXAA 2BBTA 5DYIA 3B85A 2O0KA 2W00A 2C9OA 1HEIA 4DLXA 2PMKA 3E70C 3W34A 5FBQB 3Q7PA 1KKLA 2D7CA 1Z28A 3SN6A 8OHMA 1RRCA 4Q1CA 2NPIA 3K9LA 1GIAA 1U8YA 4TLBA 3ZC3A 3FE2A 4HEJA 3RAPR 1QHHB 1UEIA 1E9SA 1CJVC 1Q82D 1XJ0A 4DKXA 3U4QA 1JECA 3CNOA 4HAVA 1M34E 3BH0A 3X1YA 2ZYVX 3LBIA 2LKCA 3BK7A 4B76A 3MFYA 2OG2A 2GEVA 4MRSA 4KVAA 3FKSA 3CR8A 2HYDA 1EG7A 1RRGA 4LZZA 3B9QA 3QSYA 1GRRA 2PEZA 4MKFA 2HMAA 3GQBA 4L4UA 4RD2A 3G4SB 2EW1A 5GJWC 1XBTA 3ZIAA 4H1UA 4DBLC 4V03A 5L3VA 4B4DA 2PX3A 4AYTA 3IO3A 3GJ7A 2CCKA 4OI4A 3MCAA 5EE0A 3X1XA 3CX8A 2BV3A 1Z5ZA 3OEED 3OW2B 4ZPXA 2F7SA 3NIBA 3UMSA 1Z6GA 1TTTA 2Z5FA 2VHUA 3C15C 4AYWA 4PQRA 3LY5A 2WSSD 3NXSA 1XTRA 2VP4A 5JZVA 2BEJA 2GDJA 1RJ9B 2NPFA 1W0JA 2B8WA 2IYZA 2REXB 3QNUA 5FUVA 1GVHA 4YC7A 1DDIA 1CR0A 2VHTA 4XSHA 4DEYA 5K8IA 3IIJA 2VHCA 1GNRA 1US8B 3DZ8A 2O8EB 4PSVA 1CBUA 3U6BA 221PA 5CM8B 3CONA 5FI1B 2YWHA 1FDRA 1SKYB 2IYQA 2J0VA 3GLHE 4JSTA 2GJAA 3MGCA 3AUYA 2B92A 4IOKA 4A92A 1R4AA 1QHSA 2F3TA 3G82C 5B30A 2JLZA 1ZU4A 1XTJA 2A5GA 3CM0A 1QGZA 2QP9X 3A58B 5L3RA 5LDDC 4LBVA 2NO7A 1WDTA 2R9VA 4O2LA 2ZJ2A 2ZJBA 1ZNXA 1CU1A 2P65A 1G8GA 1P2TA 4DWJA 1GO2A 5BYJA 1XD8A 1G3MA 2ZYTX 3LBNA 1R8QA 4Q1BA 4YXWD 3DKPA 1OIWA 4OHWA 2GXSA 4AK9A 1UPTA 3CNNA 1NJID 4MH0R 2J1LA 2PH1A 4AC9A 3CCSB 4X8LA 1L8QA 2FSIA 3C8UA 1MRNA 4M1OA 2GRJA 5JHGB 2KB0A 4K46A 2RGNC 2W0MA 3CX6A 4R2HA 4GSYA 4A0FA 1JXOA 2QBYB 2PT7A 5J4VA 2Q9AA 2BMDA 1OXSC 4YMUA 4YMSA 2WWFA 1AQYA 1EWRA 2H16A 2AKYA 2Y8EA 5H5JA 4IFBA 3NC0C 4UNRA 5LD2B 5ELXA 1H42A 2EQBA 4C3ZA 1KRHA 2QAJA 1VHLA 2QGZA 3LDAA 2HJGA 1CJMA 1NMYA 2BGJA 3L8ZA 1AK2A 2ZI3A 3U3OA 2OEPA 3CRMA 3THOA 2A30A 4B6EA 2ZI5A 4JKYA 1VCOA 3SR0A 3T06B 2OBMA 2OXCA 2FPMA 3CUEF 4PQYA 1VIAA 3RLFA 4HAWA 4URVR 3SI7A 2ZR0A 2OBNA 4JLMA 1TMKA 1Y63A 4BFVA 4A8JC 3WBJA 1KZ7B 1E96A 2C9CA 2EFEB 3PUYA 3UWOA 1KO5A 1ZM2A 3CH4B 2YWGA 2IYWA 1NBME 2AWNA 2BF4A 2ZROA 1QH0A 2GETA 3TE6A 5EP4A 1ZD1A 4Q48A 2C77A 1XMJA 3B1YA 3QG5A 3E1YE 2ZRLA 1Z3IX 2GWHA 4LV8B 621PA 3ADKA 1HE1C 2OK7A 2QPAA 3K1JA 2WPDA 2YWEA 2IK8A 4LJYA 3IKJA 4M9ZA 4R9UC 1XB2A 3WXMA 1F5NA 1DE0A 2WWIA 3UKDA 1IAQA 3CR7A 3KKPA 2GCOA 1ZM9A 3CB4A 3OJWA 2ZSDA 1TX4B 1KO8A 3EC2A 4HUQA 5JRZA 4NPHA 4WBSA 3WRYC 1X8JA 1GUAA 4BFZA 3ZDQA 2ZRBA 5SZHB 2X8AA 4CGZA 1I4DD 1VG8A 2HXSA 1U81A 2ZYUX 2HYIC 5C1BA 1YE8A 3EWAA 3MWYW 3QBTA 3CC4B 5GV7A 1RW4A 5CK4A 3IEVA 5TVKA 5FUXA 5L3SA 1YRAA 3ZVMA 2ASEA 2OCYC 1US8A 1UKYA 1VQNB 2P67A 4U00A 3UANA 3CZPA 3MAAC 1QG2A 5F9HA 4V0KA 2FZ4A 2JGNA 3Q7QA 3TR5A 1KZGB 3QVVA 3SS8A 2UVQA 3PEWA 1KMQA 3QEJA 3FMFA 4PC1A 1KMHA 3TSZA 2QSZA 2XAUA 2RKOA 1VQ8B 4PSAA 2O0HA 1XCPA 4Q47A 3H0KA 1P75A 4NCHA 3CPJB 1SXJC 3K0FB 1XZPA 1HV8A 4JLNA 1FNNA 1N6NA 1P4SA 5KOYA 2HEIA 2VEDA 3VR4A 1MO6A 1Z6XA 3TVDA 4HATA 1L4UA 3ZLJA 2DFLA 1ELOA 1R0ZA 1CEEA 3UXMA 1PJRA 1F2UB 2NO0A 2LWIA 2ODEA 3DPUA 1XXHA 1CKEA 5FA6A 5EXPA 3O47A 1B23P 5B64A 4R2IA 3OEEA 2BHRA 5IT5A 1EP2B 1BX0A 1R0XA 1HA3A 2G77B 1KK1A 3LW7A 5AR1A 2ZEJA 4CIDA 4NYIQ 3I3SR 2FN4A 4X8HA 1E94E 3VFDA 3K70D 3M6AA 4BFYA 1OPXA 4MRNA 5JWHA 1KO7A 4B2LA 3EPKA 1RVDA 2K5UA 3GEIA 1GL9B 3KXKA 1IN5A 1AZSC 3Q9LA 4LJ6A 1AJEA 4B33A 2ZETA 5JBQA 4MUAA 5HR5A 2Q9BA 3BB3A 2BMEA 1XCMA 1LS1A 1P62B 3A4LA 1QHGA 4BLPA 3WMEA 3K0CC 1M7HA 1ZNWA 1NKTA 4GOXA 3CF0A 4HDCA 2OLKA 4Q01A 4DCSA 5HZHA 5IRCD 1F2UA 1VPLA 4FMCF 1NN3A 5EE9A 4KO8A 3EPLA 4L16A 4TQAA 3LD9A 4MKIA 1P2VA 4HZIA 1YZNA 1Z63A 1PLJA 4RKFA 1ONBA 3QOFA 1OFUX 3Q72A 4JZKA 1ESMA 2QMEA 2ZPTX 4BPRA 2HV8A 3AF3A 1EXMA 2VTKA 4A8JB 1G7CA 1JR3D 2EYUA 3GJ3A 3FDIA 1H8HD 1GDDA 4MRPA 2BN4A 4TSFA 1Q20A 5DI9A 1ZD9A 2NOAA 5AUQA 5DGXA 2VNJA 3TQFA 3ECCA 3MHPA 2J7PD 4A2WA 4DB4A 2BVNA 3OFND 2GCPA 5J4YA 4KAXA 5DI3A 5FL7D 4NCKA 1VQMB 1Q81D 1SVKA 4GOKA 1UMKA 5FL7A 4U5XA 2XOKA 5J40A 3VKWA 2GCOB 2X19A 4IEIA 4KV9A 4BGDA 2ZITA 2GXUA 4HB2A 3OE7A 3BGWA 4QHSA 4RD0A 2IW3A 1GP2A 2RGAA 3Q5DA 121PA 4NKRA 5J47A 5CM9C 2C8VA 1HY3A 2W2XA 3P20A 1P72A 5IK2A 4ZIRB 2E1RA 1GOTA 3A8TA 1U9IA 1O3YA 3SFVA 1ZM4A 1AIPA 1A82A 3FPKA 1XD9A 5J4HA 4A6PA 5EMNA 5FOVA 4D4JA 3SOPA 2QDXA 3DOFA 4A8JA 3WYGA 3B82A 1FTNA 2DWOA 2QROA 1G3UA 5A5GA 1C9KA 5DYGA 3OHMA 1T4GA 4PPNA 3LO5A 3R7WA 2V7QA 3ICQB 1G1MA 3HYTA 5CIQA 4YAOA 1KSHA 2ZJZA 2H57A 4B43A 4NYMR 4M1YA 2G6BA 2J7KA 1TU4A 3GLFA 3D3QA 1KAGA 1TPZA 4O2RA 4CT5A 1BH2A 2O52A 3ASZA 1HUQA 2ODWA 4P3YA 5SZKB 4YALA 3GCGA 2B21A 4QGHA 4URXR 3THWA 1KNXA 2ZS8A 4IW3B 4Q7MB 4URUR 2X1VA 5G3ZA 1VYTA 1II0A 1QX4A 3OZUA 2JDIA 4Q5IA 1FX0A 2ANCA 4OJQA 4XWKA 1G19A 3NBZC 2ATXA 2FH5B 4M21A 5EP2A 4ASUA 4ZV4A 4AY2A 3GFOA 521PA 2IXFA 1N5JA 1JB1A 1P9NA 1U98A 1Z83A 3EW9A 4NP6A 3CIOA 4DLSA 1IBRA 4GOJA 2OZEA 1AQUA 2QP4A 1OXVA 5E3HA 1OLOA 2VP6A 1NSFA 2XJ4A 4G5OA 2JATA 1SVWA 3QXHA 1LFDB 2H18A 3FKSD 4JSYA 4LJ8A 3TVTA 3W2HA 2QSYA 5FPYA 4LJ4A 1AMOA 2ZRJA 5DLQC 2DR3A 2DERA 1S4QA 3VKHA 2QTHA 2Q3HA 3QBVA 1QFYA 1GM5A 4G5QA 2XXAA 1E98A 2F1HA 3U44B 4IOMA 5EE3A 2EYQA 1E62A 1E2JA 3LVQE 1CRQA 2F6RA 3DEFA 3EZ9A 4EPWA 2J0UA 4JL6A 5J4LA 2XNJA 2H5EA 4F92B 2AKAB 2O5VA 4HYYA 2YOHA 5DISB 3ND9A 4GZLA 1KSFX 3ND8A 4Q1EA 3I92A 2ZSEA 2WWGA 3I1FA 4PO8A 2BMFA 4BFUA 4GBMA 1QUFA 1K8AD 1DOAA 5E95A 2G9NA 5AK0A 1JEDA 4EJSC 3AF2A 1FQKA 2Z4SA 1W47A 3NDPA 4LHVA 5P21A 1VQKB 1XX6A 1EX6A 2C9YA 4G5SA 1E69A 1UBEA 1J8MF 2OBLA 3FHTA 4P4SA 1MO5A 1HTWA 1OKKA 4DCUA 2YOGA 3VNVA 5SZJA 5KSOA 1U99A 5DI3B 1KY3A 2R62A 1RPZA 2HJVA 4FINA 3G71B 3AVTA 1PZNA 3BAFA 5C4GB 4OK6A 4DDUA 4EAQA 5TARA 2WWHA 2R44A 1P7CA 4XIGS 5BN3A 2P2LA 2CRVA 3FJOA 3TJZA 1W87A 3NWJA 1QG4A 1PLKA 1YZGA 3PQCA 4HB3A 3TLXA 2KBFA 3ZIAD 3UMRA 3PXGA 4B34A 1KYIA 2ZRIA 5AUPB 5M04A 3U44A 1G3RA 4DUGD 2EFGA 2B7BA 2W83A 2R8RA 3EXAA 1MABB 3VHXA 3T12A 1JQJC 4B3CA 3U5ZB 2PZEA 2CNDA 2FFHA 1COWA 1SVIA 2OM2A 5LB4A 1NL3A 1E9BA 1QHIA 4IXNA 2YYZA 4LV6A 1E2KA 1W2GA 2OAQ1 1Q21A 3QXSA 4MRVA 1EWQA 2NMVA 3KTAA 3DVLA 5KDOA 3SJBA 1Y3AA 3VQTA 4F93B 2HF9A 2RC5A 1KSJA 2QPOA 4QKQA 3EPHA 4ZO4A 2IWHA 3GMTA 3A36A 5AN9A 1ZIPA 3BFVA 4AI6A 1OYWA 4I4LA 3VR1A 3L0PA 4LC1A 4A82A 4UAJA 4YAUA 1UJ2A 2AL7A 2ZRNA 3AQ4A 1UKVY 2BDTA 2JJ1A 3TK1A 5C46F 5EXXA 3W5HA 3SJCA 3ZGXA 4ZDKA 5KU1A 4TT3D 4ZCMA 1YRBA 4BZPA 3KKNA 4JLVA 1E9EA 1W35A 3I73A 1A5TA 2Q0HA 3KXLA 4DXAA 3ZBUA 3I61A 4KHZA 4YAWA 1NIJA 1NNEA 4ZGQB 3ZZ0A 2C99A 2Z4RA 1W44A 4C0SA 5TR9A 2GK7A 2ZAOA 5FOSA 3NTUA 3W5IA 2H92A 3OZWA 4F4CA 1Z6TA 2IF0A 1MABA 4PAQA 1T0HB 1OH7A 4BLTA 1ZVQA 4RZ2A 4DJTA 1U8ZA 4JS0A 2HT6A 1HT2E 4JBWA 4EPXA 1RZ3A 5AJXA 2VBCA 2AFHE 1WRBA 4QJ3A 3U7FB 3OIWA 4MUBA 4QGGA 2HLDD 3HPRA 3KTAB 1SKQA 2C98A 4M4SA 1KDTA 3AVQA 4O25A 4QNMA 1J8YF 4DSNA 2CK3A 4DT1A 5CYPA 5HTKA 5FPHA 1N0UA 2CE2X 1BJKA 1IJFA 5FBLB 3W5JA 1OSNA 2GILA 2QMOA 4LJ9A 4NU0A 3OIVA 4HUTA 1VCMA 2ONJA 2G0NA 2L0XA 2ATVA 4A6XA 2WICA 3K0AB 4MDEA 3EAQA 1G16A 1VQLB 1K8RA 1KSGA 1E9DA 1CJUC 2IYRA 3QI2A 5JJIA 1Q1EA 3T61A 1NIPA 2P0EA 1FP7A 3CNLA 5JCPA 2FZLA 1T3LA 4CEHB 3P26A 1X1SA 1W4CA 3WHKA 2QGNA 2VNIA 1XCGB 3LXXA 1KI8A 4NONA 2NO6A 3AGQA 4LV5B 3TUIC 3RYTC 2IWRA 3GLGE 5CJPA 4OHXA 1EFHA 2GA8A 2GBLC 3LH5A 5E4FA 4NHOA 4ZDJA 4AF7A 1KJZA 1JJ2B 2ONKA 4Q18A 1Q44A 4C7OB 4KSCA 1B2RA 1GTVA 1QDEA 2GEUA 3B9PA 2P6NA 4ASUD 2KI5A 5HKKA 1WMSA 1KK2A 2FG5A 6Q21A 1XPOA 2ZU6A 5BXQC 1ZBDA 4ZDIA 4JBYA 2XB2A 5HXBA 1CS4C 2QAGC 4C4PA 2BKEA 5CITA 5JLJA 2ZVPX 4ARZB 1K5DA 3ZD7A 1KHTA 2ZJYA 2ZRFA 4EJSB 3KJHA 2WKPA 3KXIA 2G88A 4TLDA 4XVQA 1JR3E 1IQPA 1DAHA 2JAQA 2ZUCA 3B1VA 5AWFC 3U3KA 1LF0A 2SHKA 4B3XA 2ZE5A 5E7JA 3JVVA 4R98A 1VCIA 4ACBA 2AK3A 2ZANA 3RS3A 1PUIA 5HPYB 3REFA 4P0TA 4DIEA 4IHQA 5FOUA 3WRXC 3LV8A 2AFIE 3M1IA 2XZLA 3IPYA 4TLAA 1OH5A 1NVWQ 3WNDA 4JYBA 1F20A 4KODA 1IN4A 3QFCA 2EWWA 1OFHA 1N6IA 4DRZA 2V1XA 4C7OA 1UKEA 2O8FB 4TYPA 3VTKA 3PUVA 4BRWA 3VNUA 1XE1A 1II9A 2WOOA 2QMHA 3KFXA 4OHVA 5JWOA 3EARA 4AKGA 1VQ4B 2F3RA 4V0OA 1HH4A 3K09A 1NI3A 4X8OA 5FPTA 1QGYA 4IXMA 4M9QA 1I4LD 3OIYA 1YZUA 5FBRB 3S1AA 5HZKA 2PIAA 3U7GA 4FIDA 3W8NA 1S3GA 3B13B 4MGIR 3NG1A 3NVAA 1MOZA 4KBFA 2O8DA 2W0SA 4ZCLA 2DEUA 4KBGA 1VQ5B 2RGEA 3T15A 5AJWA 3AVYA 1EX7A 3PEYA 4MYTA 1E2FA 1KAOA 2ECKA 4DLUA 2QG6A 1Z2AA 1AKYA 1VDZA 1GAWA 5H1YA 2QUZA 3L0IB 1GKUB 2BJVA 1XPRA 1G9XA 4RD6A 1T8TA 2IYSA 1BYUA 1U94A 2A2ZA 3KUDA 4XSGA 3DDCA 3FKQA 1EP3B 2IHBA 2V3CC 1KK0A 1VQ7B 4M9XA 1GRNA 5DH9A 3P1JA 4YDSA 3PEUA 4OQLA 2JLXA 2D62A 4M2LA 4IVPA 1ZRHA 1A2KC 2O8FA 2YHSA 4RZUA 4OHZA 2HCBA 4E03A 1E2LA 3U2QA 4MGKR 1JAIA 1NF3A 2I1VB 4PPGA 1E2QA 2F1JA 3T1TA 3ZD6A 4Q4HB 1A4RA 2KWIA 3IBYA 3K0AA 4PPFA 2R6GA 1O87A 2FGJA 3K9GA 3OAAD 3RWOA 1F6BA 2O8DB 2XNDD 3UG6A 3CO5A 2AN9A 3QKRA 5FPKA 2FOLA 2C95A 3CF2A 4QBFA 3BIFA 4DLRA 3RS4A 2IYTA 1F2TB 3AB3A 2J5XA 3QKTA 4QL3A 4XTRA 5CK5A 3WP0A 5JEEA 1E9FA 3QKSB 3RANA 1CRPA 4MKHA 1TQDA 1NN5A 2PX0A 1E2MA 3IUYA 3KKOA 1ZYUA 4WOPA 4ZKDA 3VR5A 3SYNA 4E07A 2IS6A 3SHFA 4ZGNB 1ZINA 3T5GA 1WF3A 2B8TA 4DLZA 1FW6A 1FL9A 4U02A 5GVSA 3ZYCA 4JLOA 3SBDA 3W90A 4L9WA 1E1QD 4PZYA 4MRRA 2CXXA 2RHDA 1TEXA 3KKQA 4Q4HA 3OFNA 4S2EA 1OXXK 4TQ9A 4P6VF 3CX7A 1GNPA 3THYB 1G4UR 5K8TA 4LY6A 5FBWB 3PENA 4HLUC 2BMWA 1ZU5A 2OESA 5EZ6B 4EJSA 1W49A 2ANBA 3NH6A 2Z83A 4XVUA 4NYMQ 1RFLA 4UXIA 1Z22A 4C0AC 1Z0DA 1NRJB 5ANRB 3BD9A 3QKSA 1UF9A 2O8BB 1G17A 1XDBA 3I32A 1JNYA 3SE0A 1KI4A 3SYLA 3NBYC 1P6XA 2QTLA 4HZUB 4BECA 2EFHB 4MDFA 2WKRA 3L0SA 1NBMD 1NMXA 2WAYA 5FUYA 1SXJA 1VIYA 4KCGA 4W5HA 2IX3A 3KQUA 4DSUA 5FOXA 5KO2A 1DAEA 1TEVA 4ZKEA 3NKVA 5JFGA 1R2QA 2QT0A 3B7GA 2ODBA 5KNBA 5KSYA 2OTLB 2BOVA 1L7VC 5JJKA 3SHWA 2OSBA 5F3WB 5TY0A 4EFNA 4QXAA 4QG7A 1RYHA 1G8HA 3RSLA 2BBOA 2P6UA 2IYXA 2GZAA 3CMEB 2ZRHA 2ZQ5A 3BXZA 2RC6A 1YZLA 3AVWA 3MWJA 5EP1A 4CZ2A 1NVVQ 2IS2A 4OBEA 2CJWA 3KUCA 1S9DA 3EG5A 4KLZA 5L3QB 4KU4A 1IXZA 3W5VA 1JI0A 1R0WA 3CRVA 3GJ0A 1PUJA 1J90A 2XITA 2J46A 1LNZA 3TW8B 2WVJA 4A9AA 4C0JA 4QBHA 2AXNA 3QG1A 3WNBA 4C2TA 2FEOA 2JLUA 2F43B 4JVNA 4JVLA 4E09A 4H9GA 3AF4A 1Q3TA 4LYJA 3B78A 4TMXA 1JAHA 2ORWA 5JHHB 4M1MA 2BCGY 3SJZA 1GKIA 4BASA 3R9WA 2FMXA 3QE0A 3QF7A 4MKGA 1UAAA 1DAKA 4M53A 4OHYA 3LW8A 3IILA 3KJIA 5KHOC 1E3MA 4PZZA 3ES9A 2MSDB 3DMNA 4DSTA 2DFNA 3JVUA 2WMNB 4O3MA 4PHTA 2FSGA 2J41A 3Q85A 3QEOA 4BRUA 4WA7A 3BFKA 4PO9A 3QKRB 1NY5A 1N25A 1XPUA 4F4JA 2CNWD 1FRNA 3A1SA 1VHTA 3B1XA 4YLGA 5C2JB 1KI2A 1BMFD 1DTSA 2XGJA 1D2EA 4GZMA 1G18A 4B3BA 2NO1A 1CJKC 2ORVA 3O8RA 3ZVRA 1WE2A 4BLSA 1SVMA 2OK8A 1OT3A 1OXUA 2GK6A 3BE4A 3QXXA 4BWYA 1RRPA 2GF0A 2IEYA 3M4YA 1COWD 1G6OA 1Z0JA 3QJYA 4OYHA 1D8TA 2R6HA 1AS2A 1ZP6A 3IQWA 3LLMA 5FTMA 5H68A 5DNYB 1XJCA 4CEIA 4BE7B 2JLVA 1QVGB 4DLTA 3OEHA 4TMTA 1LB1B 2GAAA 1TF5A 3CRRA 1RC8A 2ZVQX 5DHAA 1Z6YA 2REOA 4Q03A 3CBQA 2R6FA 3K9NA 1KNQA 1R8SA 4MYCA 3VKGA 2PT5A 4MGYR 2WJJA 3IHWA 2G1KA 4TMKA 1YVDA 4IJMA 4Y0AA 1WP9A 1W48A 1GAQA 1S9HA 4N3NA 3AVPA 5EE5B 4JLAA 4CVNA 4LBYA 4OQXA 2PLRA 5GJVC 4HE5A 2O8BA 3TGPA 1DAMA 3V4RA 1E4VA 3H2YA 3H4MA 1OFIA 2AHOA 2GVDC 1I7PA 1XD2B 821PA 4Z8XA 3QVUA 3IGFA 3UATA 4HAXA 4RVCA 2ZRAA 1GVNB 2FGKA 1NY6A 1ESNA 3G6EB 4X8MA 2QNRA 1W5SA 1RJ9A 1JALA 3R8CA 1N6OA 1NP6A 4Q7LA 2FE4A 3O8CA 3P4XA 3ZZUA 4LRWA 2FPLA 2WMOB 1N5IA 4Q7KA 2IF2A 3F3YA 5H8WA 1TF7A 5TB5A 2OT3B 3GPLA 2FF7A 3QENA 2ZJAA 3RABA 3KQNA 1S8FA 4V0MA 5FFMA 3ICEA 1E32A 2CL6X 4PPQA 4Q4JA 2X2EA 1E0AA 2B7CA 1G7RA 4IDPA 4LHXA 3REGA 3DKVA 1NVVR 3FPAA 4ACAA 1Z8FA 1W36D 4E5UA 3GLIB 5BWMA 3CCUB 1H8ED 4TL6A 4QGFA 4MQBA 1TF2A 2OILA 3FHOA 5IK2D 2AX4A 2HUPA 2QN6A 2J0QA 1XU4A 3U6KA 1B0UA 3WY9A 1UBCA 2HLDA 4KYIB 4PZLA 1GJRA 4BLRA 2G1JA 1OB5A 1CR4A 2DWQA 2EFCB 2G83A 1Z47A 2F1RA 2QEXB 3W2IA 5EUQB 3CPHA 3G0HA 1P9WA 1NBMA 2ZRPA 3UG7A 2VHQA 2BM0A 2W2VA 5KSWB 4LX0A 3ZZTA 4P4UA 2TMKA 4J0QA 5DSZA 2VLIA 2JLQA 5KPDA 5L8VA 1JJVA 1G5TA 2QEQA 4ABYA 2YKGA 3TSWA 3DMDA 2RGCA 4NTZA 3KKMA 3U7HB 2VHJA 5AUNB 3A6PC 1II8A 1TQ4A 3B60A 4Q4JB 3VX4A 4D4KA 4POAA 3NBXX 1Z08A 4G5RA 2UZIR 4NE2A 1XMIA 2WOJA 4KXFB 4XVRA 4PTLA 1CTQA 3DHWC 3HDTA 4Y0VA 4D25A 3GEEA 1G5RA 4WZ6A 3T1QA 4EFMA 1A7JA 2C2HA 2HXYA 2IA5A 1NJFA 1KI9A 1XEFA 1VMAA 3G5UA 3ZQJA 3R8FA 3ETLA 1S3SA 3Q8XB 1N0VC 1CF4A 4DLWA 2VL7A 1IN6A 4GL2A 5G53C 1QG0A 1AGPA 3B6EA 2QA4B 1P2SA 2XZPA 4IDHA 5JSZA 1QHNA 1MH1A 5EJEA 3DM5A 1SULA 3N5CA 4HAYA 2ZREA 3K70B 1TQ2A 1D6JA 2IC5A 3HU2A 3K0EA 1AS3A 4FWIB 3EZ6A 3ADCA 3FMOB 3I5YA 1G64A 1ZMXA 4LJAA 1EK0A 2ZE8A 2D4HA 2QENA 4OI1A 4Q9JA 4LJ5A 1JPNA 3QE2A 4YAFA 3U61B 2IT1A 1IHUA 4JJKA 2ZAMA 4HDOB 4AKHA 1HYQA 1KJWA 4MA4A 1ZCBA 1VCNA 1GITA 3PIRA 3ZQ6A 4UXHA 1XP8A 3LVBA 1Q1QA 2D74A 2VA8A 2MSEB 3F8TA 4NDZA 1P61B 1QUEA 2XNSA 4PR0A 4LPKA 4PC2A 2EWVA 2PZGA 3PUXA 4GP7A 4HDQB 4KFRA 4RZ3A 4BFTA 1E2NA 3EPJA 3C4JA 1ODFA 2F1IA 2WIAA 4P4TA 1QF9A 3AF0A 2WWYA 4L8GA 2W58A 3LWNA 4LOAA 3B5JA 4FCWA 5B57C 2BEKA 2F55A 5FBVB 3QFRA 1J7KA 1M7GA 2GKSA 1Z6AA 3W2FA 1G4AE 2XTZA 4TLEA 3RC3A 4DQKA 5KNDA 2RGDA 3E2IA 1OGJA 3PEVA 3AP1A 2JLWA 3I56B 2IHYA 4B3FX 5CLQA 1E2EA 3MWLA 2QBYA 1FNCA 4O0MA 4NCIA 1LY1A 2FWRA 4GPTA 1KO1A 1TAGA 1Z06A 2OUKA 4JLKA 3WMFA 4Q4AB 3VHLB 1XTIA 2ERYA 3TKLA 3RDPA 4YDHB 3CWZA 1XEWX 1GZSA 3SYKA 1Q22A 1XZQA 3TR0A 2XSZD 4TTPA 1UBGA 2RB4A 3ONWA 1JB9A 4DUGA 1N6RA 1ZIOA 1J9ZA 4NYJR 1OIVA 2EU8A 4HLCA 1OF1A 1XEXA 4GRAA 1XRJA 3PCRB 3IO5A 4XTCS 4JIMA 2IS1A 5KUTA 4HE6A 4QFMA 3CCLB 4F4IA 5GV8A 4CEJA 1J99A 2ZM5A 1XXHE 3E20A 3SZRA 4RY2A 4JLBA 4URZR 2WWWA 2FDCA 3AUXA 3CXCB 3W2EA 2XEXA 3BB4A 4BLOA 1CXZA 3UMFA 4UJ5A 3RRMA 2BKUA 3TH5A 4Q00A 1DAFA 3AP2A 2QE7A 4TQUS 5HE8A 3ZJYA 3RRYA 4TWZA 2DB3A 1KTVA 1H8HA 1ZUHA 3N2IA 4GI7A 2D7DA 1TLLA 1J2JA 3L2OB 3BH7A 1VKJA 2AK2A 1KO4A 1NLZA 5AJVB 1QVRA 1JPJA 4JL5A 5F98A 3SQXA 4A0RA 1P9RA 4Q4AA 1SVSA 1Q86D 1W46A 1X8LA 4R71A 3W6NA 3WNCA 1ZNYA 3MUFA 2ZU0C 1W36C 3OE7D 4QRHA 3P27A 2CHGA 3FMPB 3WBKA 1FMLA 3HYRA 2G3YA 4KFTA 3VMFA 1ZNZA 2J3EA 2EIXA 3VU9A 2GF9A 2XOKD 3PITA 2JLSA 1OXTA 1QZXA 2OFXA 3DL0A 2YC2C 2YNMA 5TDHA 3B1WA 4PX9A 5F2EA 2VNKA 4I99A 1ZM3A 4HUQB 2CCGA 4DDWA 4CEJB 2JDID 4MGZR 4JBXA 4ITRC 3BS4A 4BFSA 1D2MA 2DY1A 3LX8A 2RCNA 4N1AA 1MR3F 2VYQA 5AJYA 5LPNA 3EZ7A 3LNCA 5TV2A 1KK3A 1EFRA 3U3RA 4LHZA 5L3SB 1TUIA 2QM8A 2WWXA 3EA0A 1NVXQ 3LQRA 3GP8A 1SXJD 1E63A 1JEEA 1XF9A 4DC9A 4YONB 5JMTA 3RRNA 2ZJ8A 4G5GA 1Z07A 4PC3A 4AIIA 4TYYA 4DLYA 1KMHB 1MT0A 2V7QD 4N0DA 3RS5A 4BZXA 1A2BA 2YC4C 2WPDD 4OL0A 1OGIA 4FK8A 4GDFA 3TNFA 1Q0UA 2ZR9A 3W6OA 3VU9B 2CL7X 2LKDA 4II7A 3CPWB 2CLCX 3SDZA 2W2TA 4AKIA 2JLRA 4EPTA 3TIFA 4HLDA 1AS0A 2NTYC 4Y7CA 2ORIA 2V54A 3GJ8A 4PHHA 3HP1A 5A4JA 2NIPA 2WJVA 2I3BA 3KFVA 1N5KA 4Q7JB 3RS7A 2VF7A 1JQLB 4B74A 3A4MA 3AKDA 4Q9KA 4DDTA 4FN5A 4UKDA 2OTJB 4R7ZA 2C03A 2J59A 4BZQA 1EP1B 4LBWA 1XTSA 4LWZA 3TAUA 1FNMA 4QM7A 3T34A 3I72A 4BPBA 4US0R 3KQLA 1FPMA 2W6ID 3NH9A 2MSCB 3VR6A 3NHBA 1Z0KA 3MG9A 1E9CA 4NBSA 1HURA 4RSGA 5EZ5A 1BYIA 4I1UA 2XX3A 5G3YA 1TVCA 4NCNA 4F38A 4PSKA 4G1VA 3CCEB 1FQJA 2FEMA 4IVRA 1E2GA 3GLFB 2ZRMA 5JS8A 2GBLA 2IXGA 4XD7A 3IEUA 1LVGA 3AVXA 2EVWX 2VSOA 4OJKA 1XEXB 4DCVA 4YMWA 1BS1A 1I2DA 1TL7C 1FMJA 2CLDX 4F91B 1XEWY 4OI2A 2Z0MA 3T1OA 4YQFA 1DELA 4LK2A 4D4LA 4AWXA 2NZJA 4EFLA 5HCIA 5J4KA 3M0EA 2ZE6A 1AGRA 1DBSA 1E2DA 3R20A 4OI0A 2Z6VA 1W0JD 2CHQA 3VAAA 2XTMA 4AKEA 1GR1A 2J0SA 1D9ZA 3QF4B 3AKCA 4JT2A 4AURA 3UIEA 5FOWA 1P60A 4FD2A 1T91A 1DDGA 4KYUA 4QJ4A 1OKKD 4WVFA 3SC3A 4YMTA 5K8UA 1E79A 2ZI9A 4TYNA 1GKYA 1N0WA 2ZRCA 1E1RD 3A1UA 2ZUBA 3KB1A 4WXRA 3GLGA 2GNOA 3DOEA 2DYKA 2HT1A 4TT3A 5E7MA 3U7EB 1D2NA 1SHZA 2QMUA 1FUUA 1E6CA 3QIAA 5TMPA 3BFXA 3PV0A 1NSTA 2P3SA 2VF8A 1S96A 2J87A 1OHHA 1R0YA 2C04A 4RCZA 3CCJB 1FZQA 2BMJA 2BC9A 2WBLC 3DO6A 1R7RA 3EIEA 4OKSA 5FUWA 2P6RA 5KSZA 4DLVA 1OFTA 2ZSAA 4B47A 1KJYA 2IXEA 2IYUA 3P32A 4YXWA 5EUMA 1IJEA 3F0TA 1S72B 4M1TA 1OB2A 2J9RA 2X77A 1KY2A 2JEOA 3CC2B 4Q19A 1GFIA 5D3QA 5FR1A 4JKIA 2FV8A 1IONA 4B75A 3UWKA 4EPVA 1N3BA 2IYVA 1QVFB 1N6HA 3AEZA 2BJWA 1ZAKA 4D80A 4UNPA 1KDRA 1R5OA 2XTNA 1ZM7A 3SQWA 1U0HC 1BX1A 3L82B 5CDFE 3BWDD 2C96A 4Y9RA 1UFQA 3L43A 2FA9A 4PAOA 2YV5A 2DWPA 3B2EA 1W2BB 3ZS9A 2UKDA 1IY0A 1G291 3WYFA 4P31A 1W0KD 4B44A 4ILEA 1Q1ZA 1W0KA 2CBZA 3BB1A 3CPEA 3H86A 4FMCB 4JVMA 3AM1A 5JS7A 1GNQA 1XJQA 1YR7A 5FTKA 1WBBA 4LC0A 1W36B 1DS6A 1SXJE 2JIZD 3LX5A 4MYHA 4EPRA 3PUZA 2VSXA 1T0JB 2N46A 1SVLA 2QQ0A 1SHKA 1XFAA 3RS2A 3TQCA 1U0JA 2GJKA 5C4MA 4DVGA 1FX0B 3ADDA 5THXA 4XWAA 1I4TD 3CLVA 4D26A 3V9PA 1K5GA 1QGAA 5JJLA 4OQNA 3W9YA 4GP6A 2H7VA 1U9IC 5KTYA 2GEDA 4GNKA 2PZFA 1NKSA 4QHYA 1U90A 1AKEA 3I4LA 2R6AA 5AUOB 4DQLA 1YHNA 3BH6A 4PXAA 2ZJOA 4CRWB 2BWJA 2BGIA 1TQ6A 1ZW6A 3KX2A 4LI0A 4RFVA 5HE9A 1F48A 3K0FA 4NYIR 4ERNA 5H59A 4DSOA 4G0NA 4ZCIA 3VR3A 1W4BA 1IOZA 3KB2A 2OCPA 4W5WA 4M0LA 3I8XA 2XXAB 3QFTA 1E2HA 2WJGA 2QZ4A 3ASYA 1G41A 2WV9A 3QXCA 4MITA 1E9AA 1QBKC 2ZS7A 3TUJC 4C0LA 2IS4A 2FJUA 1GILA 2DFTA 1H65A 421PA 2ZIAA 2J0UB 3OZXA 4ZIRA 3TUZC 3I62A 1VYVA 1XXHB 2R6DA 1T8UA 2FSFA 4UNNA 5FI0B 4UJ3A 2F9MA 1VQ6B 4Y9UA 1KQSB 1E9RA 1AZTA 1CR2A 3EIHA 2GESA 1G3IA 1OV4A 3GD7A 3MLEA 3QF4A 1EFRD 4CYMA 1DO2A 4D0LB 2GCNA 4DT1B 3X2SA 3R7WB 4BEBA 1ETUA 5KDLA 4P4SB 4OK3A 1IXRC 1Z0IA 2NGRA 1YJWB 4KLNA 1PLLA 5IDVA 3RC8A 2QA5A 4D2IA 4M1WA 3GLGB 4BFXA 2C5LA 1XTQA 4Q1AA 1YIJB 3LO8A 2GJ9A 5IHPA 3W8RA 2ZI6A 2AXPA 4UNSA 2ZTSA 1RE0A 3VR2A 3C41J 3THWB 4IFEA 3BRWD 3LLUA 4WW0A 1UADA 4QHTA 3CCMB 2RGXA 4CEHA 3CMAB 1DO0A 3QFSA 4TYQA 1F60A 2RGBA 2ZI7A 3U3JA 1RRFA 1HQYE 2UZ3A 3PFIA 3PG5A 3J81k 2YINC 4KFUA 4B6FA 3Q3JB 4FMDB 2D2FA 4HAUA 2HDNB 3D8BA 3HU1A 4GMDA 1M1YE 1Q57A 2OE2A 4TZ0A 3CRW1 1LF5A 3LQQA 2FX3A 1M1KD 2GJSA 2NZ8A 4IEEA 2MMGA 1VG1A 2V1UA 2Q21A 2N1BA 1UDXA 4OQMA 4A1FA 2BPOA 3IBGA 1WB9A 2VZLA 3WP1B 4KJZA 1N8RD 4B71A 3RRZA 4YHBA 5D3MB 3OAAA 3I8SA 2XB4A 3VX3A 4D0GA 1E64A 3X1ZA 1FRQA 4S35A 4JLPA 2O0JA 2QY9A 1G8FA 2VYFA 1NG9A 1NVUQ 1SM4A 1EFUA 3GLIE 2XSZA 1NDHA 2GAOA 2CL0X 5LBIA 1OH6A 1L4YA 2W6JD 5JI3E 1XWIA 1Z2CA 3GJ5A 4TN1A 1GAJA 2IYLD 3KQKA 4OQFA 3PJRA 1W7AA 1OHHD 2DPXA 2O8CA 1QHXA 3ZVNA 1X86B 4LYAA 4BFWA 4PHGA 4US1R 5E7IA 3QY0A 1D1NA 3FB4A 2QI9C 4AD8A 2B5OA 1JR3A 4ESHA 1YZTA 3BBPA 2XZOA 3X1WA 5FL3A 3C5HA 4B3DA 4M1SA 1UKZA 2BIFA 4HSEA 2VPPA 4N3GA 2NQ2C 2HCJB 3LVRE 5CIWA 1G3QA 3DZDA 3MWKA 3UPUA 1YITB 3VO2A 4JLJA 2J7PA 3T1VA 1VQPB 1YZQA 4BEJA 1UDWA 3AH8A 3TBKA 1RYFA 4FCTA 4Z1MA 1FFHA 4AG5A 3PR1A 4WXPA 2JJ1D 2GZDA 3P4YA 4UQOA 3FOZA 4RCYA 3GLFE 3EC1A 1CP2A 3JZMA 1EWYA 1I2MA 2WJYA 2XNDA 1CIPA 1KOFA 1IB0A 2DETA 1X3SA 1BO6A 1U8AA 1FNBA 1XMVA 3MSXA 4TTRA 2OV2A 2OO7A 2VIIA 5EP3A 1JA0A 1IM2A 2WAXA 4Q9HA 1CLUA 4M8NE 3O8BA 3K0CA 3FYHA 4PQFA 4M22A 1KKMA 2IBMA 2Q3MA 4DB2A 2PCJA 3AP3A 2GQFA 4LBZA 1R6BX 4RJLA 1UEJA 5BQ5A 3L8YA 3FFBA 3MD0A 1CNFA 2IUSA 2IEZA 2EFDB 3WYAA 3BOSA 3JQRA 2VQSA 2IL1A 3FGNA 3RHFA 1MKYA 1N6LA 3IDQA 2PL3A 4B2PA 2DFKB 2V55B 3F5FA 4Q66C 4EUNA 2CHVA 1FNDA 3HJNA 3RS0A 1W4AA 3AF1A 4G3XA 3EX7C 1VTKA 4ZI2A 4FI3C 4U9UA 4M1KA 1HT1E 4PGOA 2FPKA 4EPYA 1FUKA 4A0HA 1H8EA 4IVQA 3EWSA 1JBKA 1WA5A 2JIZA 2GTPA 2PEYA 1A1VA 4UXJA 4PO1A 1XNJA 2I4IA 2IYYA 4JYCA 3OIUA 3ADBA 5FTJA 1K6MA 1LV7A 3SBEA 3AVOA 1YZKA 1EFTA 1GG2A 5GVRA 4TZ6A 2FFQA 4TL8A 3CF6R 5BN4A 3CRZA 4LJ7A 1WQ1R 4B32A 1R5BA 1ANKA 4FMBB 1L2TA 3L0OA 4A2QA 3D31A 4F7DA 4HAZA 2OCAA 2BBWA 3C7KA 3AV0B 2R2AA 1M7BA 2WSMA 5UKDA 1Q7YD 1VQ9B 4C0HA 5HKKD 2CDNA 1NN0A 4CW7A 5DE3A 5HCNA 1OJLA 1SZPA 1WXQA 2VP9A 5CYOA 3CH5A 1E0JA 2PLFA 4N0EA 1T5LA 5D3MA 2RMKA 4NCJA 4V02A 2AD1A 2CCJA 3THYA 1G7SA 5LB2A 1GRQA 3KJEA 4CDGA 4D81A 4PHFA 3MMPA 4OK5A 1KDPA 2VP5A 5EE1A 3OESA 1NLYA 1D9XA 4B48A 3A37A 2HF8A 2AWOA 1UBFA 3MJRA 2VO1A 2O8CB 1Z0FA 1CULC 2JCSA 3KJGA 4LPSA 3SEAA 1M74A 2RH5A 1KGDA 2VRWA 3V76A 1YJ9B 1C1YA 1ZCAA 1G6HA 4HZUA 5EXSA 3K70C 4WIAA 3KDSE 2ODNA 5KPJA 2YOFA 1RKBA 1EESA 1Q1BA 4Q9LA 3SU8A 4FMDF 2JJ2A 1Z29A 1FTSA 2B6HA 3A1TA 3OEHD 3NBFA 4P32A 1CQXA 3EASA 3ZBTA 4EIWA 4C43A 2OLJA 2V6IA 3K53A 4RD1A 1W34A 4UNQA 2QM7A 4ZDWA 4A15A 1YR8A 4ARZA 3PVSA 3QPWA 1NJGA 3MJHA 5A0FA 3OJXA 5G40A 3WMGA 4DDVA 2X2FA 4XD7D 1WBDA 4DHEA 5GJCA 3JZAA 1DADA 3E1SA 4HLQB 4IDQA 1ZC4A 3HR8A 5KYKA 1T3HA 1ZC3A 1F2TA 2CNWA 2OXRA 4C0KA 3FTQA 4AG6A 5JWRA 1D5CA 3W6PA 2A9KA 3FWYA 4QOSA 2WSSA 4DZZA 2Q3FA 2WM9B 2RHMA 4F7WA 4NZYA 4TYWA 2WJHA 1N2CE 4C9BA 5FTLA 1KI6B 4G01B 5FR2A 5JRJA 3GJ6A 3EZFA 4FWTA 3ZH9B 2PBRA 4FW9A 2QT1A 2OCBA 3T35A 1OIXA 1S0UA 1YR9A 2WIBA 2QL6A 2ZUDA 1TNDA 1ZUIA 5JECA 4TLCA 2D2EA 1YR6A 5BYKA 1E79D 2OHFA 4XWOA 1GWNA 4KI0A 5CDFA 3N70A 3D6TB 1AN0A 3S1AB 2G0TA 3I55B 3HPQA 5JCZA 1EGAA 1VG9B 1C4OA 2FFBA 4EH1A 2ZR7A 2GZHA 3U60B 4QM6A 2BM1A 4TMWA 1ZJ6A 2JA1A 2JJ8A 1W1WA 4AF6A 2ZRKA 4D4MA 4Z1MD 1KDOA 2GXQA 3CC7B 3BC1A 1E0KA 4LUCA 2H17A 3QPVA 3ZS8A 1A8PA 1YJNB 2GPJA 1UM8A 3IIMA 3RVBA 3K0SA 4JL8A 5FTNA 3THXB 3UK6A 3TSOA 2KSQA 2QQEA 3Q5EA 1SGWA 3FMIA 5DN6A 2YWFA 2DBYA 3N2EA 4W5JA 5DN6D 4TL9A 5JI2E 3CD6B 1YQTA 2V9PA 1KC8D 3CWQA 3K9HA 1E4YA 2ZS9A 4I1SA 1Q12A 4EDHA 4A4DA 4E22A 2NO9A 5LD2C 4CEIB 2QTZA 2YJTD 5FH9A 4A36A 2KE5A 4C0BA 2ZJ5A 4D6PA 1QFZA 1KD1D 1NLFA 1W2HA 3KQHA 1DG1G 1TADA 4WZBE 3TMKA 2Q9CA 3LBHA 4RD3A 3NEJA 4LCBA 1T9HA 4D82A 5IF9A 1QRAA 1E99A 2WHXA 4DEXA 4XOIA 4KITB 3MRSA 3QQ5A 5KSPA 5BW8A 1P5ZB 1E0SA 4WZAE 4HLUA 2VSFA 5L3QA 1S1CA 4D0NA 2WTUA 5G41A 1DAIA 1YU9A 1P73A 4QBIA 1AA9A 4LHWA 3GJ4A 4JVSB 1NG1A 3HU3A 1AM4D 2CMKA 2QTVB 4QGAA 4C30A 4TTQA 1OYYA 2H8KA 4H1VA 4K81B 5B58C 3NDBB 2CLSA 1NN1A 1F3OA 2BBSA 4B35A 2FU5C 4ON9A 3X1DA 1M90D 1TU3A 1JXMA 3SNHA 2BSAA 4PAMA 4Q1FA 4V0ME 2D06A 2OFWA 1R10A 3FVQA 1QFJA 1M8PA 4URWR 2A5JA 3NEYA 1MO4A 5SZIA 4Z54A 1M2OB 4NH0A 4KFSA 1R5NA 3GLHA 1MO3A 4FCVA 3AGPA 4JLDA 3A1VA 2ZE7A 2DHRA 2R65A 4GMXA 2FNAA 4K1XA 1HQCA 1TUEA 2ERXA 3QXJA 2RGGA 4L15A 3GLIA 3CW2A 2QORA 4BQSA 2KJQA 3W3ZB 5CB6A 4I1VA 1S2MA 4B2IA 1VYUA 1JR6A 1VG0B 2QPTA 3HR7A 3IQXA 2WZQA 1V43A 1IN7A 1PV4A 4LGMA 2QP3A 4NL4H 3C14C 3I5XA 1LTQA 2BCJQ 3SJAA 3EZ2A 4MYUA 3LA6A 2AR7A 4PC7A 1KI6A 4AYXA 5CLLA 2YZ2A 1U2RA 3KL4A 4Q1DA 2PJZA 2A3RA 2JJ2D 3H84A 5CJ2A 1ZD8A 4RFSA 3JQQA 4C0QC 1U0LA 3AVUA 3RNLA 1CJTC 1T3SA 2W6IA
chains in the Genus database with same CATH superfamily
4LXIA 1JHZA 3KYDA 3Q6IA 1ADCA 1VKZA 1IY2A 3LHKA 3M4NA 3QMPA 4U2BA 3IAS6 3UJ6A 4E08A 3LG2A 2VNHA 3L7AA 4WQMA 2CFOA 3WK9A 4WK2B 4US2R 1KIMA 2HK7A 3BQNB 4QU5A 3HBMA 1X7WB 4YA6A 2IE8A 3MC1A 1IXSB 5FOTA 5LYYA 5T6BA 4DWOA 1NXTA 4I5GA 3AHEA 1SQ5A 5LIPA 5B2EA 4ZYTA 2ZSBA 4W9MC 3LK6A 2GN2A 2VAWA 4C7KA 1DARA 1USVA 2NG1A 1CNEA 1TJ4A 2QAGB 3FFAA 4IKPA 2D3WA 2ENUA 1T8YA 1MJNA 4MCIA 2PUAA 1X8KA 3ND5A 2R1ZA 4U39A 1QHYA 4EKDA 2E55A 1SUWA 2X9QA 1WX1A 1XMSA 3HWSA 3UK2A 2RAPA 4DJAA 2O2XA 4B73A 1ZGZA 2YVUA 3DGEC 1Q3HA 1VL2A 1YZYA 1LSOA 3EZYA 4XPIB 1B73A 3FHCB 3L1UA 2JB9A 4XGRA 3TRFA 4A2PA 1FOEB 1LH0A 3E9QA 5CW1A 3N3BC 3UA3A 3TXAA 1NUHA 5K99A 4RAQA 2ONZA 4JD5A 1M2FA 2QTFA 4FFBA 4ZQFA 1KGSA 2WM3A 1OFGA 1QHHA 3GUUA 3HVUA 1YJ5A 4M99A 4P34A 3R9XA 1JQBA 3MLBA 4I3FA 2YBEA 3TWOA 3OBBA 4LYFA 4JJ8A 3VO8A 5I4BA 2QU8A 2N42A 3MJ4A 2I34A 1KVQA 2FSHA 2MTBA 4NFLA 2RGNA 4OMFG 3G8BA 4A0GA 1E5XA 1QCDA 1GL7A 2PHZA 4KP7A 3WDKA 4C4RA 3A6DA 2FPWA 2DYIA 3COWA 3OZEA 3BJIC 3O82A 4MUYA 4NG4A 5G02A 4YRJA 4TQGA 2OYRA 2EHDA 1ORRA 3K8OE 4HVLA 4QEDA 1PI3A 4XIIA 5CG1A 1BKDR 2I1QA 1F3LA 1GPLA 1P6QA 4W9RA 5EQTA 2A7QA 4G0ZA 3MTGA 4JU9A 1UH5A 3C70A 3MRTA 3CW8X 1OASA 3ZVLA 4JUBA 1S2IA 4ZYZA 4W1QA 1G21A 4NYJQ 4XQEA 4LVCA 4OHFA 2ET6A 2ZI4A 3JQAA 4DCTA 4DMMA 3JQAD 1CUEA 4DY4A 2D1FA 2R6CA 1GNTA 5BUQA 4JASB 3JAKA 1PSZA 3BTVA 3UJAA 1RRVA 1E1QA 1OX4A 1BOFA 1WCV1 2I8LA 2BFFB 3D1VA 4I1IA 5F7OA 4G63A 2CSUA 3FH0A 2WTMA 4TSFD 4W7SA 1XIVA 1RP1A 1V7PC 2Z43A 3BIOA 3K31A 5KQLA 3IUMA 5FORA 3IEPA 4A27A 4OPMA 1T5IA 4E6PA 3WFJA 1SA0A 4RD4A 1H6CA 1YS6A 2A6PA 2GRUA 1SKYE 3GLHB 3QRWA 4RCVA 3U3MA 3TW6A 3WHLA 1JTVA 4EYGA 1ZUNA 2V58A 3A1WA 2WYVA 5DTRA 2GVZC 1HTTA 5ALDA 4FSXA 4HWRA 1PNQA 4DW8A 1SBYA 1YZ3A 5JSFA 3RC1A 3KYCA 1BXGA 3TAHA 9LDBA 4K6OA 1T10A 3DDNA 3BXPA 2B7LA 2ILTA 2AF3C 4XLFA 1EVEA 2PKCA 1JEOA 3ORYA 4PN7A 1DOZA 4QLAA 3CCRB 3C5CA 3LXRA 4F85A 2QK4A 1UWVA 2AFVA 4UM7A 3RD5A 2GZ1A 2VP0A 4E88A 2F43A 1SBQA 2X3UA 4C21A 1DMRA 3PUIA 2QW1A 2AQ8A 2X2PA 4BUJA 2YWRA 1QP8A 5TGTA 3IP9A 1KEVA 1RE1A 4AFNA 1EM8B 4Z9FA 2MSNA 3R5XA 1E2IA 5D7NA 1DAGA 2MIIA 1P1BA 3Q88A 1KWGA 1ISRA 4WX2B 5DHFA 4KVGA 2LV8A 4JUAA 3UPTA 3PNVA 1GSIA 4D44A 3D7MA 2C4NA 2VP2A 4AY4A 1T8SA 4NMMA 1OW3B 3AR5A 3OQVA 3E3NA 3EIWA 3HM2A 4G2NA 5B2ZA 3LRPA 3OFVA 2AG0A 3PQ7A 4U6SA 1RJGA 4ZI3A 1N57A 4GFDA 2YY5A 4L8FA 3LAWA 3IPXA 3UJCA 1HE8B 4IIGA 4CR7A 1MRSA 1VXOA 3LFUA 5EXTA 3V97A 1UBUS 1MRZA 3A4NA 3F2VA 1DJPA 4V0NA 3MOGA 4URYR 3G0OA 1GZ5A 4ZK6A 2ZVJA 2F3UA 4M86A 3K8YA 4BQOA 4J3JA 1RIFA 3JQ6A 2GXAA 3CZQA 4BKPA 2FRXA 5BVGB 3COPA 2M1ZA 2C9OA 1QGED 2Q4DA 3OLQA 3SYRA 2V3WA 3WIVA 1GPBA 4LRQA 1N3LA 4ZOBA 2D7CA 3ZNNA 2QUBA 1EM6A 2VQEB 8OHMA 2P75A 2R1TA 4G0UA 4JJGA 1R0KA 1U5AA 1M2NA 2H00A 5ALGA 4G2TA 3N8NA 2ACEA 5EUBA 2VH1A 4TS3A 3ZHTA 1KXJA 4AXBA 4C04A 4CM4B 5I5GA 5U9CA 1JECA 3CNOA 3BH0A 1Z45A 4LI3X 5T5QA 2ZYVX 3W9UA 3X1YA 3FG9A 1UKBA 2LKCA 3BK7A 3DBVO 4B76A 4EGQA 1JLLA 5FWXB 2H59A 2NU7A 3I76A 1I0LA 1EPUA 2J4DA 3EIOA 1J20A 4KO3S 3U3ZA 3DD5A 5L95A 1EG7A 5C5IA 4P22A 4MMYB 3QSGA 3QSYA 1GRRA 1SC6A 2PEZA 4FGLA 5F1OA 3GQBA 1YO6A 4L4UA 3WE7A 3H9CA 3ME5A 1ZXBA 1XRNA 2Z2YA 1O97C 1XN4A 2V3VA 5JO9A 3VPFA 2ZBVA 1L5ZA 4BX8A 3ZIAA 5IAJA 4H1UA 4CJXA 5L3VA 2ATIA 5NULA 1KORA 4AYTA 4Q93A 3WIBA 2R8OA 3MCAA 1TCVA 3WAGA 2WHYA 1R4NA 1F8YA 3H2GA 4D3DA 4WVLA 1ZG3A 3TOCA 3MYYA 3ZEAA 2A4KA 4O4JB 4PQRA 2D5CA 1KEUA 4LE1A 4ZODA 1XTRA 2D2VA 2VP4A 4GZ6A 1RJ9B 2IYZA 3NAZA 2ZIXA 4I55F 3NAMA 4L4YA 4XZ3A 1BX3A 2FP3A 2TS1A 2Y71A 3AMVA 2B8JA 5F5NA 5L4LA 2P35A 1WMFA 2VHCA 2VNAA 2IZ6A 3DZ8A 3GD5A 3IVMA 2O8EB 1CBUA 2IHUA 3BXXA 1EVYA 3LQFA 4UUOA 1GZUA 3ANLA 4QSHA 1GZVA 1SKYB 3GLHE 4C06A 4NE9A 3PU6A 4B6QA 3MGCA 3OC0A 1JKJA 1MQ9A 3QYJA 4NY1A 4N8SA 2WIJA 5EHIA 3QA3E 2COKA 4I6JA 1HVXA 1LDYA 2HF2A 4DNFA 3IE0A 3L8EA 4Z4CA 2Y6VA 1S7CA 1NPYA 1EFLA 2I80A 2NO7A 1OYOA 3O1IC 5IYZF 1LZKA 2ETXA 3WG9A 2ZJ2A 2J3LA 3T5PA 1F8UA 1P2BA 2P65A 1P2TA 1SIWA 2XDQA 3IQIX 4WUVA 3T7JA 4C5CA 4DWJA 1XD8A 5F3DA 1G3MA 4HQOA 3LBNA 3GNQA 1FU4A 3GEPA 4HV4A 2YFKA 3DKPA 1OIWA 3D3KA 3AZQA 3FVRA 4UOQA 1UPTA 1NJID 1ND5A 4ZP1A 4NATA 3CCSB 4QQFA 1NVTA 3H9EO 5JAOA 2PM8A 4YJHB 1IPFA 4C87A 3L01A 3C8UA 2HWXA 5U1PA 3SY8A 3T0GA 4K46A 4R2HA 1R37A 5FP0A 1YTLA 2P3OA 2R96A 4LYGA 4O0LA 2WYWA 3TPCA 4CE6A 3O2NA 2AZXA 1NTOA 2WA2A 1L5VA 5LMZA 1M1XB 1ZW1A 3R6JA 2HA3A 3LQ2A 4L2IB 3AB7A 4P86A 2BGUA 2W6NA 2XPCA 2FWBA 3B1FA 4YMUA 2WT4A 2WWFA 1E6LA 1N2CB 1EWRA 1DV1A 4PBSA 3MMZA 2AKYA 4WCVA 3ANYB 1RTKA 2HJWA 1U6IA 2YYSA 3KLMX 1IWPB 1VMEA 3QU9A 4N5NA 4Y2RA 1ULTA 2A94A 3PDIB 4DQXA 1VHLA 2PS1A 2QGZA 3UJ9A 5J59A 3UVEA 3L8ZA 3WQSB 2EKBA 1OX6A 5CXXA 2WF9A 4C1NA 1TQHA 2OEPA 4X5OA 2FZEA 1EXNA 1SUIA 4QIHA 1WLSA 2HHAA 5IASA 1TUBA 4B6EA 4QU9A 3W06A 2BR3A 4WFQA 4WK6A 4WCFC 4DDVA 2FPMA 3H4TA 1U7TA 2Q8PA 1BROA 2HH9A 1IDOA 4S1PA 3AR9A 3QBJA 3RJTA 2ORYA 3SD7A 3WRVA 4BGEA 3BGOS 3RGGA 3X2FA 4BFVA 1RFGE 1U31A 3PUYA 4IHKA 4JNCA 1M8FA 3UWOA 4YT4A 4EW1A 2PUEA 1C0KA 2CWWA 3KV3O 5HFAA 2IYWA 3KDAA 4EDFA 3ETJA 2ZWMA 2BF4A 1QE3A 2ZROA 2ZXHA 1MOPA 1QH0A 1HFKA 3PIIA 3PFFA 3FZGA 5EKXA 2H06A 4QOGA 4QXMA 2BAGA 2JN9A 5DHQA 3FHLA 2C77A 5BQFA 1BVYF 1XMJA 4TVOA 4INPA 1N05A 3EEBA 3C3KA 2TMYA 3W78A 3F73A 3OT4A 2QJRA 3H8WA 2GWHA 4LV8B 4WJLA 1N2XA 2PA0A 4M9ZA 4LJYA 1PNVA 3IKJA 3FXAA 1P45A 4FLFA 1F5NA 3DOOA 4I5FA 3C1OA 4HNVA 1VLJA 3UKDA 2MJLA 4HT3B 5IYPA 1IAQA 1A8SA 2WYIA 3L77A 4CV1A 4GI5A 2X7XA 2GCOA 4GLBA 4IIJA 4TS4A 5CAEB 3VKFA 4B31A 5BMVA 3NVKI 3RUFA 4UTXA 2OO5A 3C3PA 5CB4F 5JPCA 3A35A 3I2FA 4S05A 4NPHA 2NUPB 1XA0A 3JV7A 4P38A 1X8JA 3WRYC 4DM4A 4BKOA 1GUAA 4BFZA 5DP2A 4IJQA 2FLVA 3HLKA 4CNQA 5HW0A 1B43A 2B1IA 4AUEA 1Y34E 4GO1A 4CGZA 4Z4SA 1SCBA 2I4MA 1VG8A 5C1BA 4WKNA 5DNEA 3F5QA 3MWYW 1JU3A 1RW4A 1WQ3A 5HA5A 3UHJA 5L3SA 1JX6A 2ASEA 5ISMA 1XAIA 2OCYC 5INTA 4R1OA 1OBCA 1UKYA 3CZPA 3E9ZA 5LQDA 2PMBA 4JHLA 3VC2A 2NZYA 3L7MA 3QVVA 2DUNA 4MEAA 3PEWA 1ADJA 4W9NC 1CT9A 3MW8A 5HBRA 2C5GA 4EKGA 1KMHA 2V7XA 1J00A 1M67A 2W4MA 3LQ1A 4JI7B 4LF5B 4B7AA 1H4VB 1QDLB 2RKOA 1MVLA 3HU5A 3LF2A 3REQB 3F7MA 2CUZA 3HCDA 4MCJA 1HBJA 2NZUG 2BEWA 4KIUA 1C0LA 2XE8A 4NZ9A 4Y2HA 5AOVA 1DTEA 4NJMA 1HV8A 3AL2A 1N6NA 2B1RA 5FIUA 3BY2A 1P4SA 4PX2A 3ZGVA 4KQEA 2HEIA 4DZRA 2EBFX 2VEDA 3AT1A 3T9EA 1Z6XA 4HATA 4XJSA 4WBNF 5CXUA 2DFLA 2WE7A 1R0ZA 1QH8A 1T5BA 3HO8A 4HXYA 2OUIA 1LBSA 1CEEA 2C5FA 2YJZA 3JU4A 1JN0A 1PJRA 2MYTA 3FFXA 4OQZA 1C9EA 2B4AA 3DEKA 4YGYA 3G2PA 2HLPA 2XLBA 1KP2A 3QLEA 5C8YF 3E7XA 3M1YA 2QUAA 1ESCA 5EXPA 2PXXA 4S1OA 4XLZA 5DHPA 3E8MA 3JATA 2ZYGA 4C4TA 1ZJ5A 2QX6A 1ZK4A 5B64A 3OEEA 1V11B 5HTOA 1JT9A 4HQLA 1BDIA 1RPNA 1XRPA 4G89A 5AXDA 1BX0A 1T34A 1R0XA 1FMFA 3RU2A 2G77B 2UZ0A 1B6SA 1VB5A 2PUCA 1XCBA 4EZIA 1P7YA 4GXQA 2GLTA 4AAYA 2FN4A 3MTBA 1J0BA 5CPBA 3K4QA 2FUEA 2QLFA 4MRNA 1AHPA 3BK1A 2D5LA 1FLNA 1YKFA 3JWGA 3HP7A 5K3SA 1C2TA 1PTJA 3LT1A 1P39A 1RWBA 3F1LA 1UAYA 4B33A 2ZETA 4KE8A 3A6LA 4MUAA 1A97A 1XCMA 1LS1A 2WSBA 4MIEA 3H9GA 3LHIA 3QE3A 1JDVA 4XLTA 4BLPA 5KTMA 2PUVA 2W98A 4H18A 1M7HA 2GYUA 3S6JA 2R4TA 5L51A 4HDCA 4XNFA 3FLAA 3UK0A 2WFLA 4FMCF 2JLCA 4RDKA 1CZLA 1I4EB 2Q5OA 1AT1A 3EPLA 3FWZA 2ZB2A 5CA1F 4LF4B 3LD9A 3ZDYB 1L0BA 1P2VA 1SU6A 4O2AA 2IEBA 3U1TA 4RKFA 3DNFA 3QOFA 4FEEA 4X62B 4KXLA 1RXIA 4W7HA 5CNIA 2HFJA 3Q72A 4UZFA 4JZKA 3CE9A 4QWMA 1U1EA 4YS6A 2HV8A 3AF3A 1EXMA 3GRCA 3TKAA 2OPHA 1GUZA 3GJ3A 1AV7A 4XKWA 3EDRA 3FDIA 2JCGA 3PFNA 2PANA 4MRPA 4TTSA 4QQKA 5DI9A 4E4TA 3DQQA 1Y1TA 3R6GA 4JJ7A 3NWEA 3TQFA 3Q7TA 2P3QA 5CHEA 4YELA 1P1CA 3C3BA 2J7PD 4P0QB 1WZIA 4DB4A 3OFND 2A0YA 4DQDA 4D43A 1JFLA 1FMTA 3T0IA 1NPTO 4YAEA 2CB0A 4IDAA 1Q81D 3V6LA 2XOKA 3NOOA 5J2UB 5LQSA 2PU5A 3VKWA 2RJNA 2GCOB 2X19A 3MTJA 5CAEA 4IEIA 1QWSA 1B41A 4KV9A 2ZITA 4RKYA 3GAZA 4QHSA 5FWAA 1C4WA 3E1KA 1KYVA 1SUSA 1GP2A 4QUJA 4B9EA 2NUPA 4QVJA 2JKVA 2DUWA 5B12A 4JQZA 4KDFA 3N7TA 5CM9C 3VHXB 1G5HA 2E1RA 3DWGA 4QYSA 2B98A 1QK4A 3PI7A 2H4JA 1AIPA 1A82A 1YE3A 5J4HA 3Q0TA 4RPKA 5EMNA 1Q0ZA 4C5AA 1KRWA 2Z8XA 3KL2A 3DOFA 2W2QA 4BV9A 1XZAA 2DWOA 4CFSA 1G3UA 2GVNA 5A5GA 1NXWA 5LLDA 4Z7QB 1Q16A 4FFMA 1NW4A 2A33A 1DEAA 1OZGA 3O8NA 4EYOA 4WY5A 2A1UB 4FZRA 3I2IA 3VYSB 2P7IA 3HH8A 4CMJA 3HYTA 1HXHA 2J31A 4DWVA 3LUKA 4YAOA 4RVDA 3RUDA 4W5TA 2EKZA 4PG4A 4BN0A 1KSHA 3NTVA 1YDHA 2H57A 3B38A 4J43A 3N0WA 2G6BA 4R8LA 5E8RA 5TGZA 3C1AA 3UBMA 1KAGA 4R2MA 3ZE1B 4N49A 5KTTA 1ODJA 1TPZA 2O52A 4MAAA 2H7XA 3RG8A 3ROKA 2GASA 4E7OA 5JALA 4AJNA 1E58A 1AF7A 1U7PA 2ZS8A 1KDYA 5IULC 4K3UA 4Q7MB 4IDFA 1LPBB 2PRZA 3G7NA 4URUR 2L2QA 4RMNA 1ECGA 1II0A 1LFAA 3E3AA 4IIBA 3KU4A 5CH5A 3RPEA 4MJ3A 4N39A 4QPPA 5IVHA 2ANCA 1X2BA 1UDBA 1G19A 3NBZC 4EWLA 4ER3A 2FH5B 5EP2A 5T4HA 4ZV4A 4KDEA 4ZVMA 3GFOA 4MO2A 2X8LA 1JB1A 1F5SA 1U98A 2H65A 1VXRA 4QAQA 4ARUA 5JNVA 1U7HA 3Q7SA 4ETWA 2OZEA 3ILYA 2JH9A 1SMKA 2YIMA 1DUSA 4AX8A 4N40A 2VP6A 1K7FB 1NSFA 2Q2QA 5I7WA 2JATA 1AO0A 4DYHA 4G7WA 1CUYA 4M83A 1LFDB 1XU7A 4DXHA 1CHDA 1TKRA 2ID4A 1GGFA 3NT2A 4E14A 1HE3A 1A8UA 3QWFA 1UOOA 5L7WA 3PA6A 1IRXA 2ZRJA 5KAPA 2C1XA 5DLQC 5KYXA 2DR3A 2YN0A 1S4QA 3ZU2A 4BE4A 3VKHA 2Y0BA 1P5HA 3MCUA 4MR7B 1V0JA 2CGEA 1WEKA 1IRIA 3QBVA 1GM5A 2IYFA 3TQTA 2OCXA 2RGYA 3OT1B 4Y7DA 3OQMA 3TZBA 3MMSA 3ZWWA 1FXUA 2QN7A 4CKWB 1JDTA 2MSWA 4POOA 1E2JA 1NVGA 5E6UB 1JVNA 1CRQA 3DWFA 3W0LB 2QD2A 2J0UA 3I0MA 1R50A 2JIDA 5PGMA 4FUTA 1MBZA 2YOHA 3HZRA 4KXVA 3CEMA 4XA8A 4Q1EA 3ND8A 3RVNA 3I92A 2ZSEA 3I1FA 2BMFA 6REQA 1COZA 3OQJA 3W8DA 2AFHA 1SB8A 1DOAA 3E84A 1AB5A 1M6WA 4PCUA 5AK0A 5E95A 5FUQA 2GNAA 2ZTNA 1VQKB 2NUAA 2WU0A 1YR1A 2A8YA 3BUSA 3I09A 1YVRA 2G9VA 2IOFA 2PH5A 3A3KA 4PXSA 5B7QA 4YMLA 3AUAA 4WY8A 3FHTA 3VAZA 1ZWLA 4P4SA 1L3BA 2IOHA 2DHEA 4KQCA 4DCUA 1ZRNA 5EMJA 1EGQA 1FFDA 4EYSA 5CBKA 5KSOA 1EMDA 4YGXB 2FQQA 5C52B 2R8EA 4I14A 4FINA 1FF9A 3N05A 1PZNA 3BAFA 1HDZA 2E85A 2I66A 2PLNA 4OK6A 1CYEA 4EAQA 1AX9A 2WWHA 1MEOA 3AJ9A 1PWHA 3HDVA 3TJZA 4ZI7A 3TLXA 3DVQX 4E5VA 3QQPA 3UWDA 4ENPA 3MT8A 5AUPB 3E61A 3IDAA 2ZJFA 4HH4A 1WR8A 2XWJI 4OPVA 2XMCA 1HE5A 3PUJA 4OV6B 1G9SA 4DUGD 3SF0A 3OZFA 1PO7A 4GBJA 4M0DA 3JQGB 2AGVA 4ZT4A 3VHXA 3ZDCA 5LP6B 4B1FA 3U5ZB 2XKJE 5BSUA 2FFHA 1HNWB 2OM2A 5LB4A 4KUHA 3MINA 2PNJA 4ND4A 1KPIA 4CMEC 2YYZA 5B6IA 1E2KA 1A69A 1Q21A 5LC1A 1JL3A 1G5FA 1OCEA 4L74A 2NUBA 3A3YA 2NTEA 4ZVVA 1Y3AA 3GLUA 2RC5A 2QPOA 4B6PA 4QKQA 5KWVA 4LCJA 7MHTA 1D4OA 3QLUC 2IWHA 3NPAA 3A36A 4WDQA 2HC9A 1QKKA 4XUCA 4J7CA 1V7ZA 3KKKA 2BFMA 3AUKA 4LC1A 5JSHA 3I5MA 4G7XA 1ONPA 2Q1TA 4UAJA 4FHEA 5KVAA 2ZRNA 2GM3A 1UKVY 3QBDA 2Y93A 3E7FA 5EXXA 3W5HA 4MGHA 4ZDKA 5KU1A 5ICCA 5JLAA 4ZCMA 2X9VA 1Y6RA 3PEEA 4JLVA 5B7NA 1VL1A 1YL6A 2I99A 2Q0HA 4YJFB 4OPOA 3C24A 3U09A 1JMVA 3JS5A 3V2HA 3FCCA 5ICGA 5IKEA 2REQB 1UXJA 2Z4RA 3QUCA 4PM4A 4DQVA 3O91A 1E6UA 2V7BA 1ZR2A 1B0AA 2G80A 2O1XA 4HK4A 3WDMA 2FP4A 1CUIA 5DV9A 5ES4B 1T0HB 1OH7A 2ZSKA 3NM5A 5ESRA 1U8ZA 4LXQA 3USZA 4JS0A 1RZ3A 4I1YA 3GT7A 3WTBA 4C08A 3S2GA 3K4PA 4EEKA 3EZGA 1JV2B 4WZZA 3HPRA 1PZGA 3PK0A 1SKQA 4YTEA 1LWNA 3WL5A 4M4SA 3MTAA 2X3YA 3OWXA 1J8YF 4DSNA 2IEGA 3PWKA 4JH0A 3QX9A 4KEAA 1KQFA 1RYNA 3D7NA 3ZCUA 2XDYA 1CQPA 1N0UA 3CLTC 1BJKA 1IJFA 3HJRA 3IQEA 3PD1A 1DRUA 1UZUA 3W5JA 1MNQA 2PUFA 1KQPA 1VE3A 1E1NA 5CLGA 4HUTA 1B2LA 1TAHA 1VCMA 3L93A 3KD2A 4Q24A 2IDKA 2AJCA 1ZKMA 5B5SA 3K0AB 1T9GR 4DGSA 3P5SA 4RHCA 1XQBA 1ZD4A 1RLUA 1BWQA 4KRGA 2XQIA 4QUAA 3TSAA 2UAGA 3ABIA 4DV2B 3T3HA 2XMGA 1A4UA 1Q1EA 3DT8A 4AVZA 3SHQA 1NIPA 2UUAB 5G4LA 3IT1A 1Z4NA 2ENWA 4YAJA 2GZSA 3P26A 1W4CA 2IYPA 4FFWA 4BNFA 2HPVA 1XLTC 3WLQA 4UU1A 1KI8A 1VJDA 4WDRA 1TDJA 3C3DA 1WZCA 3NNSA 2BI7A 1NUTA 2OR3A 2QG4A 4GMHA 4OHXA 1WUKS 5CJPA 9ABPA 5MFZA 2GBLC 3LH5A 4X07A 3BGDA 4M0UA 4BLVA 1EJ2A 1GU0A 4AF7A 1KJZA 1JJ2B 1CJCA 3PVZA 1Q44A 3LJKA 3DTVA 3KQMA 3PD7A 3B9PA 3OU7A 3M5DA 5EIBC 4ASUD 5FT9A 1ES9A 2X0DA 1WMSA 5J2TA 1XPOA 2ZU6A 5KI6A 2E4UA 5ERXA 2GEBA 2QTNA 2P9GA 4BV2A 1EDBA 2FXVA 3B9BA 3SPXA 4C4PA 1PBNA 1NJ6A 2CXQA 1R4MA 1GPMA 4KN5A 3GVHA 3UB2A 4FJ0A 4RXUA 3TJRA 2QZJA 5CB4B 5DYYA 3KXIA 3T38A 2H4XA 1L8OA 3SC2B 2ZUCA 5JSYA 2V7PA 4F9GA 4B3XA 3EBLA 3U7QA 2C5AA 3CE6A 3EWIA 4NU8X 3ZKWB 3CVVA 1QDUA 3SQLA 1K92A 4GOOD 5FX2A 1BGVA 3RS3A 2C1ZA 2QUJA 3GDGA 2NU6B 1OC4A 2HL6A 1MPXA 3IRUA 2W42A 4GBGA 3MINB 5EPUA 4M3NA 1ISSA 3WNDA 1PQUA 2NSDA 4KODA 2QTVA 1TJNA 2JARA 2O9JA 1ISMA 4H27A 1N6IA 1Z8NA 4DRZA 3ROEA 5BSXA 1JLKA 3L7BA 4FFVA 2L17A 1P4MA 5HM6A 4D8UA 4TV8A 2PNFA 3VNUA 1XE1A 4DA7A 3WLOA 2IX3A 1YFKA 1H2HA 4D0SA 4RPIA 4UVDA 1W8IA 1T5HX 2AQHA 2IU4A 3KFXA 5ADUS 5JWOA 4ZRDA 4EQZA 3ICOA 3FETA 1M6EX 3K09A 1NI3A 4FHCA 4X8OA 3V8EA 1QGYA 4FCCA 3S1AA 4BLWA 4A16A 3OTGA 5JS2A 2WUEA 2V6BA 2QRVB 3QK7A 3H2ZA 5LFAA 1S3GA 1I1HA 3NVAA 1IHMA 1WHSB 4Y3UA 2W0SA 3EVAA 3GOHA 3FWKA 1A5SB 2XMBA 3AM4A 3B3GA 3KKEA 4J1QA 2BRUA 5FEMA 5AJWA 3AVYA 3V8RA 5HQTA 4MYTA 1E2FA 2ECKA 3AYXB 3G2HA 3HBNA 4XB1A 1Z2AA 2QGGA 1AKYA 1BXZA 3L02A 3WNZA 1H66A 3S5UA 2QHXA 3NV9A 2BJVA 4JB2A 1M0SA 3H8JA 1VLQA 4GM0A 3GV0A 4B6RA 1G9XA 1XA4A 2YXPX 2IYSA 1LLQA 2FTKE 3DB1A 2A2ZA 2H4YA 4L6AA 2H7CA 5TPZA 5JXHA 3B70A 3DDCA 4E70A 2IHBA 4DYDA 1GRNA 3E2PA 3DE5X 2JFXA 3L1KA 4OQLA 5HBGA 4IVPA 3M4JA 4DIOA 2O8FA 1HWYA 2YHSA 1EVQA 3H2JA 3MF4A 4KZKA 3ZUGA 3MMXA 4MEJA 1J09A 3U19A 1N9KA 1QYWA 1X3LA 3UMJA 5AW9A 1NLMA 2AVDA 2QD4A 4IIYA 4YCNA 4NK4A 4AQYB 1DJLA 1E2QA 1LTHR 3RYHB 5AVQA 4IRMA 1YB5A 4Q12A 5C8YA 3EH1A 1C4XA 3WSWA 1PWEA 4I0WB 3HY3A 1B76A 1O87A 2C8JA 4CU2A 4D5GA 2JFPA 2FGJA 3RWOA 2Z1NA 2IOYA 4ZD6A 2XMRA 3ZD8A 1YTUA 2W71A 4H08A 2O8DB 3INGA 3RV3A 4BX2A 1JEQB 3TQIA 2Y6UA 2RGWA 5CT8A 1XDSA 2O3UA 3NHJA 1XL1A 1JU9A 4XLHA 1VL5A 2GPTA 5FLKA 3SXJA 5I51A 2IYTA 2VRNA 3AB3A 2J5XA 4QL3A 5ITSA 2HSEA 3WP0A 4LHSA 1E9FA 3QKSB 2VJMB 1CRPA 3PKZA 4RVNA 5BN4B 1TQDA 2PX0A 4EJMA 1E2MA 4IQ0A 1GEEA 2I3DA 3IB6A 3V3TA 5HYVA 3ZJUA 1Q7BA 2GPBA 5JANA 3HEMA 3RTGA 2ZBFA 3FTPA 4EHHA 3RARA 1SCUA 2V0GA 2MOKA 1ZINA 3G0CA 4NBTA 2B8TA 1HDCA 5CNJA 1LEHA 5IWAB 5DHSA 4YT2A 3HKDA 4E5DA 4CFZA 1PFUA 1H1LB 1M5TA 2B25A 2QTAA 4FGKA 4JLOA 4M76B 4QECA 1ML4A 2XTAA 1IK6A 5AQEA 4MRRA 4FZ5A 1TEXA 1CR6A 8MHTA 2DM6A 1HDOA 1OXXK 3D0KA 3DDUA 5LDGA 4PAAA 2C61A 3E5MA 3IV7A 3THYB 5FNZA 3D7KA 5FBWB 3PENA 3DBHA 4HLUC 1ZI9A 4IUYA 4CM8B 4NU6A 5CB4A 1W49A 5DNCA 2ANBA 4H16A 4H60A 3NH6A 3DMHA 2Z83A 4G8CA 1EUYA 4XVUA 5CNMA 5A04A 1RFLA 4L28A 3VUFA 4B0OA 2VXCA 5A9TA 3MCTA 3ZVKA 1F0NA 1NRJB 3CGGA 4CMHA 3RREA 2OBFA 4ALNA 1N5OX 2NZXA 2WU1A 3SVZA 1UF9A 3HYLA 3KVRA 3D4IA 3ADOA 1G17A 4E11A 4G8JA 2HHLA 1XDBA 3I32A 1XA3A 1L1FA 4UEKA 5EERA 3LWBA 3PB3A 1FXWF 1WXWA 3ESBA 5DBFA 3ROZA 1N5MA 2AI3A 4DTIA 2W22A 3ANMA 5LDHA 2RE8A 1Q91A 4KCGA 4REQA 3VHRA 2R4QA 4F5YA 2ARKA 4IIXA 2XE7A 2YWCA 5FOXA 5FV4A 4KNYA 2FRDA 1F0KA 4F2PA 3R5SA 5KYGA 3QW2A 1KZHA 3UY4A 1YQQA 4Q4CA 1LWOA 4LDZA 5KNBA 2OTLB 1O9HA 1P17A 1L7VC 3PQ4A 1DC6A 3BD7A 4X3OA 5TQ2A 2EP7A 3SHWA 3TMAA 2B2NA 3PNOA 4NF2A 3WLPA 2OCGA 4NBRA 3UJPA 1V3VA 1JDPA 2X6QA 5DJ5A 3I37X 4RO0A 1E3JA 4JN6B 2VTEA 4R5MA 3TD9A 4ZHQF 1VE5A 5JAMA 2ZQ5A 4QOFA 2NU8A 4BNIA 2RC6A 2AEJA 4G85A 2QYTA 4IR7A 1GDHA 1N92A 4TV8F 3L0ZA 4CZ2A 4M49A 3KUCA 1WCWA 4K9LA 4GZ5A 1P81A 4KU4A 4UCQA 4AY3A 1OD6A 4PR3A 2BTQA 3W5VA 1I3KA 2IQIA 3AXTA 1W1UA 3CRVA 3GJ0A 3H8SA 3R6DA 4TTJA 3ZH2A 1JMYA 3R7NA 1QPZA 3IALA 2P9FA 3P94A 2IPAB 1EB9A 1LNZA 1NGSA 4QBHA 4RJIA 3ZHCA 2AXNA 4HNTA 3C98A 2JNWA 4DPMA 2P9HA 2FEOA 2E3JA 3CNEA 2HMUA 4E09A 2JGLA 1J8FA 2ZP1A 3KQSA 3AF4A 4E7PA 3NKLA 2BM8A 2ORWA 1YFLA 4M1MA 1T0BA 1LZLA 1ZI6A 5TX7A 2FMXA 3UOWA 3QE0A 4P81A 4DLAA 5IAAA 3QF7A 3OX1A 3RVJA 4M88A 3D3WB 1WQ4A 4TWRA 2YWXA 3GNTA 2BL4A 4M53A 5BWBA 3KJIA 5B55A 1UBTS 2Q9UA 2UUPA 1E3MA 4DA9A 2DFNA 4ZQGA 4JFRA 4ETMA 1URPA 1W5FA 3JVUA 1PS9A 3E9EA 4H59A 4FYMA 2HRRA 4JSRA 5IJ0A 4KMOA 4QELA 5I9BA 4AZ0B 1RCUA 5JZMA 3GFVA 2J41A 5EJ8A 6CHYA 3QEOA 4BRUA 1XAJA 2VJNA 4C07A 4WA7A 5B1EA 1NBWB 2E6KA 3PHIA 3QKRB 3R3XA 3JWHA 3QVOA 2WD8A 1NY5A 4M9UA 1Z4JA 2Y4OA 2CNWD 1G2PA 2O7SA 4OU4A 1W59A 3A8JA 1WAMA 4J16A 5HG0A 1RRKA 1KI2A 1BMFD 1JR2A 1YUMA 2FYTA 3AWIA 4BWGA 1JKXA 3VISA 3IKMB 3CCFA 3FMVA 1LLCA 3PFHA 3WFZA 4B8WA 3M3HA 1AGNA 1TIKA 3OZGA 2B61A 3INRA 3RBZA 5EJIA 3VH4A 4DFDA 1CJKC 2V9ZA 3HBFA 5JPDA 1ABBA 1R0RE 4FYIA 4BLSA 4EFKA 1GQSA 1SVMA 2OK8A 4JB0A 2RHOA 1COWD 3NDRA 3QJYA 3KVNA 1A9XB 3IQWA 2JLVA 4CEIA 5H68A 2D3NA 3HKDB 2P79A 2IBTA 4C20A 1QVGB