3ZKAA

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA01
4BBPA 3PSAA 3AESB 1QGUB 4HMPA 1PSZA 2OGWA 4FNAA 5CX1A 2O1EA 4DBLE 3AEQB 4HMOA 4ND8A 2XH8A 1M1NA 4OXRA 5FLYA 2M6KA 3AERA 2XQVA 1N4AA 1M34A 2M6LA 5KHLB 2MINB 3TEFA 5HX7A 4MX8A 5M29A 2AFHB 5BVGA 4FI3F 5BVHA 4LS3A 3GI1A 3BE6A 3TNYA 3BE5A 4TKVB 1N2CB 4WZBB 3CX3A 4G09A 2ETVA 3R5SA 3EIXA 3HXPA 3U7QA 4WZAB 1KAEA 2PHZA 3PSHA 5B58T 5M34A 3AETA 4H59A 5KOJB 2XDQA 1K0FA 2PS3A 5M2QA 2PS9A 4WN9A 4ND8B 2Q8PA 4XPIB 3ZK8A 3TLKA 1MIOB 2WI8A 2OV1A 2XY4A 4WESA 1G21A 3HH8A 1N2CA 3EIWA 2AFIA 4NNPA 4UTOA 3NU1A 3PDIB 3UJPA 1M34B 1ESZA 3MWFA 4MO9A 2PS0A 3R5TA 1FP4B 1MIOA 3AEUB 5AFSA 2R7AA 2AFHA 4H0FA 4XPIA 2YNMD 3ZKAA 4UTPA 1TOAA 2YNMC 3U7QB 3K1AA 5KOJA 4G07A 5CR9A 1KARA 3AEKB 3AETB 2WHYA 1QH8A 4INPA 4WZBA 4WZAA 1PQ4A 5JG7A 3MFQA 4B8YA 1M1YA 4LJSA 4OXQA 2XUZA 3LHSA 3ZTTA 1G20B 1K7SN 2QI9F 4M7OA 4CL2A 3MINA 4WN9B 1G21B 4MDYA 5KOHA 5M3BA 2X4LA 1K2VN 4N01A 3ZK7A 3AEUA 2Q8QA 3G9QA 1QH1A 3LI2A 3AEQA 2R79A 4FKMA 4MLZA 4PAGA 4TKUB 4WNAA 5HDQA 2PRSA 4IRMA 5JJ5A 1H1LA 2XV1A 5CX1B 1QGUA 1FP4A 3MWGA 3AESA 1KAHA 2RG7A 4INOA 5BVHB 1QH8B 3PDIA 4NNOA 1XVLA 3ZK9A 1L5HB 3HJTA 1M1YB 4GICA 4PM4A 5JPDA 2OSVA 4HMQA 3AEKA 5BVGB 3AERB 4OVKA 1M1NB 5GGYA 2MINA 3MD9A 3K1AB 1EFDN 2OV3A 4TKUA 4WNAB 5JOQA 5KOHB 5GGXA 2XDQB 1QH1B 3MINB 4FILA 4HN9A 4TKVA 1N4DA 1G20A 4UDNA 1L5HA 1N2ZA 1H1LB 1K75A 4WESB 5I4KA 4UDOA 4K3VA 2AFIB
chains in the Genus database with same CATH superfamily
1AF4A 3UKOA 1DEXA 1JEJA 3NLLA 2I65A 2XCSB 1RLJA 3CLSD 2W58A 3UMGA 2ZYGA 2O0KA 3G0IA 5BSKA 5KDOA 2R8YA 2IU0A 2HYDA 2FCRA 2A84A 5JYBA 3AERA 2ACWA 2XBMA 3FBTA 3IEKA 3NT4A 3OF5A 4FMPA 3NFYA 4AT1A 2C83A 4JCCA 3WGIA 2FU5C 1RMQA 2JAUA 2VDOB 4HL6A 3FPJA 4ZU1X 4C5BA 1RHJA 2C8VA 3WKEA 3WWCA 1XN4A 3K0BA 5E7IA 4ZV7A 4ETWA 5I9NA 2H4WA 2NTJA 4J0DA 2WJWA 1DO0A 1JSZA 3KJEA 4OQEA 4OK5A 3BRSA 4K46A 1XZAA 4WQMA 1F0NA 1KAEA 3GYGA 3AJAA 3PSHA 2QVGA 2F8LA 4UVHA 2RHWA 2XHEA 1CLEA 4P3YA 5FI5A 2WJJA 1ZZEA 2FX3A 2WSBA 4FSDA 4JLWA 3VR2D 1QK3A 5HTOA 3SJCA 1P29A 3B1KA 3IIEA 3LGSA 1AKEA 3HVIA 3BTOA 1FFEA 1HE2A 5C3MA 2W6OA 1HRDA 2VWPA 2PZEA 2Z43A 2DUUA 2PWAA 1DG3A 4O1MA 1WMEA 5FPHA 3MJVA 5ARBA 5KNBA 4A15A 3T3NA 1QP7A 5EN4A 4ZWNA 1QO0A 3AHIA 2CLEB 1JSXA 3BD9A 1NXTA 1ADGA 1NOKA 1Z5PA 3ESAA 4Q7KA 3L8YA 2FRDC 2DLDA 4ACAA 4EW6A 1FPMA 4KQ2A 3AQIA 2QBYA 3EC7A 2YCLA 3HVUA 3CPJB 2W93A 3DHWC 3MLAA 1IRIA 4WA7A 5B6JA 3VKHA 4DMRA 2CE2X 1FTNA 3IELA 1NQVA 3ESYA 4J03A 3VYVA 3QFFA 3ZV3A 4E07A 2WTNA 4UXIA 4BJ1A 1UBLS 2EJBA 2VP5A 3QIVA 4WLNA 4BB9A 3B1WA 2NYRA 4W99A 1WUJS 3R3SA 1N9KA 2XCRB 4MRMB 1IHUA 4UHFA 4WASA 4D4HA 1XTTA 2WVJA 1GL9B 1ZD9A 1DBSA 2K2WA 2DJIA 5G3YA 4LMAA 5PNTA 2DPLA 3MGKA 1X7XA 1ISJA 4FKMA 1Y6FA 5AKKA 2Q3JA 3QZUA 2AZ4A 4HWSA 2NQ2C 1N0WA 4IDAA 3LT0A 3DTTA 3R09A 5JFOA 5LLTA 3BMOB 4DIKA 3JWEA 2ENWA 3PDIA 3M9WA 3TX6A 5BSMA 4NQRA 2P5UA 4KGDA 2JK1A 4IM7A 4TZTA 3JVIA 5JXWA 1FLNA 1VKHA 3UIEA 1GT91 4ARCA 2XAUA 1O96B 4CF5A 4J1TA 4OJTA 1A8HA 1SH7A 4HRAA 3D6NB 2ZBQA 3G2JA 4NBKA 3IUPA 4RJLA 4Z4CA 4BEVA 1IVNA 1Y3HA 5A7FA 5EC8A 2WSSA 3NJRA 5ITWA 4EG7A 5DGXA 1TM7E 1H2AS 5KQPA 3SHVA 3GT4A 3MT0A 1T6YA 2Z5FA 4Q82A 1PFQA 2OZPA 3HJBA 2OORA 2PGNA 2X0NA 4WOJA 4YACA 3SMQA 3UOWA 2AUTA 2PT5A 3G9UA 2QP3A 3MCAA 4J0JA 4P93A 4R1TA 1DRKA 3LW8A 3BN3A 1MJ5A 4JXZA 2P35A 3GLQA 3PUYA 1N7IA 1WB6A 1DS6A 5M5BA 3OICA 2IHZA 2XMGA 4MZDA 2NO6A 1XJQA 1HDGO 3VC1A 3PNBA 3OPQA 2GN2A 1B0PA 3AP2A 1WX1A 2IOFA 1ZMRA 1R8SA 4Q3NA 2H85A 1VOTA 1L1RA 4M0DA 4YASA 1KTVA 4BNJA 5AOCA 5IN5A 1MKYA 2KYRA 4LK3A 1ZK4A 2OCXA 2VJDA 4UTXA 4YT5A 1EU1A 3H1FA 4MULA 2VYFA 1INLA 3OLXA 1XTUA 4GYWA 1L5WA 1J0AA 1T5BA 5JS6A 2ETVA 4LQ4A 2PH5A 3AW8A 4B87A 1L3CA 1U0LA 4XVQA 3OPVA 4OX9Y 3R7AA 5J2TB 4A8JA 1JHUA 1P0QA 5A7GA 2FEOA 2GILA 5CXQA 3ADCA 3DTVB 5JZSA 4LOJA 2H52A 2D2EA 4LXIA 3A0RB 3DHYA 3HMQA 3IMEA 1FOEB 4ALJA 4DNXA 1NF9A 2Z2ZA 4E3WA 1HQDA 3M34A 2WU4A 4DJAA 1ZD3A 1P2GA 2FSVA 2GRUA 3OQVA 5BRJA 3L0ZA 3IAAA 1H85A 5TE9A 1B76A 1W29A 4KYIB 4U5QA 1NMQA 5IBPA 3NEPX 5J2UA 1GGMA 5FORA 1YH3A 1CV2A 2UKDA 3I04M 4L8FA 5F1KA 5IUNC 2YWJA 1ZGCA 2Y05A 4TSRA 1WW8A 1Q17A 2CEAA 2H5IA 3L8EA 4L6IA 3H2GA 4NPAA 3D2LA 3ZHCA 1DIAA 4KDFA 2JJ8A 5CA1A 4XUCA 1FA9A 3B3QA 4GLJA 1X1TA 5DGTA 2ZXEA 1CJMA 1CS0B 3E1SA 1CJKC 1RKVA 4BBJA 1G8FA 2N1BA 3LGAA 3PT5A 4IKEA 4K6MA 4LYGA 4N8DA 4ZOCA 4ZDKA 1KR5A 2GVNA 2RCYA 4LECA 2VAVA 4WY5A 1RI2A 1ZOSA 2I8AA 3WRWA 3I01M 5BMOA 4WK2B 2X0RA 2B7CA 1Y5MA 2H48A 2NU7B 3P32A 5GQSA 1F0KA 3MJ4A 2YINC 4J7UA 3VKUA 2J3HA 4JS0A 4K8OA 3PJRA 2Z2XA 5CT8A 1NNI1 2JANA 1EWVA 1GTVA 2IXBA 3UJCA 1AE1A 4N6OA 4HQOA 4HNAB 4PX5A 4ZVSA 3GA0A 4KLAA 3WNCA 4IDNA 4FFOA 2HJ9A 1ZM4A 1YHZA 4M3NA 2RBGA 4I66A 3HTXA 1H8EA 3UENA 4BGEA 4J6FA 2D5CA 2Z8ZA 5BT9A 2D2VA 1XZIA 3TEJA 3ZNNA 3B48A 1GPDG 3ZZNA 5AW4A 3QPDA 1QU3A 1S8AA 3CH6A 1W4CA 3EWAA 5T67A 3NAQA 1LSOA 3QWHA 5ARDA 4BKQA 1DQYA 4AMYA 2DFNA 2CJWB 4RDIA 4PN7A 3TPCA 4FSXA 2A9KA 3GFSA 2X3FA 2QW8A 4N0DA 3ITNA 2PYDA 3M6VA 3R7LA 1WP9A 5BVGB 4YRMA 3CRZA 4XGQA 1RBMA 3H8VA 5AO9A 3VJRA 1DC6A 2Z2KA 1V3VA 4KDRA 5BR4A 2HWWA 2ZCVA 4HPWA 4D5GA 2IYQA 2HJRA 3BFXA 3LDFA 1PIWA 2DHRA 2HJWA 3L07A 3A6FA 1VBMA 4IHKA 3SX2A 1RPAA 1GPKA 3GDGA 2VYVA 1W5EA 5LMCA 5AVTA 2W6NA 1OXVA 2VP6A 4JBGA 4ZARA 3UHJA 4BDTA 1FTGA 2VPWA 5BWCA 1YDHA 4YJ3F 1PK7A 3UMVA 2FDCA 5AUQA 3AFMA 4GM1A 2GFHA 1JZQA 5ALWA 2E5LB 3KVYA 3Q8WA 1JZSA 2ZTSA 3MT9A 4FK8A 2J0UA 4U39A 4KR9A 4X64B 4OGKA 4Z8YA 4BUJA 1XG5A 2NQTA 3DYVA 5CUQA 1DUVG 3N8IA 5CX4A 2EFCB 2CHEA 5EIBD 2X3UA 3CXUA 1UDXA 4G1EB 4DUGA 4Y7CA 3M5WA 2KMLA 1OBVA 2VHTA 4LYFA 3U31A 5A4AA 2IY9A 5FTKA 1SUIA 4HWPA 3CZ4A 2XUJA 2ZWMA 4GUAA 4P36A 4PLZA 4R40A 2VWGA 2P69A 3RU2A 3V4LA 3ZGLA 4CIXA 1BX1A 3NEYA 1NE2A 1QLWA 3K31A 4I3GA 4YQEA 4G3XA 3FVVA 4ITVA 3DDSA 3X3HA 4Q18A 3SHOA 1FMFA 2EJTA 1QF6A 4ND8B 4PWZA 2O8BA 4JQOA 3G02A 4A1FA 1XD9A 2Z6VA 5BN3A 1DIHA 2G6BA 4O4HB 2AJCA 3OOEA 1LS1A 1X0XA 3OMWA 2GA8A 1QTRA 2BCEA 3ND7A 2ACEA 4JROA 5DLPA 2OB2A 3C6ZA 1HE8B 1ESZA 3BXGA 3U3ZA 3GCGA 4WVFA 3UKDA 2HC9A 4N6NA 5A9TA 5JJBA 1JIVA 4PSDA 3O7WA 4EEZA 1KZ4A 2F4NA 2TS1A 3D4OA 1JNYA 4CM6A 1GV0A 2JFWA 4NMXB 3C3XA 4HDCA 4Z5XA 4KW7A 4TTTS 2F2TA 2H1OA 1K97A 2HA5A 1E5LA 3Q3EA 5HEKA 2XQKA 4W5JA 1EE9A 3A4IA 3JSAA 4S1WA 1EH5A 4UAVA 1WWKA 4DSOA 2OFFA 5BN1A 1OWLA 5THQA 1Z7EA 4I50F 1XPJA 3A1EA 3MJCA 1X1DA 3NHZA 4RPCA 3AFHA 4S1PA 3WGOA 4CVNA 1SELA 4J9VA 3NNNA 1JLLB 2CLSA 4FCCA 4B71A 3JWGA 4KQEA 1VMIA 1OHHD 5AM2A 5LQCA 2VZEA 4DV2B 4HWOA 4ASUA 5JDIC 5AW0A 2CHVA 2E0IA 4Z9AA 3GVHA 1EWRA 1HQKA 4HXGA 1LRKA 1WDMA 3FMOB 4W8HA 4DZZA 5BXQC 1S96A 3FCYA 2WFMA 1ZJ6A 1NQXA 2ZI6A 4URHA 3SYRA 2VS1A 2QZZA 3ZHTA 4ZQBA 2PSEA 3K16A 3D31A 2CFCA 2PLRA 3AESA 4FJ1A 2O7NA 1W4AA 3L7JA 1PVOA 1G6KA 1STOA 1Y8ZA 2GJAA 3PRHA 4IIUA 1WHTA 3P4YA 3HY4A 4O25A 1K89A 1C7ZA 4M0KA 4MV4A 3TOVA 4Z9XA 3SIPA 1GUAA 3LBFA 3LT2A 1US8A 1C9JA 1MEJA 1RM5A 1XZQA 2PKQO 2MYPA 3NBQA 4NDZA 4WIAA 4LF9B 3CSUA 3BGIA 4KBFA 4IXWA 4WVLA 4PG8A 3JY6A 2VVTA 1P5RA 3H19A 3LPNA 5FJIA 1UZMA 1JIJA 1EG7A 5DJ5A 4CEIA 3UJHA 4TKVA 4A92A 5B1SA 1A27A 3C6BA 2I1QA 5EGSA 3VH4A 3PE4A 3TDNA 2CF6A 1B42A 1GTMA 2ISQA 2Q99A 4JP5A 3X1MA 5NLLA 5C51B 1FFXA 3UY4A 3A6JA 3T5MA 4QBFA 4KKVA 2AN9A 2ZDQA 4P98A 2A78A 3B3GA 3ZR4B 4QDZA 4UBKA 1VKRA 2RGCA 4UHKA 3SDSA 1SNYA 1TMGE 1YS7A 2JASA 2I2XB 2W83A 5JCOC 3A9WA 1GSOA 1UBFA 1C9DB 2FLKA 4CIDA 5IAGA 2FF7A 4DUGD 1SO8A 3OY7A 1V41E 4BNGA 3I6ZA 4GOXA 1EAYA 2QZSA 5ANRB 4BX0A 1WUHS 1L5RA 5EHXA 1Z39A 3ZJYA 3N5CA 2GMWA 2PQ2A 2WUGA 3QPCA 4FQ7A 4QVGA 4TTQA 3VVMA 1ABEA 1MRZA 1Y4ZA 3DT6A 3HMKA 2B4RO 1AA6A 1ZONA 3AHCA 1FBTA 1Z88A 1KERA 2QN8A 3IDQA 4GYYA 5GONB 3SZMA 4CQLA 1L8OA 1EK0A 2VRCA 4M2LA 1OT5A 1TJ3A 1JG1A 2G67A 3ANNA 4NJOA 5TQ0B 2Y1LA 4B2LA 4EZIA 3D7SA 4KXYA 4D9CA 2AOTA 4EKNB 5FTNA 3A1TA 1E96A 2L82A 2HA7A 4FHEA 4YUZA 1UPBA 1DAOA 3ZGYA 3ZU3A 2DUNA 1NN3A 2XNDA 4GNRA 2HA0A 4A82A 5CT4A 4DIOA 2HSZA 5E1BA 2QENA 1EM6A 3MLEA 3OKFA 3KUXA 4N7MA 5IHXA 1NW7A 3GT7A 4ZFNA 1CQZA 2OCKA 1XCOA 2BR4A 1RM4A 4RVUA 4BNDA 2FMTA 3TRJA 4TTPA 2D2IA 2Z4SA 3A2MA 4U1RA 5CHEA 1D5CA 4K1LA 4B6QA 5BWBA 3QXCA 2EX4A 5FI0B 3PS9A 3SZUA 4F4FA 3E7DA 2QGFA 4H31A 1YRLA 1GYRA 2QAIA 3PEEA 5JD5A 1HDRA 4QUGA 5FA6A 4DE5A 3EFOA 4QFBA 4DIBA 1KU6A 1C3OB 2P6UA 5CPBA 2FI1A 3FRHA 4AUEA 5I7OA 1XA0A 3EVCA 1TO2E 2C2MA 3E9ZA 3H4IA 4W9NC 2C7BA 2VEOA 2DTDA 2BFNA 2BR5A 2AMVA 4BAZA 4EYGA 2J6IA 3ELUA 4B8YA 2NZ8A 4TS9A 3Q5DA 3SBOA 2BZSA 1KZYC 2GCOA 4QC2A 2OVFA 1LSSA 2ISCA 2V74B 5E4JA 4CFZA 5DWVA 7MDHA 1K7SN 1O6GA 4IDGA 5EIWA 2ODWA 1Q0LA 2C7QA 3FVWA 1YNOA 4OX9B 5EIOA 2Y76A 1Z6ZA 3ZU4A 4BUZA 2GCPA 2G09A 5IFKA 4D8VA 2CDAA 2AQIA 4FBLA 1Y7IA 2QX4A 4DM4A 1ZU5A 2C9CA 2DX7A 1ZVJA 5SZJA 5YASA 5ADVA 1M8GA 4F9GA 1XK6A 1ZEJA 3EIEA 1RPZA 2PNJA 1SBNE 4A4DA 4MV3A 5FOTA 2VSQA 5G4LA 1ESEA 5ABPA 1ZXLA 2FSUA 3LCRA 4FJ2A 1VBFA 3KKOA 1TAQA 5TGTA 3UWOA 4Q9IA 1AK9A 1OJLA 1U65A 4ROSA 1GNSA 3VU0A 2G5TA 1J8FA 4US1R 5JISA 2JLSA 4F6LA 3I32A 1IXZA 4JU8A 1QORA 2GHQA 4EW1A 3T3DA 3LG2A 1OQAA 4I6JA 4KH1A 4QNNA 1P7YA 2AL7A 1ICEA 3AFNA 3LUFA 1HR0B 3UXHA 1ZGBA 1H2XA 4O1IA 1RAGA 1TC1A 1WMBA 2C2KA 1EA5A 2ZBGA 3GGOA 2OVBA 4QASA 1E1DA 1D8AA 1HFWA 2QI9C 1X7DA 3F2VA 3MMNA 3VJMA 2XE8A 4KR3A 5JBNA 4PQRA 1W96A 2ZT7A 2ZT5A 1S9HA 1KYTA 2H1SA 3HG7A 2XA1A 1IM8A 1YAHA 4XSHA 3TR6A 1XOIA 1V8FA 3RDPA 4ZT6A 1GNPA 1JHXA 3ZDZB 3PLAE 3WLAA 4AZ0B 2WJIA 3Q9SA 2UZ1B 4FDLA 2C2GA 4ONEA 5C9ZA 1T9AA 1FRFS 1EM8B 3OZGA 4FFWA 4KQIA 5KYYA 1PZMA 1XWIA 2GKOA 3O8QA 3FM9A 3O4GA 3U4DA 3VKWA 4GL4A 1AZLA 3ZJ4A 3MNFA 5FR1A 4F2HA 5LP6B 1JWAB 4JYZA 1P0PA 3DO5A 3WOVA 2FLWA 1XI2A 3KEQA 4Y9UA 3LVRE 4OBBA 3IHWA 2ECOA 3QFSA 3RK1A 4FC6A 3QUQA 1WBDA 1QTQA 5A4IS 2Q50A 2WAOA 2WHXA 5K0EA 4B76A 4XIFA 3M1IA 2EQBA 5KTMA 2G70A 3CINA 3L7CA 4KNWA 2IC5A 2TECE 4HDOB 1AV6A 4XDGA 5TQ2A 4DNOA 2V97A 1OFIA 5E3IA 3B7PA 4AMUA 4QJ3A 4DV0B 4OL0A 3T1NA 2H08A 5HFAA 2HO4A 1SGWA 3L84A 3H65A 4EEXA 4ZYZA 3I53A 1QOPB 3CR3C 2A59A 3NP7A 1F1BA 1N2EA 3F49S 1BMDA 4JLUA 4E88A 5KTOA 3DP7A 1F2UB 4LHZA 3DOEA 3QU5A 3EVAA 5KNCD 1O87A 3GG2A 5J9FA 5I3ZA 3VZRA 2V03A 4YQYA 2R7AA 2CLOB 3LDAA 1CG6A 3ORRA 3T9EA 2CMDA 2LV8A 5IDQA 3MOGA 3UW1A 1SCKA 2EHDA 2V7UA 1Q74A 2MWMA 4TMTA 3RTDA 4J29A 3UMMA 4PRKA 4RKRA 4IG4A 4REQB 3SZLA 2PM8A 2WIBA 1Z2PX 4M1ZA 4QEDA 5EEGA 4YXWA 2ZJ1A 4UPVA 2WG2A 1UC5B 4C6RA 2ZRKA 1WXHA 4AJ4A 4RL4A 3IOBA 3VVBA 3FF4A 4ZQIA 1SVIA 4UXHA 3QNMA 1W47A 5EE3A 3F46A 3W78A 3WWDA 4OQFA 5B1HA 3GUZA 2GK7A 2A67A 4MVWA 1ZQ9A 2Q6OA 2QTFA 4P31A 1DFHA 1AURA 3M6MD 5FTWA 2G76A 2O8EA 1RZVA 4CM3A 4QJ5A 1R4AA 1R50A 1ZOLA 5FFFA 4EA7A 4EX6A 1USIA 4YUXA 3NBYC 4WNAA 1CR2A 1JJFA 2QD2A 3I58A 1RPJA 2ZJ0A 2Q3HA 1TKBA 4H7JA 1R15A 5HUJA 2UZ4A 1TUGA 4HLUC 2PUAA 1DAIA 4EY3A 4GLOA 3DZ8A 2A8YA 3HU5A 4GQBA 1G8AA 3WAJA 3AVXA 1LTHR 1SUAA 4G8JA 2X8JB 4OCZA 5DWQA 1ZXXA 3LVBA 5FA8A 2VHZA 5EXTA 2QM8A 5BP7A 4KG7A 1FDIA 4AKIA 3KXKA 4PINA 3QM1A 4HNHA 4OI0A 3N6RA 1X3LA 3HP4A 3QU9A 5IKOA 2RDMA 1JFSA 5HG0A 1MPXA 3QE2A 2EX0A 4K6OA 4MV8A 1ZXBA 4PU0A 1C0LA 1WXXA 3U81A 1F6WA 2BEWA 2HMWA 1L8LA 4KMOA 3RGGA 5L3QB 4OHYA 3AY3A 1T9HA 1IYZA 4HYEA 4LX0A 4B44A 2FPXA 2MSEB 2X9GA 4PZAA 4BNUA 1T43A 3BTUA 3MJEA 4M7RA 3E5NA 5JT1A 1EQAA 1TZKA 1E3TA 2PZLA 5TPZA 4BXOA 4MUYA 3TKLA 1J5XA 1QVVA 1F60A 1GZHB 1IZZA 4X63A 1NQOA 3VNBA 2M6KA 1DADA 3BORA 3GJSA 4DY6A 3IB3A 3QSYA 3JQFC 2JI9A 4B48A 3GJYA 2Q9AA 3E23A 4AXBA 4LZLA 2VZ0A 4LS3A 1Z4LA 1WB4A 2P27A 3NIBA 1WSBA 2M1XA 3C5VA 2R6CA 3DL0A 1OI3A 1UBCA 2W2KB 2W42A 1RLTA 1JRLA 4WZBB 3E84A 3BE8A 4N7BA 4WPGA 3R9IA 2AOXA 3DP9A 3QY9A 3ZDYB 3PX7A 1F3LA 5K1ZA 1I7QB 5LZ4A 1TZ2A 2UUCB 1BE1A 2FA9A 1DGQA 1OI2A 1UKZA 1SCDA 3PFFA 5JAQA 2C7PA 1OZ0A 2XB6A 1QHFA 2CL0X 3MQFA 5CEFA 4DBVO 3CUUA 3VISA 4RTOA 2KM1A 3ET5A 5ALOA 4RACA 4X6XA 2FXVA 4DAOA 4ISBA 2VHWA 2PGIA 3LUDA 3ZHXA 4B4WA 1B14A 1M1UA 4YRPA 4P5DA 3THYB 4PBTA 2JLZA 4D45A 1M34B 1WVIA 2I99A 5FBRB 4DC0A 1Z4MA 2H9IA 2FAXA 3IILA 4PLHA 1HT0A 3IIIA 4RCZA 3JD4A 3MBKA 3DMHA 2Q46A 5TMEA 3EQ2A 1ZMTA 4CL8A 2YNMC 1ZICA 2QQ0A 3PDJA 4IQGA 5KWVA 1HNWB 3IMKA 3N2NA 4E7OA 2XT6A 2Q29A 1LRLA 3MAJA 5ICMA 4O4LB 1X7ZA 1GV1A 2BM1A 5CDTA 3OETA 3ZV7A 3EPLA 4C20A 1ORVA 4LJYA 3TFOA 1UAAA 3HRIA 3OX3A 1RWWA 1TQ8A 2X42A 2F9FA 2MYUA 2LP4Y 1AXRA 4NE7A 2HDNB 3QG1A 3PYLA 4J07A 4CRWB 5IVDA 3RWMB 1W52X 3F5FA 1YFJA 2IS6A 1CY2A 4Q3KA 2NU9B 4GP6A 5AKEA 2QZ9A 4CV0A 4NBRA 3IOYA 3S2ZA 1T26A 3KUUA 1T36B 5CBPB 1GNRA 1JR3D 2PUHA 3K7EA 4HAUA 1T8TA 5JAHA 4IS3A 2WF9A 3CZPA 4MLZA 2XNJA 4IGAA 2G40A 5CAEB 1CVIA 4IRMA 5I48A 3JQ6A 3IIKA 3QLUA 5JMOA 1J4AA 2J9XB 1Z37A 1KF0A 3F71A 4I55F 3CUWA 4JUFA 3RYCB 4JQSA 1JAHA 4KWEA 5AM4A 5IC6A 5T4EA 4CMJA 3UATA 3QPAA 2HRBA 3NIGB 1FZTA 3P0RA 4JD5A 5DCWA 5EZ5A 3NOQA 3ONNA 1KGSA 2DBRA 2J4CA 5NULA 1M2JA 3IJ5A 3USES 3BAFA 4ZEVA 3HDVA 1QIMA 4FEAA 3GLFB 3E53A 3RS0A 4ALKA 1O9GA 4Z4GA 2HF8A 3D6JA 8MHTA 4TKLA 1SCIA 1TL7C 3COVA 3MCZA 3NGMA 3SI7A 3ZXYA 1DQRA 3GAMA 5DM1A 2XUFA 3K1TA 3GFQA 1SUCA 2FRXA 2RHBA 2VQSA 2XNCA 4XGRA 3KSUA 5EP2A 4ZAFA 4ML3A 4BVGA 2DXIA 4F9FA 4OBWA 1T5SA 3TK1A 4BWVA 1WM1A 1B8UA 2H1HA 4YEDA 5ECGC 1GKUB 2BTOA 4YDHB 1P2SA 1YNSA 5EESA 1W35A 5A5FA 3MSXA 3LBNA 1I7LA 4K7JA 3S5UA 3OF3A 1CCWA 2E7ZA 5PGMA 5WRFA 1DEKA 1LBSA 4G97A 4JI0B 3ME5A 4UFOA 1YS6A 1YR6A 2PG3A 2HREA 3ONWA 3O31A 4HQ6A 3GAFA 4K9KA 1NJGA 4CNQA 2D8AA 1J1UA 1RKQA 3ACCA 1XAHA 1PLJA 1YMUA 3KYDB 3ND8A 5SYNA 3UMSA 1DWUA 2VOEA 2GH1A 1MH1A 2E1PA 1W73A 1QCYA 3PT9A 1C8KA 1NJ5A 1FNDA 2AN1A 2VATA 3JRWA 5G4KA 5BNZA 3KQUA 1DELA 1P2TA 5C31A 2PBLA 3LFHA 5G2OA 3Q15C 4LKRA 2ZS7A 2NAPA 3D2BA 4BNYA 1LC0A 1QYVA 2NTYC 2HGZA 2ZUDA 3LPAA 2FUG6 5IMSA 3U1BA 1OB2A 2O7QA 2CL7X 3VR6D 2Q8PA 5F64A 1U6KA 3ZK8A 3W9UA 4CL0A 4EFKA 2XVYA 4EHLA 3S44A 2H4ZA 4RD0A 4WESA 2ID8A 1DKNA 2EV9A 5KVCA 1FNCA 3TOSA 2IXDA 2JFGA 2O8DA 1SOVA 4R1OA 5AKJA 4I4NA 1EWYA 5KJ6A 1FJXA 5TQ2B 1A9ZA 2A5YB 4DGQA 5IDXA 1H42A 4IIHA 4IVQA 4PC7A 2H7CA 5B7QA 1Q91A 3B82A 3P2KA 1Q7EA 1SRRA 2GBPA 1KJWA 3DMGA 4AO6A 3LKVA 4D42A 2HPHA 4G01B 4QPPA 4QDTA 4U2FA 1L7XA 4Z1MD 1JU9A 2II6A 1VPDA 3RBZA 5C2JB 1Z0DA 5IC5A 2XW6A 1JEEA 4PG4A 4DADA 3RUFA 2YBDA 3A04A 4PZEA 4Q9DA 1HUQA 2O5RA 4O63O 3D8NA 4WT7A 4BRWA 2WF5A 3H2IA 4ENTA 3BVPA 3T41A 3SVTA 2QAGA 4QKQA 1IBKB 2I4TA 4KUEA 4XCXA 4EAAA 3NNDA 4WCFA 3CBGA 3GEBA 3FPSA 5JCOA 3ESCA 3TRFA 1CXZA 4MZXA 1RCFA 1KO1A 2DHEA 4Z9YA 3WSWA 2BEUB 2YXEA 4KQGA 1YVEI 5CFZA 2WTMA 4HS9A 2BFCB 4ZO8A 2PR7A 1V8OA 4ZRNA 4UTRA 1XRSB 4NH0A 4L4RA 1OOEA 4MUEA 5AJYA 1XZHA 2NIPA 3BWXA 3B1ZA 5AK5A 3ZE0B 4CDNA 5CIWA 1PVVA 3K9CA 4UKDA 1NRIA 1F8FA 2B2XA 3P5SA 4HD8A 5BOVA 3ZNOA 3MELA 1N8TA 1G9TA 3E5HA 4JC8A 2QP9X 2R66A 3O4HA 4PYLA 3UMFA 3WTCA 4EVQA 1TU3A 5HW0A 3Q3HA 4PTLA 4X8MA 4ZVTA 4C6TA 4QPNA 5KMGA 3AF3A 3IAS1 4I5FA 2XGSA 3S68A 4LXGA 4JT8A 1ZRNA 4BO2A 2NUBA 2Q5OA 1WZEA 1AKMA 5CT6A 1DXYA 3TRHA 4Q6BA 2D13A 2C4VA 1K68A 3FLEA 4HAXA 2DHCA 4RZ3A 5IM4A 4O59O 4G67A 1W49A 1C30A 2B8JA 3PSAA 3RK4A 1NJ2A 1PT6A 1XA4A 4B4DA 3IDOA 1QWSA 2O8FB 3GVCA 4X1IB 1T9KA 1O97C 3BK2A 3G5LA 1LI7A 1P4GA 3DEJA 3TWOA 4MW1A 4EK9A 1OBFO 1DNPA 1ZL0A 3TG2A 3VPFA 1JHQA 4YCSA 2DFTA 1VMAA 2PZKA 4IJVA 4FDMA 1KORA 1BXRA 3QLJA 2ZBFA 3EGEA 5FUYA 2ET6A 3D43A 4C0WA 3EEOA 3BHIA 3RROA 3BMOA 3KJFA 4CKBB 3F1LA 1GAJA 2OESA 3EMBA 4G36A 4AG6A 1VLJA 3I92A 1VJ0A 1WAMA 3A2NA 2BP7B 3HUDA 4G8BA 2GAJA 3I39X 3PZRA 1MB3A 2I5PO 3N0VA 4EL5A 5ITVA 1GQSA 4POAA 1R0XA 4E2ZA 4L4SA 5U1PA 1MFPA 1EQ2A 1FPQA 2NU8B 2QGZA 1SUBA 3UFXB 1SCNE 3FDFA 4U2EA 2HV9A 3LFTA 1P17A 1T3TA 3L5KA 1XPRA 1FSFA 3AM5A 4NSNA 3GZNB 4XGIA 1JFFA 3SYMA 3UM9A 5F3WB 3CKKA 1OYWA 4IJWA 1OAOC 2HQSA 2QRPA 4AF8A 3MUFA 3D8RA 1L4LA 3V9AA 2Z58A 1FJ2A 1E7YA 3H6HA 4IHJF 1H05A 3CWZA 2YWDA 1UPXA 1KPIA 5BQXA 1VMDA 3GD7A 5KIAA 2XZLA 2ENUA 4A10A 2GS9A 4B3XA 3F6CA 3PF8A 5EXXA 1DBRA 4H7KA 5TNXA 5KBYA 4J1SA 5IANA 3O73A 1F9AA 2CLMB 2QD3A 4HEA6 4JL6A 2WFLB 3QELB 4XJVA 1GGNA 1G8PA 1M5TA 1SUEA 3TTSA 1F7UA 2GKGA 3MLBA 3AL3A 2LE0A 4U0JA 4A0RA 3O95A 5D84A 1RI4A 1P9LA 1HDZA 1KMNA 4OGLA 2JIQA 3U3XA 5CT5A 4RZHA 1K7YA 4U02A 3FMVA 4G9BA 1IXYA 1QFJA 4XGKA 1SUWA 4YO8A 1M2EA 1Y8RA 4ZVQA 2H92A 4X6YA 2GEVA 1B43A 1MJHA 1S8NA 1NASA 2OMKA 3JQAA 4HLQB 3RLIA 3RRNA 4LJ6A 2BL4A 2F43B 4X7RA 3MYYA 1JHZA 3V80A 3GHHA 4Z7OB 2R2GA 3DTVA 1TZMA 2WUDA 3C85A 2B1IA 2V6FA 1Q84A 4J3FA 4RMGA 4TTJA 2C8JA 4C07A 4AY3A 3ZDCA 1UBOS 3LC2O 3DYIA 3QEMB 3RB8A 1G60A 2GNOA 4MI1A 4PNZA 4QXOA 3EQ8A 2ANCA 5EE5B 2OEPA 4JENA 4A6EA 3EJ6A 3GNQA 4NNOA 4F8EA 1F17A 2C29D 1M1YB 3P2OA 5D51S 4OK3A 3B38A 2IOFK 1YRBA 1RWMA 3CPEA 1C1YA 3KEFA 1KGDA 1N6LA 1XJ5A 3AHJA 4FKBA 5GM1A 1K5PA 4MI9A 1FIUA 3C6XA 1H65A 3H99A 2AK3A 4L27A 4OPMA 5EWMB 2H2DA 1QU2A 3D4BA 4E09A 1NVUQ 4J6EA 1JG7A 4H7DA 3A10A 5JBQA 1ZN2A 4OB8A 3KCQA 1LSUA 5CCDA 2QTBA 3PQ7A 1AKYA 3ZE1B 4BFCA 4GZ5A 3K8OE 3PVSA 1L5HA 3SE0A 2I2BA 1JHVA 3ZIDA 3QLUC 2X9NA 1W0CA 4DLAA 2XYPA 1IUOA 3OHSX 3NV7A 4LZPA 4BP8A 2I6SA 3OOSA 3AK4A 3IULA 1ATZA 4TSFD 3VU9A 4Z7JA 1LDBA 2J09A 3L1KA 1SEPA 2OFPA 1GZUA 3SC3A 5KVSA 5A6SB 3MB8A 4KQJA 1Z25A 2FP4A 4Y1GA 2Y92A 5C53B 1NUAA 4KZKA 5BNTA 4KHZA 3FWPA 3FPLA 1CNFA 4NMHA 4RSMA 1VJGA 1FNSA 1U28C 2VJNA 2WG0A 3OTGA 4R8VA 3OM0A 3PHBE 4B31A 3B3FA 4DWJA 2XNKA 1Q2XA 1E2FA 1QB8A 1ADJA 1N2CB 4D56A 3O2NA 1UINA 3A32A 5F33A 3OCWA 3TZBA 3PNKA 1NVMB 2OV4A 1QC5B 2V3WA 3I4LA 3U4AA 1OZHA 2EF0A 1X13A 3P45A 4UOZA 5LL6P 4L8VA 1NNEA 4QYIA 2Q2OA 4LBYA 4QUIA 3TNLA 2AG8A 1AKNA 3WWOA 2QF7A 2BH9A 4MJLA 5CLHA 1CUZA 5LPNA 3AJ9A 2X5JO 3CEMA 3PWKA 1XZMA 1L5YA 3U6BA 1RHQA 1LC3A 4JLAA 1XP8A 2B6HA 2BBOA 2H2AA 4RTLA 2X8AA 4JGGA 1JF8A 3ANXA 3GQVA 4HH4A 4JI5B 2IV7A 3EULA 3NXSA 2YXBA 3M4NA 5CA0B 1FFYA 1P1CA 3NHMA 3H2JA 1FNNA 4P4GA 2P9EA 2F1KA 5BW4A 3Q8XB 4IFEA 1P2BA 4K0RA 4FGUA 4GXNA 3RRBA 2HSWA 2ID9A 1MO2A 1O9HA 1QONA 2AFHA 2H4XA 2RHCA 3H4MA 2FOXA 4H0FA 4JJ7A 4Q1EA 4QTZA 3E2IA 4TM8A 5G4KB 5H3LA 1MT3A 2IUTA 4E5SA 5BMVA 1K3FA 1OAOA 1ZRMA 2P4SA 2RI1A 3N86A 3RJTA 4UDYX 5IKPA 4V0MA 4CU2A 1H9AA 1PQ4A 1Q3HA 2OV2A 2X8JA 4X9XA 3ZOKA 3TNFA 1U2PA 4MCHA 5A3QA 3RG2A 2BFEA 3TLEA 4ZOEA 1OTXA 2C7VA 3LHSA 1E3IA 3DJYA 4R2HA 4ZI7B 2CVFA 4OMFG 4RTSA 4H1WA 4TV8B 1OXTA 3AY0A 2SKDA 1BZYA 1QF9A 4H1VA 4U2BA 5DBHX 3GQBB 1U9IC 1K08A 3UWKA 5I3CA 4OI2A 1JDTA 3LT5A 4LWOA 3CLTC 1SC6A 1A72A 3TECE 3REOA 1PJRA 4IWNA 3WXMA 2WYWA 4BKOA 1ODKA 2AXPA 2K4MA 5I51A 2G9UA 3A4TA 2YIJA 1QMPA 5IVIA 5THXA 3I34X 5DTIA 4O0MA 3RTBA 2GDJA 4XX0A 1L4FA 1GNTA 3K2QA 3V4ZA 4JIGA 4CYMA 1TUEA 5BSVA 1I01A 1CC1S 1DKUA 2ASVA 2OHHA 1X7XB 3VO8A 1Z6XA 2FHSA 2IEGA 4LOIA 1P7WA 4XTRA 2IT1A 3WNDA 1KSHA 3RPEA 3NYRA 5AI0A 1H3FA 5JNVA 2EJCA 2QORA 4QXMA 5A06A 5H8WA 3STHA 3WGLA 1VYVA 2EKZA 2FTKE 3RVJA 3ZGNA 5JSZA 2DSNA 4WJZA 4J4HA 3WGNA 2XTZA 4M99A 1XXLA 4HLDA 5L7TA 3IAFA 4UDOA 4B3TB 3AM3A 2HU2A 2EP5A 4WLVA 3ZV6A 3P94A 4OHBA 1ZJ4A 5CAEA 2VCHA 3AVOA 1YRYE 2H2HA 2J9FB 2GSWA 2QJTA 3H5NA 2X1VA 3IV9A 1EVKA 4GOLD 4IDPA 5EXSA 4AZWA 1D2MA 2ZJ6A 5A71A 1LJLA 2JIZD 3CVXA 3MOIA 1OFHA 3PUJA 2YUTA 3FNRA 3CUSA 2VZ8A 5KCZA 2A3RA 3PC3A 3GLHA 4KFCA 2GARA 3O8BA 1RYMA 1PL7A 3SY8A 3EGCA 3N6XA 1JT9A 1ORTA 2PKEA 4RIHA 3SIRA 3WLLA 4DIMA 1TRHA 3NAGA 4HZGA 3ZKWB 3UK1A 3NS7A 4JKYA 4H18A 3ETJA 1L5NA 4YXFA 3GJ4A 3KQPA 3DWIA 3IT0A 2IA5A 4LZWA 3AF5A 4CUJA 3NKLA 4BVJA 1M54A 1LLCA 1HI9A 2UZIR 2WJ6A 3HCRA 2VZ9A 3M9XA 5DO9A 1U0OC 1UZAA 3H0KA 5FKJA 1NHGA 2VUTA 2JFQA 5F2EA 2IU6A 2CSUA 4PVCA 5EJEA 3THSA 2W2TA 1NJSA 3LCVB 3AUAA 5I4BA 1M2OB 1E1CA 1QCZA 2C8LA 3HZHA 1KOLA 4ZCMA 4C4AA 4PX9A 4NNPA 4RK4A 1UM8A 1AK2A 1JHRA 1V96A 1EJ2A 1Z6GA 3AKCA 3L06A 3OZCA 4IPTA 4MQ6A 2PMKA 4WN3A 3TFWA 2HLDA 3ZIAA 1FUIA 2WTEA 4F84A 2EDAA 5HCUA 3STYA 1H1DA 4KSCA 4V3BA 5FA5A 2O1WA 2C0QA 1NSTA 1O5OA 1NOIA 4NV0A 2H1LA 4AS3A 1RYHA 4MQEB 5EJIA 2AR7A 8AT1A 5HIMA 4RH0A 2IU3A 1TECE 4B74A 3H42B 1NBMD 2BPOA 3F7NA 3OLWA 5BNIA 2PVPA 2C42A 2QW1A 4NEHB 3ZTWA 2FK7A 5GONA 1IXSB 1NLUA 3D6HA 3FB4A 3KLMX 1G4AE 2E85A 3LOPA 3NDJA 3PA8A 1EI9A 3OOYA 3PNYA 4UMDA 2DLNA 3H97A 3GCWA 3HKEB 3JRXA 3AVWA 4Y2GA 3FOWA 3GA7A 1RJ9A 2ZRPA 4IXDA 3H0EA 2HWYA 3ND5A 2IV3A 5CEJA 2QROA 4JNKA 2H5LA 3AKYA 3B89A 4LXQA 3OCCA 5K6AA 4ATNA 1T35A 2HHLA 5IDYA 3R5XA 3OE5A 4CKEB 2Q1WA 3JARA 3RT7A 2EFGA 3X1WA 2F17A 4CT4B 4DQKA 2V5UA 3S2SA 3ZDBA 3ZJ5A 2FUCA 4LQDA 4Z8XA 2ZE5A 3G49A 4DA8A 1U0TA 3RUIA 4NU6A 3ZE9A 2P9QA 3OG9A 3PVZA 4UE3S 1XRRA 1I3OA 1PDOA 1G59A 1NI5A 1KI8A 2I3BA 4GE0A 4NBUA 1VL2A 1SQ0A 2IEDA 1RIFA 5EE1A 2IWHA 3VKVA 4DIUA 4IXTA 2PPVA 4Y1FA 3IEVA 1SXIA 2IFTA 1A5SB 1XMPA 3F1KA 2VDQB 4W63A 2H0QA 1T8RA 4EGFA 1P1BA 5ALLA 3ZJTA 4I3HA 1FXSA 2C20A 1EPUA 2P2ZA 4F97A 2O2YA 2VJMA 1PTJA 3K1YA 3RS7A 1ZX1A 2A0FA 1Y3AA 3NANA 3WGJA 5FL3A 2UUBB 4XCVA 3GT0A 1K92A 4LBZA 4OJNA 4QU8A 5D8DA 1CFZA 1GXSA 1IHXA 1W44A 1XU9A 2GTPA 3KB6A 5AVOA 1WKCA 5B2ZA 3AESB 4GWKA 3CLSC 5H1YA 4JP3A 4UVGA 1N5KA 2OLKA 3H9QA 3KUDA 1K6EA 3OU6A 3HN2A 2YHUA 1BWRA 1VE7A 2IELA 1WA5A 3PD0A 1K06A 3AR5A 3FYHA 3QF7A 5EQJB 4CN8A 4OKSA 1IOWA 4EYEA 3RU7A 1G8JA 4BGVA 4HTFA 2HM7A 1GUFA 5EKTA 4ZYYA 1HT1E 4M0MA 5EP3A 4C1BA 1BNCA 4F46A 3LX4A 4AYXA 2VH1A 3GLIE 4P08A 4KGZA 1VECA 2C9YA 4A16A 4JVOA 2WMOB 4OV6B 4M60A 2P2NA 2WNIA 3GFGA 3I9MA 4X95A 4ZDWA 2PKRA 2GHRA 3T4UA 3E9CA 1X7WA 2JGRA 4MWGA 4DG5A 4P3OA 5FUMA 2FDXA 3QJYA 4IEEA 6GPBA 1XEWY 1E3WB 2SCUA 1NN1A 1HDIA 1K0FA 2Q45A 2XUAA 4RABA 3TFQA 2PDAA 4EY4A 5IHPA 1FP2A 1I2DA 1T1RA 3L02A 4F7DA 1MN6A 1JALA 2ADFA 2IHJA 2AD5A 1U0BB 1K6JA 2C5FA 1T8SA 3H1EA 3IP3A 4Q1VA 4X24A 3VR4D 3QEKA 2A1TR 1R0ZA 4W9RA 3QVMA 3B7WA 4M9ZA 2WZDA 3LWZA 1NE7A 4MITA 3UW3A 2OGSA 1ZBQA 2QT1A 2CN1A 2QOEA 1NF2A 4IO0A 1NYTA 4V2UA 4KPUA 4RADA 3FHCB 3FOAA 5J2TA 4U7HA 2WV7A 3GEMA 4RIFA 4WBNB 1L5FA 3FZYA 1K86A 3NOXA 1XBTA 3K94A 2QM7A 3MAGA 1VRCA 4MWSA 2QMZA 4Z9BA 1FSGA 4ES6A 3IBGA 2EATA 2ZI9A 1GZ5A 1OCEA 4MP8A 3T4EA 4ACBA 3HNRA 5AVSA 4LRYA 1R2QA 1YUNA 3OZTA 3EX7C 1II9A 4BO0A 1K9SA 2ZRAA 3IC5A 2BN4A 3QKUA 4HB3A 4MJ7A 4C6SA 1IHOA 5ICGA 5JNSA 2VCYA 5K3FB 3THXA 2I4MA 2GZHA 2VJYA 4BU0A 1OFTA 5BRNA 3RTEA 4KI0A 1D03A 3BPSA 1L4EA 4JP8A 3VKFA 1ZINA 2X6RA 2R7NA 2JG3A 5B3LA 1OYOA 5U9CA 1VLVA 1UMCA 1S02A 4G26A 3OD1A 4HAVA 4MVJI 4HB2A 3O8CA 1GQFA 3IKJA 1FYDA 3AF1A 5FOUA 1OIWA 4N7RA 1TUBB 2GVDC 1UMBB 3SCZA 2G1JA 4BFXA 2W48A 5DHPA 1NATA 2IUFA 1R0KA 4AICA 3WLIA 1USGA 2CDRA 2EWMA 4Z99A 3QYJA 2I3AA 2B2CA 3PIRA 4E1VA 2Y1XA 4MKRA 4QT0A 4V0OA 3GYBA 1H2HA 3VGJA 4BATA 1WLYA 4RPKA 2VDWB 2O1SA 3G1UA 4KTVE 4XWKA 5CTJA 1HURA 1T2CA 1U9JA 1XMOB 4OLBA 1A2KC 1XXHA 1YQXA 4U6NA 4CUZA 2UXDB 2Q1TA 4YREA 3CONA 4PYRA 1FSSA 2V6GA 3MILA 3IUJA 5JOQA 3SF8A 4AP5A 5BOSA 5HKAA 4AMBA 3DSRA 2AJLI 4D57A 1RC1A 4B1FA 2AG5A 1Z83A 2YASA 4OHZA 1YQQA 2OLJA 4JEIA 4J0HA 3C5HA 2LUOA 2VJLA 1IY8A 3IEIA 5JXJA 1S3FA 2FVXA 4UUOA 5K3DA 2JHPA 5JY6A 1YMQA 5DHUA 4BBPA 1THZA 4G0MA 2HCJB 1CUAA 2BTEA 4DMGA 3E3LA 4HFMA 4LHVA 3WMRA 2F1HA 1R6AA 1T5HX 4CTKA 4BO6A 5C8YF 1HA3A 4RVSA 1HE1C 1ATIA 3S28A 4J2OA 3SHQA 3TQQA 2OAP1 3CXRA 2ID4A 3RVMA 4EPWA 2PV0A 4WCDA 1ZCZA 1YB5A 4F56A 2OZVA 1PR3A 5B4VA 3ZWKA 2JF0A 4J2HA 4U9HS 3ZI7A 3BSFA 2QLNA 1OASA 2CV0A 1YQEA 4IINA 3G0DA 2QQEA 4HGOA 4F4JA 1JDZA 2EFHB 2CV2A 3CH7A 2ATXA 3AFIA 1CDEA 3ETDA 4OO3A 5ER6A 5DKFA 2P9GA 1OXKB 2ZQYA 1RWKA 3IOMA 3L43A 4Q3OA 4UZFA 4XIGS 1XZEA 1P80A 1KOJA 4YUYA 4RV5A 3JTEA 3ND9A 3TB6A 5EJAA 5HIIA 2C7GA 1IU9A 2NTVA 1GGEA 4AD8A 4UW9A 3TLKA 1TCAA 1BTOA 1E2EA 4M1QA 4AL4A 4DB2A 5KVAA 3W8NA 1TK2A 1C1HA 1ESCA 1RW4A 5ALPA 3K15A 1EB8A 3RD5A 2FEAA 1TK3A 1XMSA 1DG1G 3MERA 3MN1A 3QE0A 3RIXA 5LWHA 2QRHA 1T2VA 3M82A 2XZOA 2D62A 2FZGA 4AYTA 3OZAA 3FTEA 2I8LA 2ZI5A 2RSLA 3GJXC 5FADA 4UNQA 5JNWA 3JASB 3A6PC 3F6SA 1IG0A 4AECA 4FLEA 3VSBA 3BGOS 3T9BA 3AF6A 2FMKA 3NRCA 4RV4A 4M87A 2GEFA 1OH8A 2WVHA 2BKVA 1Z6QA 4HDMA 4RH3A 4IVRA 4BN5A 1YQGA 2RHJA 4QHTA 1Q95A 3SHFA 4YRIA 2QRVA 1P2FA 2CLLB 2DCMA 2JI7A 1FFHA 3HB7A 1RKUA 3OTWA 1A98A 4KTTE 4XWTA 4L0DA 4DCCA 3SFVA 2CV1A 5E8JA 4YRJA 5KYUA 2FE1A 5K0BA 3MT7A 3H87A 1P1RA 1SMKA 5JCZA 2HLPA 4R3WA 3HJNA 2XTJA 1B16A 5JJLA 1AGXA 4LMPA 3TINA 1FRQA 4BE9A 1I5RA 2ZSFA 3C5CA 4D96A 5AW3A 1IB6A 1G8SA 4WH0A 1CEXA 3LCJA 1ZMOA 4X90A 1UBJS 2DUWA 2PLFA 3KYCA 3PGXA 2GK4A 4FD3A 5CG2A 1A7KA 2AJDA 2JGJA 4MA4A 1K7XB 5K0SA 2C98A 1T0PA 3PLNA 4JODA 1MAWA 1Z74A 2EFEB 4TMFA 1NZDA 1UM9B 1U99A 2P9HA 1T4GA 3KVVA 1OIXA 2OAEA 3D6MA 1U2TA 1H6AA 2JATA 4H3KB 3BRQA 4GICA 3V32A 2FPOA 4OA8A 4K5QA 4M9SA 4GHWA 1X80A 3REQB 4HDQB 1K8QA 2GFQA 4ZI2A 2HLDD 1PJLA 5F5XA 3PHCA 2FE4A 3QVOA 4B40A 1LPBB 2JLQA 3F78A 4MRVA 1TZJA 3QBVA 5F7JA 1ISFA 5GV8A 3I5YA 3FIUA 1D4OA 4IMIB 4YPOA 4KMSA 3FYUB 2W8BA 3AF2A 4XRRA 4JN6B 1UZNA 3HA2A 3EXHC 5DIFA 5ALIA 2C9MA 1XV5A 4F9EA 1AMNA 2H3HA 2D0PB 3N2GB 1JKMA 3LKZA 3DBIA 3M1YA 4RZQA 1G8MA 3OQMA 1XVIA 1KRHA 4URUR 1GQOA 1XF9A 3WR5A 3PR3A 4PQGA 4B3GA 4YRLA 4WDQA 3G89A 4RV9A 3CRMA 3GY0A 4CG1A 3IQIX 4CMEA 1BSVA 2EZ4A 1L5MA 1BRMA 1VIVA 1YL7A 3EUWA 1BFDA 4OBXA 5AI4A 4CMBA 4D4MA 1XPUA 2A14A 3JQAD 4QQKA 1WMDA 3HADA 4E2XA 2YVUA 4MX8A 4L22A 5CA0A 3I2KA 5KTTA 1QQTA 4HX2A 5DHFA 4IHJA 1QK5A 3U7IA 4P9NA 3CX6A 2H54A 3TNYA 1UEIA 3BWYA 4BN0A 3R4CA 2GAFA 2HDOA 4Z4QA 2ZIEA 4V0RA 3STUA 4M83A 3TSOA 4AS1A 2QRLA 3WGVA 4DQUA 1CJUC 1BVRA 4JWKA 3D0RA 3OESA 4YT4A 2IU4A 3DOJA 4HNQA 5LZ5A 5CFNA 5KNCH 1JIIA 7ABPA 2O3RA 1R8XA 2HA3A 4KIGA 5BWMA 5I7WA 4K81B 1RQ7A 2EFJA 3G88A 3R0QA 2R68A 3OSZA 4BBAA 2E4ZA 5LLDA 3K92A 3GCZA 4ID9A 4Q05A 2DWCA 5DX1A 3F90A 3U7JA 3KPUA 2RD2A 3MTIA 4KIFA 4CHTA 1D2NA 1DUSA 1EXNA 3ZV5A 2ZWAA 4N9QA 1YO6A 5LWQA 5C4GB 5FOWA 3DPIA 1SC3A 2Q8NA 1Z0ZA 2BGLA 4L0QA 1Z7YA 1LBQA 4KR7A 3KCNA 3EG9B 1XMJA 2QMHA 5AJUA 1OA1A 4YJHA 4F4CA 3QEAZ 4NBLA 5FFMA 3IQZA 2AVNA 3PXAA 4GVLA 2YVKA 4OUDA 5DASA 3TPFA 4EJ2A 2NO0A 2YWRA 2H5EA 2ODTX 2YY7A 4GOND 4LFAB 2JI4A 5K3CA 1ZIOA 2UYYA 3WYEA 2LR0A 3T3OA 4MWBA 4BP1A 1KY3A 3FG9A 3HDHA 1MCZA 2P6NA 4LG1A 4CE6A 3AUXA 3FNIA 3LK6A 1WOYA 3GMTA 1ZVMA 1MW9X 2J59A 3DWGA 3GR6A 4JFAA 5BN5A 1POWA 4B34A 1ZZGA 2QI9F 2UYOA 3O9ZA 4EUEA 2HKIA 4PW0A 1E1CB 3Q9NA 3GVXA 3OJOA 2QVCA 4FYXA 2GPJA 3QX3A 4PLPA 1GNLA 1NBME 2HMTA 3ZK7A 2VHQA 5AESA 1DKLA 3AI1A 4NZNA 4LYAA 4CV1A 4KE8A 2IYOA 3I9V1 3E27A 2BE7A 3GL9A 5IZ4A 1L4YA 1IN8A 3CYFA 4MKHA 3WIBA 4N65A 1PV2A 3QWBA 2HF2A 4ERXA 3W2HA 5CLJA 1KFEB 1BXZA 4TT8A 1SKYB 2ZPTX 1J2YA 1QH8B 2P77A 4K2HA 3ZEIA 2B6NA 3KT0A 4OXKA 3S99A 1YZTA 1PT7A 2LCFA 4TLCA 1DSSG 2JZNA 3IP8A 1W4BA 4LAFA 3CZCA 3TSZA 1U8YA 2PSFA 2F1IA 4JA2A 4EKIA 1THMA 2E55A 2P2CA 5FTJA 4F5WA 2PA3A 1BXGB 3C6MA 3FUCA 4YFVA 5AXBA 4R9VA 3T9FA 3MGGA 4EA8A 5G41A 3PXXA 2G3YA 3WGYA 4ESVA 2F4VB 1YZFA 2ZT6A 4JLJA 2CNWA 5C34B 4LDAA 1GT6A 1P75A 4ICIA 2QVXX 1Q92A 1TF2A 2QL9A 5H59A 4EMUA 1PW5A 5SYMA 3N75A 3V4FA 1ZUNA 5HUQA 5K8IA 3ZWYA 1BVHA 1ZM9A 1UBSB 3A3NA 2GXSA 4L02A 4NYMQ 1O08A 4J2TA 3DMDA 4MWDA 3SM3A 5KX5A 4DV4B 2PL3A 4ND8A 1D2AA 3ER6A 3O4RA 5EWMA 5F2OA 4Q39A 2F48A 4L7VA 4B6OA 3T5AA 3ISJA 1GR1A 1TFRA 3IE1A 2Q3MA 3NBUA 1TYCA 3G2MA 1KRXA 1O0CA 3GFBA 1B0UA 2VPPA 5E9WA 2P9JA 3DDNA 5H9VA 4UOEA 1TCVA 1OIVA 2ZYTX 1D3AA 1BD3A 1E2QA 3BA1A 2R1VA 3MWDA 1NXSA 4FR0A 3AZQA 4ZO9A 5LMZA 2PUBA 1V3TA 3UHPA 1Q0UA 3ENQA 3OJWA 4MV6A 5CW1A 3L2OB 4IR7A 1E2BA 1WMFA 2JCBA 1QWOA 3MK31 1PGOA 2GCGA 3N53A 4ZTUB 1J00A 5TT1A 1IN6A 3T9DA 1P5HA 4IRXA 2G7ZA 2I78A 1RRGA 2PS3A 2GKSA 2Q2NA 3L4JA 2HADA 5FBHA 1VIYA 4NEGA 3UGTA 2Q28A 3LQRA 5ALYA 1M2WA 2FN9A 3PFNA 4IXNA 5LDHA 3UJAA 1KAOA 1X8KA 2C8KA 4DG8A 3U61B 1C30B 1W6UA 2V6BA 4QM6A 3O3OB 3IHKA 1XHLA 3KYDA 3K9QO 3D59A 1QNLA 3X44A 4ARVA 4FGSA 1S6YA 4LOAA 4B3DA 2W71A 2O5EA 1L4GA 1HE4A 3IQEA 3CVYA 4ER7A 3NDIA 3KFLA 2ZJ5A 1DOAA 1W76A 4JB0A 1LF0A 1Q0HA 4Y2QA 3PV0A 3CBQA 5AXAA 3F96A 3V2GA 4X44A 1DWOA 3W6ZA 3ZW9A 3WGUA 5FEUA 3BIXA 5G53C 2VHCA 2WIJA 1EGMB 1C41A 2B5VA 4NQZA 1DE0A 4O4JF 5KSPA 4DDHA 1HQYE 3UXYA 1YI8A 1Z4IA 4AROA 1W5SA 4LJSA 4PLYA 1P60A 2D5IA 3ILHA 2HWUA 1TQ4A 1PQWA 1IATA 2DHDA 1JXAA 1IBCA 1IJKA 3ZJVA 1D2RA 5GJBA 4AKSA 2CLFB 2HN9A 2XUDA 2J4DA 2RCNA 2WUWE 3UPUA 4KPEC 1V4BA 2OXRA 2RGXA 1L1QA 1EFTA 1PTJC 2X7XA 3E18A 4L57A 3C1TA 4Q9HA 1THGA 4NBSA 1GPLA 4HYQA 4JBNA 1OLXB 4B7CA 4MH0R 4B7UA 1QUFA 1TEXA 2NU8A 3UFXA 4DWWA 3HCFA 4DA0A 4HX5A 2EW2A 3C8ZA 3CX8A 3PNQA 4I4TF 3VXKA 1VL5A 4RVHA 1PG5A 5F4BA 1IJFA 1RAHA 4RLFA 3X0DA 3U7FB 2M6SA 4IY1A 1GIAA 3L7LA 1V4VA 4XAQA 5CMLA 1JLLA 1I1QB 1L6RA 3EXHA 1CBUA 1KYXA 1A2QA 4LGCA 5AHOA 1LX7A 5JW6A 1JMKC 2J32A 2OKCA 3NBAA 4IV5A 4GSLA 4TL8A 1DC5A 4EW2A 2OXTA 3VHXB 1OW3B 2XGGA 4EENA 2O19A 1GKKA 1V95A 3DTNA 3G82C 2WINI 1YQWA 3KSDO 4RY9A 5DU2A 1TTHA 3QU4A 1CUXA 1W93A 2IEAA 3SSMA 3VZCA 3GUHA 1GAXA 1I2BA 1X7WB 3PNLA 2YRXA 4I9UA 1IIRA 1K7CA 1H66A 4IMPA 3ZCXA 3DZJA 1G4UR 4MNTA 2AF4C 3ORFA 2DVMA 2VUIB 4OY3A 2EBHX 1ECGA 1EHYA 1NI4B 1HEUA 4L85A 4Q16A 4QPJC 4R54A 2GHTA 4XZ3A 4BLQA 1IN7A 2X13A 4M9QA 2FEXA 1XEAA 3HKDA 4Q1DA 1ZC3A 3TG8A 5IKXA 5FPPA 3TH5A 1T6XA 3WP0A 4W8OA 1DKRA 3KL4A 3LP6A 3NAZA 3WBBA 3RBAA 3IPRA 1CZUA 4IOMA 3UICA 5EWLB 2VSYA 2JJ1D 5JVDB 5LFAA 1U7HA 4URVR 5E1OA 2ETXA 1DEOA 4P3NA 4DMHA 1GG5A 2WE7A 3IUNA 1X94A 5FBLB 2XADA 3UMRA 4YO7A 3BH6A 2AX3A 1SG9A 2OZEA 4PSKA 2JAXA 4FZVA 4DDWA 4ESHA 5F1OA 1J2UA 1XRPA 3WA6A 5EMJA 3EEBA 4P4SB 1TMOA 4TMYA 4DY4A 3AKZA 2BLLA 3ED1A 5HKLA 1YGPA 4OHVA 3B78A 3M89A 3SP1A 1E3QA 4MGKR 2CK3A 2YOFA 1JA0A 3BK1A 1QZ3A 4C0JA 4ZKDA 1YVUA 3EIHA 3OBIA 3WLEA 4NS4A 5DSXA 3UAWA 4ZGBA 3TOXA 4Q7JB 1KI2A 3L8CA 1PJBA 5CH8A 4BEWA 1WHSB 3EUFA 4I36A 4QWWA 4W5TA 1XZFA 3EAGA 3UYKA 1LZKA 3ZLJA 3CTMA 2L42A 4IHJB 2QUBA 1EP9A 3ABRB 4Z4FA 2JARA 2XUGA 1A8UA 1U81A 2C5BA 5KINB 1UKBA 5TMPA 4RGQA 4TRJA 2BBWA 5JI2E 2FP4B 1FL9A 2PLWA 2CLDX 4HGRA 4WNIA 5AM0A 4UTPA 2CNOA 2YJ6A 1OFUA 3I37X 2WR8A 3E70C 4I4TB 4EMBA 1DCTA 2W00A 3U26A 2OM6A 3BIOA 1M72A 1XCBA 3FTNA 1QQ7A 3JALB 1EP3B 1JKXA 1M6VB 3C3PA 2GN6A 1RWPA 3WWYA 2KS6A 4FTWA 3U9LA 9ABPA 4EECA 1NQTA 3MXTA 2IX3A 1FZQA 4Y0VA 4I9NA 5LZ7A 4B8ZA 4BV3A 1J07A 2YICA 1RTKA 3PZBA 1Z34A 2NZYA 1L5GB 3SJUA 3CA8A 3UG6A 3LV8A 3FHTA 1Z8FA 3SPXA 4WXHA 2V96A 2VDUE 3H1PA 5K2MA 1UK7A 3KFXA 2GCOB 4WL0A 4UU1A 4MQBA 5U4QA 3ZHUA 1ZCFA 2OQRA 1A9PA 2OSVA 5ED0A 4IGKA 3L0OA 4M98A 4OAOA 3UNXA 1TO6A 2B8WA 1ST2A 3C5WP 5GGYA 1RJ9B 3I28A 4E5NA 3Q2KA 4KQMA 4QGSA 4HJXA 4DV3B 4A2QA 4QYXA 3DGEC 3A0UA 4LMRA 4F12A 5EQDA 2FPMA 1L4KA 3QHPA 1TGVA 3NORA 4OFWA 5JJKA 2GJ8A 3LSYA 1W5AA 5CDFE 3VPHA 5LP1A 1KC1A 1Q3TA 2QD1A 3UG7A 5AK4A 2IS4A 2PY6A 3WKAA 3WIUA 1AC5A 1Z22A 1XZ8A 5J5CA 2I1VB 3KWMA 1NQAO 4Z0HO 3G9TA 2AE1A 3VR0A 4KR6A 1O6FA 4JI6B 1OMOA 2O20A 2GNAA 1EQUA 1V9CA 3ONDA 1F51E 1GPNA 3INNA 4D9FA 4X91A 1E2NA 1V7PC 2DR3A 3R6GA 4U00A 1NQ5A 4RD3A 2JZOA 1VTKA 3GVPA 3A05A 5EJFA 3T52A 1JBKA 1ECLA 2ODBA 5LA6B 4EUHA 1MOPA 3QBTA 1HL7A 4MW2A 5KJFA 2ZREA 4CFSA 4BV2A 2O2SA 4LIPD 4HNTA 2W2OA 3QUSA 1DC3A 2F3QA 1PNRA 2YTZA 5HE9A 2OD9A 1Y63A 5LBUA 2P11A 4EGSA 1I36A 1EZ4A 4I4IA 3FHJA 1Z17A 4IUDS 4CIVA 2XWBF 4XDYA 2GCIA 4OG2A 1P1IA 3TQIA 5ICCA 2PRJA 2H0RA 3AH8A 4GW3A 3ZD9A 4ARUA 1W581 3AYZB 3DKRA 5IMBA 5DX0A 5KOJA 1NVGA 1IIBA 4XIYA 3SIWA 3NU1A 1NHWA 2JGIA 3IODA 4L6CA 3RV3A 1GTL1 4BFWA 4CCWA 4EPXA 5HHTA 2AZXA 1QYCA 2PS0A 3RWBA 4DC1A 1CZNA 2GZ2A 3H1TA 1FQWA 4NFLA 1O9BA 1ZJZA 5K3AA 1DLJA 3LCUA 4TQAA 4ZYVA 3IUQA 1V25A 1QC5A 1JSRA 1VG1A 4EL0A 2P30A 4F93B 4IGFA 1GTRA 5KPJA 1RM0A 4R98A 3ETLA 3H6GA 3GUUA 3UN1A 3V8VA 4BLTA 5A5GA 4WD3A 1EFPB 2EBFX 3GMIA 1J22A 3PFCA 3SSOA 1IZ8A 3U3KA 5BV7A 1GCOA 1X39A 1DQPA 2JRLA 3QXSA 1QRAA 1KXJA 5BUQA 4IJ5A 1M74A 3L7YA 3LUBA 2XYHA 3WNZA 3I9KA 3A36A 1N8NA 4UAJA 3OO1A 1KRWA 1AIPA 2Q5EA 1GR0A 3KZKA 2V98A 3E7PA 1T8PA 4QAQA 1WU7A 4Q9NA 5EYPA 4ZI3A 5E95A 3QFTA 4YCMA 2WB2A 3H2YA 4Q01A 2NP7A 1MAHA 2AXEA 2WHRA 2VTVA 4C7VA 3ADDA 1TMYA 4CDRA 4PNHA 2OFOA 3DT8A 4RE5A 2JLCA 1FNMA 1ZUIA 4PIMA 1P91A 4R2WA 5LB2A 1JV2B 3SFTA 3WMEA 4X65B 4EG5A 3AUFA 3KRTA 4PS1A 1KI3A 2LZ0A 5EJ2A 1OU0A 1RAFA 2BZGA 4KMRA 4XJTA 4AJIA 4OFXA 2IYRA 3E2MA 1D09A 1R37A 4AJ9A 5JO0A 2XGOA 5JCJD 4YTEA 1SKQA 1H93A 1KJ9A 2JVKA 1N5LA 3MRXA 3NCHA 1KHHA 2NSDA 2I91A 3GZJA 1FUEA 2G25A 1P9WA 4F4DA 1U3VA 4NV3A 3WDSA 2IY8A 2QYTA 1MG5A 1Y6ZA 3LDUA 2BSQA 2G9RA 5BO5A 2EL7A 4XB6B 3RKUA 1OLXA 3KAPA 1G98A 3B70A 4RY8A 4ZO4A 5LYJA 221PA 3FWZA 1B26A 4Q34A 4UNIA 3EPJA 4Y8VA 1U94A 2VYNA 4XFJA 3RVQA 4CTMA 1SVSA 1MEOA 1RYBA 4EPVA 4FS8A 4GSYA 1AB5A 2GXUA 4EOGA 1NLFA 4GMHA 4JMLA 1SRQA 1NIPA 3HVJA 3ILVA 3VU1A 2P0AA 1L2TA 2VK1A 3IQGX 4KQ9A 4AZ3B 1FRNA 3WFIA 2IDMA 4BKRA 4PIPA 4P84A 1DL5A 2COKA 1VRWA 2G06A 1MEEA 3NUQA 5ITSA 1QLHA 2F67A 5DOZA 1O6BA 2QUAA 2C07A 3ZI4A 2WT8A 1SZCA 4HB0A 3DBLB 3N7TA 3QWAA 3TO5A 3W34A 2AOUA 2O05A 3I2FA 1KH2A 2I8CA 4MHSA 3CRVA 1Z63A 3VU9B 3NGLA 1P8AA 3UT5A 3P9NA 2RI0A 2ODAA 3KNZA 3W2GA 5IC4A 1XDBA 3DYBA 3K4PA 4Q48A 5AVWA 3JQGB 2FPGA 3PDCA 2BIFA 2VK2A 3W3AA 4YR9A 4F5DA 4GPTA 2OD2A 4PLWA 4IP0A 4RCVA 1D0VA 5ARCA 2X14A 3F6PA 5CLQA 3RC9A 2PMWB 1ZY2A 1DRUA 2O7VA 1NZJA 1U3WA 3FTPA 2PXXA 3R3VA 4X8HA 5FP0A 4G0NA 4IW3B 2VAXA 1LDMA 1N36B 1W88B 2V8OA 2VCEA 4I1PA 1M2GA 4WKOA 1KZHA 4TLMB 4HXFB 4RM3A 1EBBA 4URWR 1BS9A 3R6LA 5ISMA 1LRJA 1AGPA 3BXFA 1ZHHA 2PCLA 2XUQA 2N1MA 3KQOA 4P34A 5D6OA 1LW6E 3FCOA 3OOHA 3OHMA 3KVNA 4NNJA 4S2EA 4ZVMA 4Q9LA 3JWIA 3G9ZA 2YY5A 3THWB 2BV3A 1TYZA 2OXEA 2Z3VA 1E1RA 3TUIC 4BMOB 4B7AA 2AEMA 4AZ0A 2BMEA 1J2EA 3FAZA 3HHPA 1YA6A 1SXJD 1XZJA 1YJBA 4HNUA 1LXCA 1HK7A 4OHUA 5E0OA 2XE6A 1TAUA 5FO0A 1F4PA 1QYRA 2GESA 1MUUA 2ILTA 1MMFB 1MQ8B 4YN3A 1Z4QA 5CFMA 3QRWA 3DLPX 2XITA 3I8OA 4LGYA 4MVJD 2HSGA 2XOKA 5JJIA 1NJ8A 1JB9A 5MN5A 1FJHA 1G63A 1C1XB 4RMHA 4DMCA 4EARA 3THYA 1DV2A 3JZMA 1G2OA 4QGHA 3W5BA 4AFNA 1C9MA 4HJRA 1MAAA 1VZ2A 3IPLA 5EJ7A 3FKJA 4N39A 5DTQA 3EIOA 1X1BA 4FIZA 2XODA 5EI5A 1KK0A 3NIWA 3HY3A 4I46A 3SKYA 3WLSA 1NR5A 4AO7A 2VT7A 2NMVA 4EG8A 1QH1A 4MB2A 2VNSA 2XDWA 3HU2A 1X1SA 3Q41A 5HQ3B 2FOIA 2BGGA 1R0SA 1C7JA 2I6FA 2PWPA 3CF4A 3BXOA 3ECCA 2V7VA 3L6BA 5IABA 1LPPA 3ZTYA 1DJMA 1C0IA 1P8JA 4JYCA 1E20A 2A94A 4U7WA 1E0DA 4KSBA 3WX0A 1R6UA 5ECYA 1Z35A 4IQ0A 1WSWA 3TBHA 2OR3A 4I9HA 2WWVD 2D5AA 3ICQB 3WMXA 3COPA 3R41A 4U3JB 1GQYA 4JQYA 2VUHB 3CZQA 4G0PA 3U4QB 3HRHA 1F2TA 3OZUA 3V8PA 4ZC1A 2JI6A 2FMXA 1NXQA 1YDMA 2BMJA 1SHJA 1T36A 5CBPA 2E4UA 5DYWA 4ZI7F 2OHXA 4LXYA 1Y8RB 2ATEA 3FKSA 3KETA 1QRSA 1EVIA 1IHPA 1M2KA 5DEIA 4DV1B 1T1EA 1UDWA 3FYSA 3NOOA 4E08A 2GEUA 2WSLA 2F62A 4US2R 3OIWA 3RQSA 1M7GA 2XOKD 4JSTA 1PFYA 1BAPA 4X3OA 4MGYR 1SUFA 4L5CA 5JZMA 4CLHA 1Q0QA 1AH2A 1VCNA 2VQ3A 4UHEA 1TJ4A 2DC1A 1D1SA 3IT3A 1J0XO 1U5AA 2CW5A 2AN4A 2FPIB 3L6EA 4KN6A 1HNXB 5IYZA 1GPH1 3L4SO 3L6UA 1G17A 3C70A 3VBEA 5A2QA 5JHHB 2IYAA 1Y48E 3IIJA 2V6IA 2WKQA 5E1DA 1VRVA 2LKDA 4MW9A 1Y7HA 4YAEA 2VH5R 3QFHA 4GP9A 4OH1A 4Y9SA 5F76A 1K6MA 5JEDA 4D9HA 2WJAA 5COBA 2QL5A 3GEIA 4PGHA 2X2PA 3GN2A 4C9BA 1AXEA 3HYLA 1I2AA 4IXMA 1JFRA 1ODTC 2FW8A 1R5NA 1J8DA 1EZ1A 2YVQA 3QVLA 4WBXC 4DLTA 5C7LO 3IMGA 2VPYA 5JH7F 1KIFA 1H2RS 4KRXA 3SF8B 2IIQA 3ONEA 5JI3E 1R0WA 1VB3A 1IXKA 1JG4A 1Z0JA 1NPYA 3AJEA 1WB5A 1PK9A 4LZJA 2RB5A 3BFVA 1KK2A 4RK0A 2PRIA 1UKEA 1UXIA 4CKXA 4K9RA 1U0NA 4MB0A 3GHYA 1YDEA 3U4MA 3RC7A 1A97A 1YR9A 1X2EA 2HHAA 1QPZA 5BW6B 2VPZA 1UBKS 4FMCF 1PD0A 1JKFA 4KLRA 4RHTA 1TLTA 1DKPA 4B0OA 1ONBA 2VSNA 4O29A 5EZYA 3K0EA 4CLOA 3IQHX 3JQ7B 4IHAA 5BNFA 1QNFA 3K5IA 5JASA 3H4TA 3SKXA 3E8SA 4DMMA 1V1RB 2EGHA 3COZA 3U7QB 3VQTA 2IJGX 1BVUA 3CKMA 1BRTA 3QG5A 2PYIA 1XRQA 2XEXA 4FZ5A 2HI0A 3N8GA 3ZGZA 1JDVA 1ECBA 1I1OA 2BP7A 3U4HA 1DIBA 4PPQA 3H6KA 3W77A 4MUGA 3QXXA 2AG6A 4DLYA 4M37A 3DMYA 4XA8A 1TTTA 5I8WA 3GH3A 4NR0A 2IYUA 3GROA 5KOIA 2WQ7A 1ZJWA 1V43A 2I29A 3EHDA 3OPMA 3P0JA 5KMGB 1J1ZA 4MRPA 1G7CA 4EI9A 1WABA 1EUCB 3PA6A 5IARA 4BZWA 1T2NA 4QULA 2JLAA 2WTUA 3DBVO 1L9KA 4H7IA 2X5XA 4PO8A 4ETMA 4PAGA 1GD1O 2HCFA 2DRIA 2F3UA 4EHDA 3EWSA 5F2KA 1SVKA 5L8VA 3D0OA 1R5BA 1NI4A 3Q0TA 1Y82A 3ONFA 2DOKA 2NVBA 4FMBB 3GEGA 1D6MA 2WZQA 3QWFA 4JX9A 5K09A 3QKSA 2CUZA 2OV8A 4I4TA 1V5IA 3UHOA 2ATIA 4LDPA 3BCUA 3E9YA 2QSJA 5A62A 1E7MA 2WAXA 1Q1ZA 2OAQ1 4KX5A 3WL6A 4UD2A 4YP7A 3KPYA 1IQ0A 1RP7A 3NZEA 3UUWA 4B73A 3EH2A 4O4IA 4QG3A 4HVCA 3D3EA 3PHLA 4D0LB 1L3IA 3SWWA 2X4IA 4KRGA 4RNCA 1LV8A 4Q7QA 1MLDA 3N3AC 1I3CA 2F9MA 3QI7A 1C3VA 4CKWB 3CJTA 1QH0A 1TD1A 2DFPA 2EKPA 2VA8A 3A06A 1U3CA 1UMKA 2EEZA 3EODA 3IAEA 3HLTA 3PQ3A 3Q3IA 1AG9A 1BCSA 3IJPA 1T5LA 2XH8A 2V9CA 5DBIA 3EIUA 2RH4A 2C1XA 1U1FA 2W2MA 2YJNA 4M89A 4WECA 3ZDAA 5JAOA 2A4KA 3O2SB 1VHWA 2YKGA 1XJCA 2BGWA 1J2RA 1Z4JA 3FMGA 3ZDXB 3BZWA 5C52B 3A9UA 4JBIA 3UT0A 1E2MA 1LDEA 1MNQA 1Y6QA 5EQFA 3WB9A 5J40A 1B8OA 2E82A 3LL7A 5AKHA 4G1UC 2FEKA 2I4NA 3KZ1E 5AKZA 1YE3A 3FX2A 3CNBA 3G3EA 4GD3Q 2HWXA 5AK3A 1X8JA 1Y7TA 5T6BA 2F90A 3RIHA 5BW5A 1OTHA 1CY7A 1N1MA 3EZNA 4G5FA 3SU8A 1XKTA 2OLEA 3KQQA 3EEYA 5DXJA 4A7PA 4RKFA 2BKAA 5IXSA 2PZMA 5AOBA 3N2KA 1ZM2A 3HCWA 7AT1A 2GJKA 5ERXA 2QSZA 1N6KA 2AI2A 2Y77A 5EERA 4JB8A 2FUKA 4H1UA 4IVPA 3GGPA 3TNDA 2CBXA 1EX7A 2JBHA 4J0FA 4X0EA 4B5LA 5JPCA 4V3CA 1R3DA 5CFPA 1MABB 1G66A 4AVYA 5ALTA 1X19A 3TTXA 4Q21A 3PFWO 1YJXA 4QTXA 4XQ0A 3EZGA 5F7XA 5I7HA 1Z08A 2P3LA 5REQB 2DAPA 3L1VA 4UARA 2FWIA 4FOSA 1V2HE 1GLVA 3BFJA 1CUJA 2FH5B 4LDZA 5FOXA 3U13A 4EB6B 1NWCA 5FLXA 4K87A 4RMIA 3O75A 3SLRA 1EK1A 2CJPA 5CDGA 1NVFA 2EIHA 2R6R1 3K09A 4WKNA 3E9DA 3GLKA 2M32A 1Z5NA 3H11A 2YVAA 1BMFA 4S1VA 3EFBA 1E94E 1R9GA 4KE6A 1X7YB 1KEWA 3TQOA 4L78A 3KHUA 2Q6VA 1NQUA 3UXEA 3RAGA 3V6LA 1PYDA 2RGAA 4J49A 4GT1A 1IEWA 3DWEX 4NV1A 3C1AA 2D00A 3Q12A 2D1RA 2CK3D 3RKRA 4F8YA 3RSQA 5JD4A 3T1OA 4OMUA 3UJ9A 2CE7A 1ACMA 4GBMA 4GNKA 1VG8A 3E1KA 1CUIA 4IUBS 4CEHB 3I83A 3WY9A 3X2EA 3NC0C 4Z7QB 4KBYA 1DFIA 5G1OA 3H8WA 4MQFB 2WDPA 4BTEA 4KIUA 4DA4A 1G6Q1 4S1OA 3L7NA 4M7WA 3SMVA 3L46A 2NAFA 4QTTB 4NBWA 2O0JA 4H0NA 5HSGA 2YIMA 1JFVA 4NHOA 2ZG6A 1QBGA 4MQEA 2GX6A 5FD8A 1C9KA 2Q6TA 4QG7A 3HJFA 3AR8A 1CIJA 3S2IA 1W7AA 3PHGA 4NS1A 4GI3A 2K2QB 1R1DA 2E4WA 1DMSA 2NU9A 3MGAA 3TAHA 4I7EA 1N5JA 4DDMA 4EJSC 4GOMD 2IP1A 2ZCJA 2QLTA 2XXJA 4N5LA 1QGOA 3LQKA 4YROA 3RS5A 3GNTA 5JHGB 5KSWB 2EU8A 4HH3C 3VBCA 1EWQA 1JI3A 2RJNA 5C1OA 4PZYA 1PI3A 3ZH9B 2OQIA 3L0CA 4E5VA 3SQLA 4PZDA 5LVAA 4CGZA 1J20A 3IPAA 5GWXA 1PWEA 4F3RA 4FW9A 1PAUA 4Z4EA 3ILXA 4MUNA 4Q1AA 2G88A 2VQFB 5TQVA 3VR5A 1NRWA 4EATA 1V71A 1UANA 2A5FA 4TYMA 4DTIA 1U1EA 3BA6A 1J9EA 3AOEC 1M2HA 1MTZA 4WCFC 4ZTBA 3GGJA 2QRJA 2YIVX 5AJXA 1KJNA 5A5EA 4MWZA 2DTXA 3SOPA 1KXZA 3I6IA 2L0XA 5G3ZA 3FDZA 1X42A 3W8EA 2AEFA 1WHTB 1GXSB 4MUFA 4FI3F 4YMIA 2CLHB 1IWOA 2WY2D 4BIMA 2VF2A 2WQZA 1I4WA 2GO1A 5IYZF 3SBXA 2UVQA 2CBZA 3K4QA 4K9PA 3HXLA 5HIJA 2PJZA 3TQTA 4F91B 5LQSA 4E1BA 3N6VA 5CXXA 1NKTA 3WLRA 4YRCA 1FFGA 3H8SA 1ISRA 3LA8A 1RHUA 1W4RA 1YBHA 4MKFA 2NUTA 2ZSJA 1ZK3A 4CTJA 3EWNA 3ZI0A 1S3GA 5IM4F 3SXUB 1JJIA 2FPIA 3IRUA 2QD4A 2VA9A 3K4HA 1CIPA 3HBLA 2IUEA 4AZ3A 3LK7A 1RHRA 4M9UA 4BEJA 5KNBD 4FVTA 1JA9A 5EE9A 5JATA 1VGVA 4QUJA 2RGDA 3H16A 1H5NA 3F3YA 3I6YA 2I76A 3R20A 3Q3VA 2G7MC 4H3SA 4HZUA 4PFQA 3S81A 2IOHA 1T0UA 3A4NA 1ZL2A 2IGTA 1JE1A 1U2DA 1Q20A 1ZH0A 4YLGA 4P3PA 5DVZA 3FN4A 3R6WA 3SQMA 1Z68A 4EJSB 4P53A 5CD1A 1IWBB 2RONA 2GYWA 3U39A 1KL7A 2WNHA 2ZYRA 1QF7A 2J30A 3EVFA 3FHOA 1IXRC 5JSKA 2R47A 5LCXA 1AA9A 3NTLA 3VMFA 1AZTA 4DNPA 3DNMA 1J8MF 4G07A 4PQFA 4GKJB 4OP2A 4HPJB 5HKKD 3MZ0A 3ZWPA 3OF2A 4M8IA 3JW8A 4KODA 4CLOB 3EOBI 3MQ4A 3B7GA 1U7XA 3L82B 3CPSA 4B6FA 3FWYA 1XYGA 2ZUUA 3OZWA 2FF5A 1RQLA 3JZAA 1SXJE 5LD2B 2BBSA 4IZ6A 2HNKA 1PGQA 2XIJA 1D8TA 2I71A 4V0KA 3V8QA 4CL2A 1DDIA 5K8JB 3WV4A 3HO1A 5AKXA 1LDGA 3C2QA 3IPYA 7ADHA 3ESXA 2L69A 3HVHA 1HYBA 2V9PA 4E7PA 4L9WA 1RHKA 5K7SA 3RYHA 1IWPB 1P4HA 4E3ZA 4YIHA 5EHIA 1BWPA 5TEWA 3SVLA 2O14A 2HYIC 5IU6A 3AEQA 5KYUB 3SC6A 4U8GA 1EHCA 1ZG3A 2ATCA 1E2PA 4GQAA 2BFBA 3IERA 3OCJA 5HFJA 2QVZX 3MD0A 4CEJB 2A3NA 3IEUA 3V1MA 3G8YA 3QU7A 3SDZA 5IG2A 1VI6A 5M7EA 1PX2A 5JAPA 2AOVA 4IDFA 3B2QA 1NJ1A 1E3MA 3PFGA 2ZWPA 1PGPA 3JQ8A 2BWJA 3EBOA 1ZESA 4OBEA 4XEUA 4QGGA 2D0IA 2ZBVA 1W9HA 2HEGA 5IN4A 2QRZA 3QEOA 2GEDA 4CT5A 1I4LD 3RHTA 2HTEA 4GOOD 2J5BA 1ZNQO 3LX6A 3B85A 2CFTA 3HYCA 1X92A 3ROGA 3A9VA 4CN9A 1E8NA 1PQPA 1UOQA 4FR5A 5T3YA 2NU6A 4OIMA 5TMDA 2DYKA 4IS2A 3OLVA 4M6WB 2XCIA 4A0SA 4NZYA 1BXKA 1ML3A 2JBAA 2D1FA 5JSHA 1Y98A 4DJ5X 1EKXA 1PWZA 1WCV1 2GAAA 4EFMA 2ZI7A 5EWJB 2GWHA 5TT0A 3TZCA 3N0RA 2NXEA 1YJAA 3QMVA 1XEXB 4NMLA 3B13B 1I5EA 5MN6A 3ESRA 4DCUA 4TTAA 4C89A 4CETA 1M8KA 3SBDA 4U3JA 3U4QA 2FPWA 3RHFA 5A03A 5I9TA 3F0TA 1CPYA 1PYGA 3IALA 5LKAA 2HMYB 3O9MA 3RVLA 2V54A 3A14A 2HL6A 4IZOA 4JUIA 2CJYA 2R96A 1DAPA 3KAKA 4PY2A 4ASUD 1SKUA 4QOIA 4PPGA 3ZQUA 4UJ5A 1ADBA 2A5GA 3LF1A 1W2HA 5TC4A 2QYHA 1WS6A 2NXCA 4AF6A 1IM5A 1UT6A 3G8DA 4LZOA 1NDQA 1H0RA 2OGZA 5GMOA 4MUJA 4Z3DA 1TUIA 4D02A 1AQIA 2ZT8A 4D41A 4FB5A 4JLNA 1GVNB 1OV4A 2BONA