3AXZA

Crystal structure of haemophilus influenzae trmd in complex with adenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
Knots found
sequence length
252
structure length
241
Chain Sequence
VPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 68
structure length 241
sequence length 252
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3axzA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3axzA01
4YQJA 3KY7A 1X7OA 4MCDA 3OINA 1UAJA 3GYQA 4YPZA 4YQGA 1IPAA 5D9FA 4YQ4A 4YQ2A 2YY8A 4YQ6A 4H3ZA 4YQ1A 5GMCA 3IC6A 4YQRA 1P9PA 4YVGA 4YQIA 4XBOA 3AI9X 5FAIA 3L8UA 1UALA 4MCBA 3BBHA 4YQAA 1K3RA 3O7BA 4YQ3A 4E8BA 1J85A 1Z85A 4YQQA 3BBDA 1UAMA 2QMMA 1UAKA 1VHKA 3OIJA 4IG6A 2EGVA 3IEFA 4YQNA 4X3MA 3N4KA 4YVIA 3AIAA 3KTYA 3QUVA 4X3LA 4FAKA 2V3JA 4KGNA 4YPXA 1NS5A 3N4JA 4YQCA 4YQTA 4YQPA 2EGWA 4YQ9A 4YVKA 1O6DA 4YQLA 2I6DA 3BBEA 4MCCA 4YQDA 1MXIA 4H3YA 4YQOA 4J3CA 2CX8A 4YQ5A 3KW2A 1ZJRA 5GMBA 4YVHA 4CNDA 4CNFA 1V2XA 3OIIA 3ONPA 1GZ0A 4YQ8A 1X7PA 4JALA 3KNUA 1V6ZA 1VH0A 2Z0YA 1VHYA 4KDZA 4YPWA 4YQ7A 4RG1A 4YPYA 3E5YA 3ILKA 4YQSA 5CO4A 3NK7A 4YQBA 4PZKA 4JAKA 4CNGA 2QWVA 3AXZA 3DCMX 4L69A 4YVJA 1OY5A 2HA8A 5GM8A 3NK6A 2V3KA 4YQ0A 1NXZA 2O3AA 1TO0A 4YQKA 4CNEA
chains in the Genus database with same CATH superfamily
4FMWA 4YQJA 3KY7A 3SSWN 1X7OA 4MCDA 3OINA 1UAJA 3GYQA 4YPZA 4YQGA 1IPAA 5D9FA 1WRPR 3WRPA 4YQ4A 4YQ2A 2YY8A 4YQ6A 4H3ZA 4YQ1A 5GMCA 3IC6A 4JWJA 4YQRA 1P9PA 4YVGA 4YQIA 4XBOA 3AI9X 5FAIA 1ZT9A 3L8UA 1UALA 4MCBA 3BBHA 4YQAA 1K3RA 3O7BA 4YQ3A 4E8BA 1J85A 1Z85A 4YQQA 3BBDA 1UAMA 2QMMA 1JHGA 1UAKA 3KORA 1VHKA 3OIJA 1TROA 4IG6A 2EGVA 3IEFA 4YQNA 4JWGA 1RCSA 4X3MA 4JWFA 3N4KA 4YVIA 4JWHA 2OZ9R 3AIAA 3KTYA 3QUVA 1CO0A 4X3LA 1TRRA 4FAKA 2V3JA 4KGNA 4YPXA 1NS5A 3N4JA 4YQCA 4YQTA 3FRWA 4YQPA 2EGWA 4YQ9A 4YVKA 1O6DA 4YQLA 2I6DA 1WRSR 1MI7R 3BBEA 4MCCA 4YQDA 1MXIA 4H3YA 4YQOA 4J3CA 2CX8A 4YQ5A 3KW2A 1ZJRA 5GMBA 4YVHA 4CNDA 4CNFA 1V2XA 3OIIA 3ONPA 1GZ0A 4YQ8A 1X7PA 4JALA 3KNUA 1V6ZA 1VH0A 2Z0YA 1VHYA 4KDZA 4YPWA 4YQ7A 4RG1A 4YPYA 1WRTR 3E5YA 2XDIA 3ILKA 3G1CA 4YQSA 5CO4A 3NK7A 4YQBA 3SSXN 4PZKA 4JAKA 4CNGA 2QWVA 3AXZA 3DCMX 4L69A 4YVJA 1OY5A 2HA8A 5GM8A 3NK6A 2V3KA 4YQ0A 1NXZA 2O3AA 1TO0A 4YQKA 4CNEA
chains in the Genus database with same CATH topology
4FMWA 4YQJA 3KY7A 1X7OA 4MCDA 3OINA 1UAJA 3GYQA 4YPZA 4YQGA 1IPAA 5D9FA 4YQ4A 4YQ2A 2YY8A 4YQ6A 4H3ZA 4YQ1A 5GMCA 3IC6A 4JWJA 4YQRA 1P9PA 4YVGA 4YQIA 4XBOA 3AI9X 5FAIA 3L8UA 1UALA 4MCBA 3BBHA 4YQAA 1K3RA 3O7BA 4YQ3A 4E8BA 1J85A 1Z85A 4YQQA 3BBDA 1UAMA 2QMMA 1UAKA 1VHKA 3OIJA 4IG6A 2EGVA 3IEFA 4YQNA 4JWGA 4X3MA 4JWFA 3N4KA 4YVIA 4JWHA 3AIAA 3KTYA 3QUVA 4X3LA 4FAKA 2V3JA 4KGNA 4YPXA 1NS5A 3N4JA 4YQCA 4YQTA 4YQPA 2EGWA 4YQ9A 4YVKA 1O6DA 4YQLA 2I6DA 3BBEA 4MCCA 4YQDA 1MXIA 4H3YA 4YQOA 4J3CA 2CX8A 4YQ5A 3KW2A 1ZJRA 5GMBA 4YVHA 4CNDA 4CNFA 1V2XA 3OIIA 3ONPA 1GZ0A 4YQ8A 1X7PA 4JALA 3KNUA 1V6ZA 1VH0A 2Z0YA 1VHYA 4KDZA 4YPWA 4YQ7A 4RG1A 4YPYA 3E5YA 3ILKA 4YQSA 5CO4A 3NK7A 4YQBA 4PZKA 4JAKA 4CNGA 2QWVA 3AXZA 3DCMX 4L69A 4YVJA 1OY5A 2HA8A 5GM8A 3NK6A 2V3KA 4YQ0A 1NXZA 2O3AA 1TO0A 4YQKA 4CNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQJ A;  3KY7 A;  1X7O A;  4MCD A;  3OIN A;  1UAJ A;  3GYQ A;  4YPZ A;  4YQG A;  1IPA A;  5D9F A;  4YQ4 A;  4YQ2 A;  2YY8 A;  4YQ6 A;  4H3Z A;  4YQ1 A;  5GMC A;  3IC6 A;  4YQR A;  1P9P A;  4YVG A;  4YQI A;  4XBO A;  3AI9 X;  5FAI A;  3L8U A;  1UAL A;  4MCB A;  3BBH A;  4YQA A;  1K3R A;  3O7B A;  4YQ3 A;  4E8B A;  1J85 A;  1Z85 A;  4YQQ A;  3BBD A;  1UAM A;  2QMM A;  1UAK A;  1VHK A;  3OIJ A;  4IG6 A;  2EGV A;  3IEF A;  4YQN A;  4X3M A;  3N4K A;  4YVI A;  3AIA A;  3KTY A;  3QUV A;  4X3L A;  4FAK A;  2V3J A;  4KGN A;  4YPX A;  1NS5 A;  3N4J A;  4YQC A;  4YQT A;  4YQP A;  2EGW A;  4YQ9 A;  4YVK A;  1O6D A;  4YQL A;  2I6D A;  3BBE A;  4MCC A;  4YQD A;  1MXI A;  4H3Y A;  4YQO A;  4J3C A;  2CX8 A;  4YQ5 A;  3KW2 A;  1ZJR A;  5GMB A;  4YVH A;  4CND A;  4CNF A;  1V2X A;  3OII A;  3ONP A;  1GZ0 A;  4YQ8 A;  1X7P A;  4JAL A;  3KNU A;  1V6Z A;  1VH0 A;  2Z0Y A;  1VHY A;  4KDZ A;  4YPW A;  4YQ7 A;  4RG1 A;  4YPY A;  3E5Y A;  3ILK A;  4YQS A;  5CO4 A;  3NK7 A;  4YQB A;  4PZK A;  4JAK A;  4CNG A;  2QWV A;  3AXZ A;  3DCM X;  4L69 A;  4YVJ A;  1OY5 A;  2HA8 A;  5GM8 A;  3NK6 A;  2V3K A;  4YQ0 A;  1NXZ A;  2O3A A;  1TO0 A;  4YQK A;  4CNE A; 
#chains in the Genus database with same CATH topology
 4FMW A;  4YQJ A;  3KY7 A;  3SSW N;  1X7O A;  4MCD A;  3OIN A;  1UAJ A;  3GYQ A;  4YPZ A;  4YQG A;  1IPA A;  5D9F A;  1WRP R;  3WRP A;  4YQ4 A;  4YQ2 A;  2YY8 A;  4YQ6 A;  4H3Z A;  4YQ1 A;  5GMC A;  3IC6 A;  4JWJ A;  4YQR A;  1P9P A;  4YVG A;  4YQI A;  4XBO A;  3AI9 X;  5FAI A;  1ZT9 A;  3L8U A;  1UAL A;  4MCB A;  3BBH A;  4YQA A;  1K3R A;  3O7B A;  4YQ3 A;  4E8B A;  1J85 A;  1Z85 A;  4YQQ A;  3BBD A;  1UAM A;  2QMM A;  1JHG A;  1UAK A;  3KOR A;  1VHK A;  3OIJ A;  1TRO A;  4IG6 A;  2EGV A;  3IEF A;  4YQN A;  4JWG A;  1RCS A;  4X3M A;  4JWF A;  3N4K A;  4YVI A;  4JWH A;  2OZ9 R;  3AIA A;  3KTY A;  3QUV A;  1CO0 A;  4X3L A;  1TRR A;  4FAK A;  2V3J A;  4KGN A;  4YPX A;  1NS5 A;  3N4J A;  4YQC A;  4YQT A;  3FRW A;  4YQP A;  2EGW A;  4YQ9 A;  4YVK A;  1O6D A;  4YQL A;  2I6D A;  1WRS R;  1MI7 R;  3BBE A;  4MCC A;  4YQD A;  1MXI A;  4H3Y A;  4YQO A;  4J3C A;  2CX8 A;  4YQ5 A;  3KW2 A;  1ZJR A;  5GMB A;  4YVH A;  4CND A;  4CNF A;  1V2X A;  3OII A;  3ONP A;  1GZ0 A;  4YQ8 A;  1X7P A;  4JAL A;  3KNU A;  1V6Z A;  1VH0 A;  2Z0Y A;  1VHY A;  4KDZ A;  4YPW A;  4YQ7 A;  4RG1 A;  4YPY A;  1WRT R;  3E5Y A;  2XDI A;  3ILK A;  3G1C A;  4YQS A;  5CO4 A;  3NK7 A;  4YQB A;  3SSX N;  4PZK A;  4JAK A;  4CNG A;  2QWV A;  3AXZ A;  3DCM X;  4L69 A;  4YVJ A;  1OY5 A;  2HA8 A;  5GM8 A;  3NK6 A;  2V3K A;  4YQ0 A;  1NXZ A;  2O3A A;  1TO0 A;  4YQK A;  4CNE A; 
#chains in the Genus database with same CATH homology
 4FMW A;  4YQJ A;  3KY7 A;  1X7O A;  4MCD A;  3OIN A;  1UAJ A;  3GYQ A;  4YPZ A;  4YQG A;  1IPA A;  5D9F A;  4YQ4 A;  4YQ2 A;  2YY8 A;  4YQ6 A;  4H3Z A;  4YQ1 A;  5GMC A;  3IC6 A;  4JWJ A;  4YQR A;  1P9P A;  4YVG A;  4YQI A;  4XBO A;  3AI9 X;  5FAI A;  3L8U A;  1UAL A;  4MCB A;  3BBH A;  4YQA A;  1K3R A;  3O7B A;  4YQ3 A;  4E8B A;  1J85 A;  1Z85 A;  4YQQ A;  3BBD A;  1UAM A;  2QMM A;  1UAK A;  1VHK A;  3OIJ A;  4IG6 A;  2EGV A;  3IEF A;  4YQN A;  4JWG A;  4X3M A;  4JWF A;  3N4K A;  4YVI A;  4JWH A;  3AIA A;  3KTY A;  3QUV A;  4X3L A;  4FAK A;  2V3J A;  4KGN A;  4YPX A;  1NS5 A;  3N4J A;  4YQC A;  4YQT A;  4YQP A;  2EGW A;  4YQ9 A;  4YVK A;  1O6D A;  4YQL A;  2I6D A;  3BBE A;  4MCC A;  4YQD A;  1MXI A;  4H3Y A;  4YQO A;  4J3C A;  2CX8 A;  4YQ5 A;  3KW2 A;  1ZJR A;  5GMB A;  4YVH A;  4CND A;  4CNF A;  1V2X A;  3OII A;  3ONP A;  1GZ0 A;  4YQ8 A;  1X7P A;  4JAL A;  3KNU A;  1V6Z A;  1VH0 A;  2Z0Y A;  1VHY A;  4KDZ A;  4YPW A;  4YQ7 A;  4RG1 A;  4YPY A;  3E5Y A;  3ILK A;  4YQS A;  5CO4 A;  3NK7 A;  4YQB A;  4PZK A;  4JAK A;  4CNG A;  2QWV A;  3AXZ A;  3DCM X;  4L69 A;  4YVJ A;  1OY5 A;  2HA8 A;  5GM8 A;  3NK6 A;  2V3K A;  4YQ0 A;  1NXZ A;  2O3A A;  1TO0 A;  4YQK A;  4CNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...