3FE4A

Crystal structure of human carbonic anhydrase vi
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
Knots found
sequence length
248
structure length
243
Chain Sequence
EAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGTVQISLPSTMRMTVADGTVYIAQQMHFHWGGISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 6
publication title Crystal structure of the secretory isozyme of mammalian carbonic anhydrases CA VI: implications for biological assembly and inhibitor development
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 68
structure length 243
sequence length 248
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3fe4A00
5FNHA 3RZ8A 3D9ZA 3M1JA 5DSQA 5SZ3A 5BRUA 4RUZA 5DOGA 4RFCA 4E49A 5JG5B 1CAKA 2NXTA 4FVNA 3OIKA 5AMLA 4CA2A 1RZDA 4CNVA 4Q78A 1I91A 4RH2A 3RYYA 4Z1EA 2NNGA 3OKVA 4K1QA 4QTLA 4ETQC 3JXHC 3MNKA 1CVHA 3MHOA 3DVDA 5FNJA 2Q1BA 1H9NA 4MLTA 3CAJA 7CA2A 3S75B 5DSPA 5CA2A 1TTMA 3GZ0A 2HKKA 3BETA 1FLJA 2POUA 1CA2A 3KWAA 2AX2A 3T5ZA 5FLQA 3UYQA 3B4FA 1CA3A 4GL1X 4FU5A 4KUVA 2FOVA 3ML5A 5DSNA 1ZSAA 1TG9A 5FLSA 1IF9A 1HUGA 3BL1A 3M5TA 1YDBA 4Q8XA 2FNKA 1XEVA 1LG5A 4N16A 4XIXA 3IBUA 3RG4A 4XIWA 2FOYA 4K0TA 2NN1A 5JG3B 3V3IB 1JCZA 5BRWA 3MNIA 5CJFA 2NMXA 4MO8A 4PQ7A 1BNUA 3CYUA 3MNHA 4QY3A 3DV7A 1TH9A 2CBDA 4M2UA 2NXSA 2VVBX 1AZMA 3ML2A 4ILXA 4Z1JA 3F7UA 1FR7A 3M04A 3M5SA 4JSAA 3OILA 5JGSB 5SZ2A 5E5RA 3KLDB 1CVDA 1CVCA 4ZWIA 3M2ZA 4M2WA 3F8EA 5DSRA 2W2JA 2ABEA 4Q49A 4E3HA 2WD3A 5DSJA 2OSFA 3U45X 3UYNA 5EKHA 3HFPA 5SZ7A 3JXGA 3S76A 6CA2A 4JSZA 3MMFA 3DA2A 1BN3A 1TG3A 1BV3A 5DOHA 2WEGA 4KNIA 4Y0JA 1T9NA 1CAYA 3FW3A 1F2WA 1H4NA 5JQ0A 1HCAA 4CACA 2AW1A 2Q38A 4FL7A 1CVFA 4LHIA 4FPTA 1CNGA 1MOOA 1ZSBA 4RUXA 5EHVA 1TE3X 2X7UA 1BZMA 2X7TA 3D8WA 3M96A 3LXEA 1OKLA 1G6VA 1DCAA 4Q08A 5E2MA 1IF4A 3S73B 4YXOA 3R16A 1CAJA 5G01A 1UGDA 2H4NA 4Z1KA 2HOCA 12CAA 5BRVA 1CANA 3FE4A 5CLUA 5FNIA 1BNVA 5EH5A 4HU1A 5J8ZA 3MNAA 3DAZA 4KNNA 5EHWA 4Z1NA 4Q06A 1KOQA 1CINA 3DD0A 1DMXA 4Q83A 1UGAA 4HEWA 3S74B 3V3GB 1BCDA 4PZHA 4HBAA 1I9PA 4HT2A 3T5UA 2POVA 1A42A 1G52A 1RZCA 4FRCA 1HEDA 2NNVA 2HFWA 4ZWXA 4MDGA 4JS6A 1CNJA 3SBHA 1CNKA 3N0NA 3RLDA 1DMYA 3DC9A 4JSSA 1CILA 3RZ7A 4Q9YA 1RJ6A 4KAPA 2H15A 3K2FA 4Q09A 1Z9YA 5BNLA 3HKTA 3IBIA 1CVAA 4QK1A 5JEGB 3KNEA 4HT0A 4WL4A 5SZ6A 2NN7A 3KOKA 1ZGFA 3M5EA 1LG6A 4HF3A 2WD2A 2NNOA 1KWQA 4Q6DA 4KUYA 3HLJA 1BNMA 5EKMA 1JV0A 3ZP9A 5E2SA 1CAOA 1I9NA 5DSKA 2O4ZA 4YXUA 1FSNA 2FNNA 1LUGA 2IT4A 1CCTA 3IBLA 1Z97A 4R5AA 4WW6A 1CALA 3K34A 1G0FA 4WR7A 4QJWA 1ZSCA 5JQTA 5FNKA 3NJ9A 3M2NA 2FOQA 4IDRX 4Q87A 4Q8ZA 3JXFA 1AM6A 1CNBA 1G4JA 4XZ5A 2FOUA 3MWOA 3RGEA 1CAHA 3OYSA 5FL6A 2FMGA 3MNJA 4QIZA 1CNCA 5E2NA 3QYKA 3MHLA 5FDIA 1G54A 2NXRA 4KV0A 5FLTA 3TVNX 1H9QA 2GD8A 8CA2A 4E4AA 3M40A 3F4XA 4QJOA 3DCCA 4XFWA 4E3FA 4RIVA 3RYVB 1ZGEA 3T84A 1G46A 4Q81A 3P4VA 4MDLA 3HKQA 5A25A 5SZ4A 1CNHA 4LU3A 1KEQA 4LP6A 3RYXB 3CA2A 1CNXA 1YO2A 1I9OA 4TWLA 3TMJA 2QOAA 1CRMA 1I8ZA 3OKUA 9CA2A 3S78B 1YDCA 3P58A 1TBTX 4RFDA 3IAIA 1XQ0A 1CAIA 4HEYA 1IF6A 4X5SA 3R17B 5G0BA 4E3DA 3D0NA 1BN4A 1ZE8A 5FLPA 4DZ7A 4QJPA 1XEGA 1I90A 1G45A 5FNGA 2QO8A 4Q99A 5HPJA 3RJ7A 3M98A 4L5WA 1G48A 4KNMA 1G3ZA 4QJMA 3U47A 5FL4A 4ZWZA 4K0SA 5FNLA 4C3TA 4QSIA 3OIMA 3Q31A 3IEOA 4WUQA 3SAXA 1Z93A 4BF6A 4Q7SA 1ZNCA 3M2YA 2EU2A 4YHAA 4MTYA 4ZWYA 4FIKA 1YO1A 4HEZA 1LGDA 4M2RA 4YX4A 3KKXA 4L5UA 2POWA 3OYQA 5L6KA 1TB0X 3W6IA 2FNMA 4MLXA 1CNIA 1HEAA 3V5GA 1CNWA 1V9EA 4YGFA 3P3HA 5EH8A 4E9OX 1ZH9A 4Q6EA 5L3OA 1UGGA 1FQRA 4Q7PA 1HVAA 5E28A 4QJ0A 4CQ0A 5SZ0A 1FQNA 1KWRA 4RUYA 3RYZA 3PYKA 4Q90A 4ZX1A 3RG3A 2NWPA 5DSIA 5FLOA 5EHEA 1CIMA 3C7PA 2ILIA 1I9MA 1CVEA 1G1DA 1UGEA 1XPZA 1UGCA 1URTA 1RAZA 5EZTX 5LMDA 3RZ5A 4QEFA 3V3FA 1CCUA 2CA2A 2Q1QA 4BCWA 3P44A 4PYYA 3V2MA 4ZAOA 2CBEA 2OSMA 5G03A 4ITOA 1G0EA 5FL5A 1IF7A 3SBIA 5DRSA 4KP8A 3P55A 4XE1A 1FQLA 5G0CA 1HECA 1RAYA 1MUAA 1I9QA 1I9LA 3N4BA 1OKNA 1HUHA 3EFIA 3ZNCA 1ZFQA 3P5LA 1ZFKA 1AVNA 4Q7VA 5DSLA 3S71B 2NWYA 1HEBA 1CVBA 1EOUA 3DD8A 3HKUA 4CNXA 5FNMA 3V3HB 3F7BA 1YDDA 3V3JA 4KP5A 1FSQA 1IF8A 1OKMA 3N3JA 2EU3A 5A6HA 3B1BA 2ZNCA 2VVAX 4G0CA 4QSAA 5JEHB 4YXIA 2WEOA 4TWMA 1CRAA 4JSWA 4WW8A 1BNQA 2CBAA 3T85A 4YYTA 3VBDA 1CNYA 1THKA 3DVBA 1CAMA 1FSRA 3P3JA 1RZEA 5AMDA 3NI5A 1TEUX 4QSBA 1J9WA 3M1KA 3S8XA 2EZ7A 4CNRA 1BICA 3RZ0B 3EFTA 5IPZA 5FDCA 2CABA 3S72B 5C8IA 4MDMA 1BNWA 1YDAA 3TVOX 2HD6A 2CBCA 3K7KA 3NB5A 1FQMA 2FW4A 3MDZA 2GEHA 5E5UA 1DCBA 4QK3A 3U7CA 5DSMA 4L5VA 3CZVA 3V7XA 3U3AX 3PJJA 4R59A 4Q8YA 3T82A 1BNNA 3S77B 5JDVB 3HS4A 2NWOA 3IBNA 1V9IC 3KOIA 4QJXA 4YVYA 5EOIA 4Q07A 5DVXA 4WUPA 1JD0A 4E3GA 1OQ5A 5AMGA 3KIGA 2CBBA 2HNCA 3N2PA 4FVOA 3MNUA 1TEQX 4DZ9A 1HCBA 1CAZA 4G7AA 3M2XA 4R5BA 2FMZA 3M1WA 4RN4A 3MHMA 1FR4A 4QIYA 2WEJA 1BN1A 4N0XB 3M14A 3L14A 5DSOA 1YO0A 4YGKA 5SZ1A 1RZAA 5BYIA 3KS3A 5CACA 2X7SA 4K0ZA 3S97A 1BNTA 3OY0A 2FOSA 1RZBA 3MYQA 4IWZA 1G53A 3M3XA 4KNJA 4RIUA 3RZ1B 4K13A 3D92A 1CZMA 3PO6A 1KOPA 5JEPB 1UGFA 3S9TA 3DCSA 3V2JA 5EKJA 3HKNA 4QSJA 3M1QA 1LZVA 4YGJA 3BL0A 1IF5A 4BF1A 4ZX0A 4M2VA 3MHIA 4YWPA 1RJ5A 3MHCA 5SZ5A 2HL4A 4KUWA 3MZCA 5EH7A 4YGLA 5JGTB 3DCWA 1G4OA 3M67A 3T83A 1CCSA 3KONA 4Q0LA 4COQA 3D93A 1Y7WA 5FLRA 3IGPA 3DBUA 4PYXA 4Z0QA 4ITPA 3DC3A 2WEHA 3FFPX 5E2KA 3RYJB 3W6HA 2NWZA 4CNWA 2QP6A 5EIJA 4QK2A 3P5AA 2F14A 3DVCA 4PXXA 4Q7WA 1UGBA 5JESB 2NNSA 3SAPA 4YGNA 5E2RA 4UOVA 4E5QA
chains in the Genus database with same CATH superfamily
5FNHA 3RZ8A 3D9ZA 3M1JA 5DSQA 5SZ3A 5BRUA 4RUZA 5DOGA 4RFCA 4E49A 5JG5B 1CAKA 2NXTA 4FVNA 3OIKA 5AMLA 4CA2A 1RZDA 4CNVA 4Q78A 1I91A 4RH2A 3RYYA 4Z1EA 2NNGA 3OKVA 4K1QA 4QTLA 4ETQC 3JXHC 3MNKA 1CVHA 3MHOA 3DVDA 5FNJA 2Q1BA 1H9NA 4MLTA 3CAJA 7CA2A 3S75B 5DSPA 5CA2A 1TTMA 3GZ0A 2HKKA 3BETA 1FLJA 2POUA 1CA2A 3KWAA 2AX2A 3T5ZA 5FLQA 3UYQA 3B4FA 1CA3A 4GL1X 4FU5A 4KUVA 2FOVA 3ML5A 5DSNA 1ZSAA 1TG9A 5FLSA 1IF9A 1HUGA 3BL1A 3M5TA 1YDBA 4Q8XA 2FNKA 1XEVA 1LG5A 4N16A 4XIXA 3IBUA 3RG4A 4XIWA 2FOYA 4K0TA 2NN1A 5JG3B 3V3IB 1JCZA 5BRWA 3MNIA 5CJFA 2NMXA 4MO8A 4PQ7A 1BNUA 3CYUA 3MNHA 4QY3A 3DV7A 1TH9A 2CBDA 4M2UA 2NXSA 2VVBX 1AZMA 3ML2A 4ILXA 4Z1JA 3F7UA 1FR7A 3M04A 3M5SA 4JSAA 3OILA 5JGSB 5SZ2A 5E5RA 3KLDB 1CVDA 1CVCA 4ZWIA 3M2ZA 4M2WA 3F8EA 5DSRA 2W2JA 2ABEA 4Q49A 4E3HA 2WD3A 5DSJA 2OSFA 3U45X 3UYNA 5EKHA 3HFPA 5SZ7A 3JXGA 3S76A 6CA2A 4JSZA 3MMFA 3DA2A 1BN3A 1TG3A 1BV3A 5DOHA 2WEGA 4KNIA 4Y0JA 1T9NA 1CAYA 3FW3A 1F2WA 1H4NA 5JQ0A 1HCAA 4CACA 2AW1A 2Q38A 4FL7A 1CVFA 4LHIA 4FPTA 1CNGA 1MOOA 1ZSBA 4RUXA 5EHVA 1TE3X 2X7UA 1BZMA 2X7TA 3D8WA 3M96A 3LXEA 1OKLA 1G6VA 1DCAA 4Q08A 5E2MA 1IF4A 3S73B 4YXOA 3R16A 1CAJA 5G01A 1UGDA 2H4NA 4Z1KA 2HOCA 12CAA 5BRVA 1CANA 3FE4A 5CLUA 5FNIA 1BNVA 5EH5A 4HU1A 5J8ZA 3MNAA 3DAZA 4KNNA 5EHWA 4Z1NA 4Q06A 1KOQA 1CINA 3DD0A 1DMXA 4Q83A 1UGAA 4HEWA 3S74B 3V3GB 1BCDA 4PZHA 4HBAA 1I9PA 4HT2A 3T5UA 2POVA 1A42A 1G52A 1RZCA 4FRCA 1HEDA 2NNVA 2HFWA 4ZWXA 4MDGA 4JS6A 1CNJA 3SBHA 1CNKA 3N0NA 3RLDA 1DMYA 3DC9A 4JSSA 1CILA 3RZ7A 4Q9YA 1RJ6A 4KAPA 2H15A 3K2FA 4Q09A 1Z9YA 5BNLA 3HKTA 3IBIA 1CVAA 4QK1A 5JEGB 3KNEA 4HT0A 4WL4A 5SZ6A 2NN7A 3KOKA 1ZGFA 3M5EA 1LG6A 4HF3A 2WD2A 2NNOA 1KWQA 4Q6DA 4KUYA 3HLJA 1BNMA 5EKMA 1JV0A 3ZP9A 5E2SA 1CAOA 1I9NA 5DSKA 2O4ZA 4YXUA 1FSNA 2FNNA 1LUGA 2IT4A 1CCTA 3IBLA 1Z97A 4R5AA 4WW6A 1CALA 3K34A 1G0FA 4WR7A 4QJWA 1ZSCA 5JQTA 5FNKA 3NJ9A 3M2NA 2FOQA 4IDRX 4Q87A 4Q8ZA 3JXFA 1AM6A 1CNBA 1G4JA 4XZ5A 2FOUA 3MWOA 3RGEA 1CAHA 3OYSA 5FL6A 2FMGA 3MNJA 4QIZA 1CNCA 5E2NA 3QYKA 3MHLA 5FDIA 1G54A 2NXRA 4KV0A 5FLTA 3TVNX 1H9QA 2GD8A 8CA2A 4E4AA 3M40A 3F4XA 4QJOA 3DCCA 4XFWA 4E3FA 4RIVA 3RYVB 1ZGEA 3T84A 1G46A 4Q81A 3P4VA 4MDLA 3HKQA 5A25A 5SZ4A 1CNHA 4LU3A 1KEQA 4LP6A 3RYXB 3CA2A 1CNXA 1YO2A 1I9OA 4TWLA 3TMJA 2QOAA 1CRMA 1I8ZA 3OKUA 9CA2A 3S78B 1YDCA 3P58A 1TBTX 4RFDA 3IAIA 1XQ0A 1CAIA 4HEYA 1IF6A 4X5SA 3R17B 5G0BA 4E3DA 3D0NA 1BN4A 1ZE8A 5FLPA 4DZ7A 4QJPA 1XEGA 1I90A 1G45A 5FNGA 2QO8A 4Q99A 5HPJA 3RJ7A 3M98A 4L5WA 1G48A 4KNMA 1G3ZA 4QJMA 3U47A 5FL4A 4ZWZA 4K0SA 5FNLA 4C3TA 4QSIA 3OIMA 3Q31A 3IEOA 4WUQA 3SAXA 1Z93A 4BF6A 4Q7SA 1ZNCA 3M2YA 2EU2A 4YHAA 4MTYA 4ZWYA 4FIKA 1YO1A 4HEZA 1LGDA 4M2RA 4YX4A 3KKXA 4L5UA 2POWA 3OYQA 5L6KA 1TB0X 3W6IA 2FNMA 4MLXA 1CNIA 1HEAA 3V5GA 1CNWA 1V9EA 4YGFA 3P3HA 5EH8A 4E9OX 1ZH9A 4Q6EA 5L3OA 1UGGA 1FQRA 4Q7PA 1HVAA 5E28A 4QJ0A 4CQ0A 5SZ0A 1FQNA 1KWRA 4RUYA 3RYZA 3PYKA 4Q90A 4ZX1A 3RG3A 2NWPA 5DSIA 5FLOA 5EHEA 1CIMA 3C7PA 2ILIA 1I9MA 1CVEA 1G1DA 1UGEA 1XPZA 1UGCA 1URTA 1RAZA 5EZTX 5LMDA 3RZ5A 4QEFA 3V3FA 1CCUA 2CA2A 2Q1QA 4BCWA 3P44A 4PYYA 3V2MA 4ZAOA 2CBEA 2OSMA 5G03A 4ITOA 1G0EA 5FL5A 1IF7A 3SBIA 5DRSA 4KP8A 3P55A 4XE1A 1FQLA 5G0CA 1HECA 1RAYA 1MUAA 1I9QA 1I9LA 3N4BA 1OKNA 1HUHA 3EFIA 3ZNCA 1ZFQA 3P5LA 1ZFKA 1AVNA 4Q7VA 5DSLA 3S71B 2NWYA 1HEBA 1CVBA 1EOUA 3DD8A 3HKUA 4CNXA 5FNMA 3V3HB 3F7BA 1YDDA 3V3JA 4KP5A 1FSQA 1IF8A 1OKMA 3N3JA 2EU3A 5A6HA 3B1BA 2ZNCA 2VVAX 4G0CA 4QSAA 5JEHB 4YXIA 2WEOA 4TWMA 1CRAA 4JSWA 4WW8A 1BNQA 2CBAA 3T85A 4YYTA 3VBDA 1CNYA 1THKA 3DVBA 1CAMA 1FSRA 3P3JA 1RZEA 5AMDA 3NI5A 1TEUX 4QSBA 1J9WA 3M1KA 3S8XA 2EZ7A 4CNRA 1BICA 3RZ0B 3EFTA 5IPZA 5FDCA 2CABA 3S72B 5C8IA 4MDMA 1BNWA 1YDAA 3TVOX 2HD6A 2CBCA 3K7KA 3NB5A 1FQMA 2FW4A 3MDZA 2GEHA 5E5UA 1DCBA 4QK3A 3U7CA 5DSMA 4L5VA 3CZVA 3V7XA 3U3AX 3PJJA 4R59A 4Q8YA 3T82A 1BNNA 3S77B 5JDVB 3HS4A 2NWOA 3IBNA 1V9IC 3KOIA 4QJXA 4YVYA 5EOIA 4Q07A 5DVXA 4WUPA 1JD0A 4E3GA 1OQ5A 5AMGA 3KIGA 2CBBA 2HNCA 3N2PA 4FVOA 3MNUA 1TEQX 4DZ9A 1HCBA 1CAZA 4G7AA 3M2XA 4R5BA 2FMZA 3M1WA 4RN4A 3MHMA 1FR4A 4QIYA 2WEJA 1BN1A 4N0XB 3M14A 3L14A 5DSOA 1YO0A 4YGKA 5SZ1A 1RZAA 5BYIA 3KS3A 5CACA 2X7SA 4K0ZA 3S97A 1BNTA 3OY0A 2FOSA 1RZBA 3MYQA 4IWZA 1G53A 3M3XA 4KNJA 4RIUA 3RZ1B 4K13A 3D92A 1CZMA 3PO6A 1KOPA 5JEPB 1UGFA 3S9TA 3DCSA 3V2JA 5EKJA 3HKNA 4QSJA 3M1QA 1LZVA 4YGJA 3BL0A 1IF5A 4BF1A 4ZX0A 4M2VA 3MHIA 4YWPA 1RJ5A 3MHCA 5SZ5A 2HL4A 4KUWA 3MZCA 5EH7A 4YGLA 5JGTB 3DCWA 1G4OA 3M67A 3T83A 1CCSA 3KONA 4Q0LA 4COQA 3D93A 1Y7WA 5FLRA 3IGPA 3DBUA 4PYXA 4Z0QA 4ITPA 3DC3A 2WEHA 3FFPX 5E2KA 3RYJB 3W6HA 2NWZA 4CNWA 2QP6A 5EIJA 4QK2A 3P5AA 2F14A 3DVCA 4PXXA 4Q7WA 1UGBA 5JESB 2NNSA 3SAPA 4YGNA 5E2RA 4UOVA 4E5QA
chains in the Genus database with same CATH topology
5FNHA 3RZ8A 3D9ZA 3M1JA 5DSQA 5SZ3A 5BRUA 4RUZA 5DOGA 4RFCA 4E49A 5JG5B 1CAKA 2NXTA 4FVNA 3OIKA 5AMLA 4CA2A 1RZDA 4CNVA 4Q78A 1I91A 4RH2A 3RYYA 4Z1EA 2NNGA 3OKVA 4K1QA 4QTLA 4ETQC 3JXHC 3MNKA 1CVHA 3MHOA 3DVDA 5FNJA 2Q1BA 1H9NA 4MLTA 3CAJA 7CA2A 3S75B 5DSPA 5CA2A 1TTMA 3GZ0A 2HKKA 3BETA 1FLJA 2POUA 1CA2A 3KWAA 2AX2A 3T5ZA 5FLQA 3UYQA 3B4FA 1CA3A 4GL1X 4FU5A 4KUVA 2FOVA 3ML5A 5DSNA 1ZSAA 1TG9A 5FLSA 1IF9A 1HUGA 3BL1A 3M5TA 1YDBA 4Q8XA 2FNKA 1XEVA 1LG5A 4N16A 4XIXA 3IBUA 3RG4A 4XIWA 2FOYA 4K0TA 2NN1A 5JG3B 3V3IB 1JCZA 5BRWA 3MNIA 5CJFA 2NMXA 4MO8A 4PQ7A 1BNUA 3CYUA 3MNHA 4QY3A 3DV7A 1TH9A 2CBDA 4M2UA 2NXSA 2VVBX 1AZMA 3ML2A 4ILXA 4Z1JA 3F7UA 1FR7A 3M04A 3M5SA 4JSAA 3OILA 5JGSB 5SZ2A 5E5RA 3KLDB 1CVDA 1CVCA 4ZWIA 3M2ZA 4M2WA 3F8EA 5DSRA 2W2JA 2ABEA 4Q49A 4E3HA 2WD3A 5DSJA 2OSFA 3U45X 3UYNA 5EKHA 3HFPA 5SZ7A 3JXGA 3S76A 6CA2A 4JSZA 3MMFA 3DA2A 1BN3A 1TG3A 1BV3A 5DOHA 2WEGA 4KNIA 4Y0JA 1T9NA 1CAYA 3FW3A 1F2WA 1H4NA 5JQ0A 1HCAA 4CACA 2AW1A 2Q38A 4FL7A 1CVFA 4LHIA 4FPTA 1CNGA 1MOOA 1ZSBA 4RUXA 5EHVA 1TE3X 2X7UA 1BZMA 2X7TA 3D8WA 3M96A 3LXEA 1OKLA 1G6VA 1DCAA 4Q08A 5E2MA 1IF4A 3S73B 4YXOA 3R16A 1CAJA 5G01A 1UGDA 2H4NA 4Z1KA 2HOCA 12CAA 5BRVA 1CANA 3FE4A 5CLUA 5FNIA 1BNVA 5EH5A 4HU1A 5J8ZA 3MNAA 3DAZA 4KNNA 5EHWA 4Z1NA 4Q06A 1KOQA 1CINA 3DD0A 1DMXA 4Q83A 1UGAA 4HEWA 3S74B 3V3GB 1BCDA 4PZHA 4HBAA 1I9PA 4HT2A 3T5UA 2POVA 1A42A 1G52A 1RZCA 4FRCA 1HEDA 2NNVA 2HFWA 4ZWXA 4MDGA 4JS6A 1CNJA 3SBHA 1CNKA 3N0NA 3RLDA 1DMYA 3DC9A 4JSSA 1CILA 3RZ7A 4Q9YA 1RJ6A 4KAPA 2H15A 3K2FA 4Q09A 1Z9YA 5BNLA 3HKTA 3IBIA 1CVAA 4QK1A 5JEGB 3KNEA 4HT0A 4WL4A 5SZ6A 2NN7A 3KOKA 1ZGFA 3M5EA 1LG6A 4HF3A 2WD2A 2NNOA 1KWQA 4Q6DA 4KUYA 3HLJA 1BNMA 5EKMA 1JV0A 3ZP9A 5E2SA 1CAOA 1I9NA 5DSKA 2O4ZA 4YXUA 1FSNA 2FNNA 1LUGA 2IT4A 1CCTA 3IBLA 1Z97A 4R5AA 4WW6A 1CALA 3K34A 1G0FA 4WR7A 4QJWA 1ZSCA 5JQTA 5FNKA 3NJ9A 3M2NA 2FOQA 4IDRX 4Q87A 4Q8ZA 3JXFA 1AM6A 1CNBA 1G4JA 4XZ5A 2FOUA 3MWOA 3RGEA 1CAHA 3OYSA 5FL6A 2FMGA 3MNJA 4QIZA 1CNCA 5E2NA 3QYKA 3MHLA 5FDIA 1G54A 2NXRA 4KV0A 5FLTA 3TVNX 1H9QA 2GD8A 8CA2A 4E4AA 3M40A 3F4XA 4QJOA 3DCCA 4XFWA 4E3FA 4RIVA 3RYVB 1ZGEA 3T84A 1G46A 4Q81A 3P4VA 4MDLA 3HKQA 5A25A 5SZ4A 1CNHA 4LU3A 1KEQA 4LP6A 3RYXB 3CA2A 1CNXA 1YO2A 1I9OA 4TWLA 3TMJA 2QOAA 1CRMA 1I8ZA 3OKUA 9CA2A 3S78B 1YDCA 3P58A 1TBTX 4RFDA 3IAIA 1XQ0A 1CAIA 4HEYA 1IF6A 4X5SA 3R17B 5G0BA 4E3DA 3D0NA 1BN4A 1ZE8A 5FLPA 4DZ7A 4QJPA 1XEGA 1I90A 1G45A 5FNGA 2QO8A 4Q99A 5HPJA 3RJ7A 3M98A 4L5WA 1G48A 4KNMA 1G3ZA 4QJMA 3U47A 5FL4A 4ZWZA 4K0SA 5FNLA 4C3TA 4QSIA 3OIMA 3Q31A 3IEOA 4WUQA 3SAXA 1Z93A 4BF6A 4Q7SA 1ZNCA 3M2YA 2EU2A 4YHAA 4MTYA 4ZWYA 4FIKA 1YO1A 4HEZA 1LGDA 4M2RA 4YX4A 3KKXA 4L5UA 2POWA 3OYQA 5L6KA 1TB0X 3W6IA 2FNMA 4MLXA 1CNIA 1HEAA 3V5GA 1CNWA 1V9EA 4YGFA 3P3HA 5EH8A 4E9OX 1ZH9A 4Q6EA 5L3OA 1UGGA 1FQRA 4Q7PA 1HVAA 5E28A 4QJ0A 4CQ0A 5SZ0A 1FQNA 1KWRA 4RUYA 3RYZA 3PYKA 4Q90A 4ZX1A 3RG3A 2NWPA 5DSIA 5FLOA 5EHEA 1CIMA 3C7PA 2ILIA 1I9MA 1CVEA 1G1DA 1UGEA 1XPZA 1UGCA 1URTA 1RAZA 5EZTX 5LMDA 3RZ5A 4QEFA 3V3FA 1CCUA 2CA2A 2Q1QA 4BCWA 3P44A 4PYYA 3V2MA 4ZAOA 2CBEA 2OSMA 5G03A 4ITOA 1G0EA 5FL5A 1IF7A 3SBIA 5DRSA 4KP8A 3P55A 4XE1A 1FQLA 5G0CA 1HECA 1RAYA 1MUAA 1I9QA 1I9LA 3N4BA 1OKNA 1HUHA 3EFIA 3ZNCA 1ZFQA 3P5LA 1ZFKA 1AVNA 4Q7VA 5DSLA 3S71B 2NWYA 1HEBA 1CVBA 1EOUA 3DD8A 3HKUA 4CNXA 5FNMA 3V3HB 3F7BA 1YDDA 3V3JA 4KP5A 1FSQA 1IF8A 1OKMA 3N3JA 2EU3A 5A6HA 3B1BA 2ZNCA 2VVAX 4G0CA 4QSAA 5JEHB 4YXIA 2WEOA 4TWMA 1CRAA 4JSWA 4WW8A 1BNQA 2CBAA 3T85A 4YYTA 3VBDA 1CNYA 1THKA 3DVBA 1CAMA 1FSRA 3P3JA 1RZEA 5AMDA 3NI5A 1TEUX 4QSBA 1J9WA 3M1KA 3S8XA 2EZ7A 4CNRA 1BICA 3RZ0B 3EFTA 5IPZA 5FDCA 2CABA 3S72B 5C8IA 4MDMA 1BNWA 1YDAA 3TVOX 2HD6A 2CBCA 3K7KA 3NB5A 1FQMA 2FW4A 3MDZA 2GEHA 5E5UA 1DCBA 4QK3A 3U7CA 5DSMA 4L5VA 3CZVA 3V7XA 3U3AX 3PJJA 4R59A 4Q8YA 3T82A 1BNNA 3S77B 5JDVB 3HS4A 2NWOA 3IBNA 1V9IC 3KOIA 4QJXA 4YVYA 5EOIA 4Q07A 5DVXA 4WUPA 1JD0A 4E3GA 1OQ5A 5AMGA 3KIGA 2CBBA 2HNCA 3N2PA 4FVOA 3MNUA 1TEQX 4DZ9A 1HCBA 1CAZA 4G7AA 3M2XA 4R5BA 2FMZA 3M1WA 4RN4A 3MHMA 1FR4A 4QIYA 2WEJA 1BN1A 4N0XB 3M14A 3L14A 5DSOA 1YO0A 4YGKA 5SZ1A 1RZAA 5BYIA 3KS3A 5CACA 2X7SA 4K0ZA 3S97A 1BNTA 3OY0A 2FOSA 1RZBA 3MYQA 4IWZA 1G53A 3M3XA 4KNJA 4RIUA 3RZ1B 4K13A 3D92A 1CZMA 3PO6A 1KOPA 5JEPB 1UGFA 3S9TA 3DCSA 3V2JA 5EKJA 3HKNA 4QSJA 3M1QA 1LZVA 4YGJA 3BL0A 1IF5A 4BF1A 4ZX0A 4M2VA 3MHIA 4YWPA 1RJ5A 3MHCA 5SZ5A 2HL4A 4KUWA 3MZCA 5EH7A 4YGLA 5JGTB 3DCWA 1G4OA 3M67A 3T83A 1CCSA 3KONA 4Q0LA 4COQA 3D93A 1Y7WA 5FLRA 3IGPA 3DBUA 4PYXA 4Z0QA 4ITPA 3DC3A 2WEHA 3FFPX 5E2KA 3RYJB 3W6HA 2NWZA 4CNWA 2QP6A 5EIJA 4QK2A 3P5AA 2F14A 3DVCA 4PXXA 4Q7WA 1UGBA 5JESB 2NNSA 3SAPA 4YGNA 5E2RA 4UOVA 4E5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNH A;  3RZ8 A;  3D9Z A;  3M1J A;  5DSQ A;  5SZ3 A;  5BRU A;  4RUZ A;  5DOG A;  4RFC A;  4E49 A;  5JG5 B;  1CAK A;  2NXT A;  4FVN A;  3OIK A;  5AML A;  4CA2 A;  1RZD A;  4CNV A;  4Q78 A;  1I91 A;  4RH2 A;  3RYY A;  4Z1E A;  2NNG A;  3OKV A;  4K1Q A;  4QTL A;  4ETQ C;  3JXH C;  3MNK A;  1CVH A;  3MHO A;  3DVD A;  5FNJ A;  2Q1B A;  1H9N A;  4MLT A;  3CAJ A;  7CA2 A;  3S75 B;  5DSP A;  5CA2 A;  1TTM A;  3GZ0 A;  2HKK A;  3BET A;  1FLJ A;  2POU A;  1CA2 A;  3KWA A;  2AX2 A;  3T5Z A;  5FLQ A;  3UYQ A;  3B4F A;  1CA3 A;  4GL1 X;  4FU5 A;  4KUV A;  2FOV A;  3ML5 A;  5DSN A;  1ZSA A;  1TG9 A;  5FLS A;  1IF9 A;  1HUG A;  3BL1 A;  3M5T A;  1YDB A;  4Q8X A;  2FNK A;  1XEV A;  1LG5 A;  4N16 A;  4XIX A;  3IBU A;  3RG4 A;  4XIW A;  2FOY A;  4K0T A;  2NN1 A;  5JG3 B;  3V3I B;  1JCZ A;  5BRW A;  3MNI A;  5CJF A;  2NMX A;  4MO8 A;  4PQ7 A;  1BNU A;  3CYU A;  3MNH A;  4QY3 A;  3DV7 A;  1TH9 A;  2CBD A;  4M2U A;  2NXS A;  2VVB X;  1AZM A;  3ML2 A;  4ILX A;  4Z1J A;  3F7U A;  1FR7 A;  3M04 A;  3M5S A;  4JSA A;  3OIL A;  5JGS B;  5SZ2 A;  5E5R A;  3KLD B;  1CVD A;  1CVC A;  4ZWI A;  3M2Z A;  4M2W A;  3F8E A;  5DSR A;  2W2J A;  2ABE A;  4Q49 A;  4E3H A;  2WD3 A;  5DSJ A;  2OSF A;  3U45 X;  3UYN A;  5EKH A;  3HFP A;  5SZ7 A;  3JXG A;  3S76 A;  6CA2 A;  4JSZ A;  3MMF A;  3DA2 A;  1BN3 A;  1TG3 A;  1BV3 A;  5DOH A;  2WEG A;  4KNI A;  4Y0J A;  1T9N A;  1CAY A;  3FW3 A;  1F2W A;  1H4N A;  5JQ0 A;  1HCA A;  4CAC A;  2AW1 A;  2Q38 A;  4FL7 A;  1CVF A;  4LHI A;  4FPT A;  1CNG A;  1MOO A;  1ZSB A;  4RUX A;  5EHV A;  1TE3 X;  2X7U A;  1BZM A;  2X7T A;  3D8W A;  3M96 A;  3LXE A;  1OKL A;  1G6V A;  1DCA A;  4Q08 A;  5E2M A;  1IF4 A;  3S73 B;  4YXO A;  3R16 A;  1CAJ A;  5G01 A;  1UGD A;  2H4N A;  4Z1K A;  2HOC A;  12CA A;  5BRV A;  1CAN A;  3FE4 A;  5CLU A;  5FNI A;  1BNV A;  5EH5 A;  4HU1 A;  5J8Z A;  3MNA A;  3DAZ A;  4KNN A;  5EHW A;  4Z1N A;  4Q06 A;  1KOQ A;  1CIN A;  3DD0 A;  1DMX A;  4Q83 A;  1UGA A;  4HEW A;  3S74 B;  3V3G B;  1BCD A;  4PZH A;  4HBA A;  1I9P A;  4HT2 A;  3T5U A;  2POV A;  1A42 A;  1G52 A;  1RZC A;  4FRC A;  1HED A;  2NNV A;  2HFW A;  4ZWX A;  4MDG A;  4JS6 A;  1CNJ A;  3SBH A;  1CNK A;  3N0N A;  3RLD A;  1DMY A;  3DC9 A;  4JSS A;  1CIL A;  3RZ7 A;  4Q9Y A;  1RJ6 A;  4KAP A;  2H15 A;  3K2F A;  4Q09 A;  1Z9Y A;  5BNL A;  3HKT A;  3IBI A;  1CVA A;  4QK1 A;  5JEG B;  3KNE A;  4HT0 A;  4WL4 A;  5SZ6 A;  2NN7 A;  3KOK A;  1ZGF A;  3M5E A;  1LG6 A;  4HF3 A;  2WD2 A;  2NNO A;  1KWQ A;  4Q6D A;  4KUY A;  3HLJ A;  1BNM A;  5EKM A;  1JV0 A;  3ZP9 A;  5E2S A;  1CAO A;  1I9N A;  5DSK A;  2O4Z A;  4YXU A;  1FSN A;  2FNN A;  1LUG A;  2IT4 A;  1CCT A;  3IBL A;  1Z97 A;  4R5A A;  4WW6 A;  1CAL A;  3K34 A;  1G0F A;  4WR7 A;  4QJW A;  1ZSC A;  5JQT A;  5FNK A;  3NJ9 A;  3M2N A;  2FOQ A;  4IDR X;  4Q87 A;  4Q8Z A;  3JXF A;  1AM6 A;  1CNB A;  1G4J A;  4XZ5 A;  2FOU A;  3MWO A;  3RGE A;  1CAH A;  3OYS A;  5FL6 A;  2FMG A;  3MNJ A;  4QIZ A;  1CNC A;  5E2N A;  3QYK A;  3MHL A;  5FDI A;  1G54 A;  2NXR A;  4KV0 A;  5FLT A;  3TVN X;  1H9Q A;  2GD8 A;  8CA2 A;  4E4A A;  3M40 A;  3F4X A;  4QJO A;  3DCC A;  4XFW A;  4E3F A;  4RIV A;  3RYV B;  1ZGE A;  3T84 A;  1G46 A;  4Q81 A;  3P4V A;  4MDL A;  3HKQ A;  5A25 A;  5SZ4 A;  1CNH A;  4LU3 A;  1KEQ A;  4LP6 A;  3RYX B;  3CA2 A;  1CNX A;  1YO2 A;  1I9O A;  4TWL A;  3TMJ A;  2QOA A;  1CRM A;  1I8Z A;  3OKU A;  9CA2 A;  3S78 B;  1YDC A;  3P58 A;  1TBT X;  4RFD A;  3IAI A;  1XQ0 A;  1CAI A;  4HEY A;  1IF6 A;  4X5S A;  3R17 B;  5G0B A;  4E3D A;  3D0N A;  1BN4 A;  1ZE8 A;  5FLP A;  4DZ7 A;  4QJP A;  1XEG A;  1I90 A;  1G45 A;  5FNG A;  2QO8 A;  4Q99 A;  5HPJ A;  3RJ7 A;  3M98 A;  4L5W A;  1G48 A;  4KNM A;  1G3Z A;  4QJM A;  3U47 A;  5FL4 A;  4ZWZ A;  4K0S A;  5FNL A;  4C3T A;  4QSI A;  3OIM A;  3Q31 A;  3IEO A;  4WUQ A;  3SAX A;  1Z93 A;  4BF6 A;  4Q7S A;  1ZNC A;  3M2Y A;  2EU2 A;  4YHA A;  4MTY A;  4ZWY A;  4FIK A;  1YO1 A;  4HEZ A;  1LGD A;  4M2R A;  4YX4 A;  3KKX A;  4L5U A;  2POW A;  3OYQ A;  5L6K A;  1TB0 X;  3W6I A;  2FNM A;  4MLX A;  1CNI A;  1HEA A;  3V5G A;  1CNW A;  1V9E A;  4YGF A;  3P3H A;  5EH8 A;  4E9O X;  1ZH9 A;  4Q6E A;  5L3O A;  1UGG A;  1FQR A;  4Q7P A;  1HVA A;  5E28 A;  4QJ0 A;  4CQ0 A;  5SZ0 A;  1FQN A;  1KWR A;  4RUY A;  3RYZ A;  3PYK A;  4Q90 A;  4ZX1 A;  3RG3 A;  2NWP A;  5DSI A;  5FLO A;  5EHE A;  1CIM A;  3C7P A;  2ILI A;  1I9M A;  1CVE A;  1G1D A;  1UGE A;  1XPZ A;  1UGC A;  1URT A;  1RAZ A;  5EZT X;  5LMD A;  3RZ5 A;  4QEF A;  3V3F A;  1CCU A;  2CA2 A;  2Q1Q A;  4BCW A;  3P44 A;  4PYY A;  3V2M A;  4ZAO A;  2CBE A;  2OSM A;  5G03 A;  4ITO A;  1G0E A;  5FL5 A;  1IF7 A;  3SBI A;  5DRS A;  4KP8 A;  3P55 A;  4XE1 A;  1FQL A;  5G0C A;  1HEC A;  1RAY A;  1MUA A;  1I9Q A;  1I9L A;  3N4B A;  1OKN A;  1HUH A;  3EFI A;  3ZNC A;  1ZFQ A;  3P5L A;  1ZFK A;  1AVN A;  4Q7V A;  5DSL A;  3S71 B;  2NWY A;  1HEB A;  1CVB A;  1EOU A;  3DD8 A;  3HKU A;  4CNX A;  5FNM A;  3V3H B;  3F7B A;  1YDD A;  3V3J A;  4KP5 A;  1FSQ A;  1IF8 A;  1OKM A;  3N3J A;  2EU3 A;  5A6H A;  3B1B A;  2ZNC A;  2VVA X;  4G0C A;  4QSA A;  5JEH B;  4YXI A;  2WEO A;  4TWM A;  1CRA A;  4JSW A;  4WW8 A;  1BNQ A;  2CBA A;  3T85 A;  4YYT A;  3VBD A;  1CNY A;  1THK A;  3DVB A;  1CAM A;  1FSR A;  3P3J A;  1RZE A;  5AMD A;  3NI5 A;  1TEU X;  4QSB A;  1J9W A;  3M1K A;  3S8X A;  2EZ7 A;  4CNR A;  1BIC A;  3RZ0 B;  3EFT A;  5IPZ A;  5FDC A;  2CAB A;  3S72 B;  5C8I A;  4MDM A;  1BNW A;  1YDA A;  3TVO X;  2HD6 A;  2CBC A;  3K7K A;  3NB5 A;  1FQM A;  2FW4 A;  3MDZ A;  2GEH A;  5E5U A;  1DCB A;  4QK3 A;  3U7C A;  5DSM A;  4L5V A;  3CZV A;  3V7X A;  3U3A X;  3PJJ A;  4R59 A;  4Q8Y A;  3T82 A;  1BNN A;  3S77 B;  5JDV B;  3HS4 A;  2NWO A;  3IBN A;  1V9I C;  3KOI A;  4QJX A;  4YVY A;  5EOI A;  4Q07 A;  5DVX A;  4WUP A;  1JD0 A;  4E3G A;  1OQ5 A;  5AMG A;  3KIG A;  2CBB A;  2HNC A;  3N2P A;  4FVO A;  3MNU A;  1TEQ X;  4DZ9 A;  1HCB A;  1CAZ A;  4G7A A;  3M2X A;  4R5B A;  2FMZ A;  3M1W A;  4RN4 A;  3MHM A;  1FR4 A;  4QIY A;  2WEJ A;  1BN1 A;  4N0X B;  3M14 A;  3L14 A;  5DSO A;  1YO0 A;  4YGK A;  5SZ1 A;  1RZA A;  5BYI A;  3KS3 A;  5CAC A;  2X7S A;  4K0Z A;  3S97 A;  1BNT A;  3OY0 A;  2FOS A;  1RZB A;  3MYQ A;  4IWZ A;  1G53 A;  3M3X A;  4KNJ A;  4RIU A;  3RZ1 B;  4K13 A;  3D92 A;  1CZM A;  3PO6 A;  1KOP A;  5JEP B;  1UGF A;  3S9T A;  3DCS A;  3V2J A;  5EKJ A;  3HKN A;  4QSJ A;  3M1Q A;  1LZV A;  4YGJ A;  3BL0 A;  1IF5 A;  4BF1 A;  4ZX0 A;  4M2V A;  3MHI A;  4YWP A;  1RJ5 A;  3MHC A;  5SZ5 A;  2HL4 A;  4KUW A;  3MZC A;  5EH7 A;  4YGL A;  5JGT B;  3DCW A;  1G4O A;  3M67 A;  3T83 A;  1CCS A;  3KON A;  4Q0L A;  4COQ A;  3D93 A;  1Y7W A;  5FLR A;  3IGP A;  3DBU A;  4PYX A;  4Z0Q A;  4ITP A;  3DC3 A;  2WEH A;  3FFP X;  5E2K A;  3RYJ B;  3W6H A;  2NWZ A;  4CNW A;  2QP6 A;  5EIJ A;  4QK2 A;  3P5A A;  2F14 A;  3DVC A;  4PXX A;  4Q7W A;  1UGB A;  5JES B;  2NNS A;  3SAP A;  4YGN A;  5E2R A;  4UOV A;  4E5Q A; 
#chains in the Genus database with same CATH topology
 5FNH A;  3RZ8 A;  3D9Z A;  3M1J A;  5DSQ A;  5SZ3 A;  5BRU A;  4RUZ A;  5DOG A;  4RFC A;  4E49 A;  5JG5 B;  1CAK A;  2NXT A;  4FVN A;  3OIK A;  5AML A;  4CA2 A;  1RZD A;  4CNV A;  4Q78 A;  1I91 A;  4RH2 A;  3RYY A;  4Z1E A;  2NNG A;  3OKV A;  4K1Q A;  4QTL A;  4ETQ C;  3JXH C;  3MNK A;  1CVH A;  3MHO A;  3DVD A;  5FNJ A;  2Q1B A;  1H9N A;  4MLT A;  3CAJ A;  7CA2 A;  3S75 B;  5DSP A;  5CA2 A;  1TTM A;  3GZ0 A;  2HKK A;  3BET A;  1FLJ A;  2POU A;  1CA2 A;  3KWA A;  2AX2 A;  3T5Z A;  5FLQ A;  3UYQ A;  3B4F A;  1CA3 A;  4GL1 X;  4FU5 A;  4KUV A;  2FOV A;  3ML5 A;  5DSN A;  1ZSA A;  1TG9 A;  5FLS A;  1IF9 A;  1HUG A;  3BL1 A;  3M5T A;  1YDB A;  4Q8X A;  2FNK A;  1XEV A;  1LG5 A;  4N16 A;  4XIX A;  3IBU A;  3RG4 A;  4XIW A;  2FOY A;  4K0T A;  2NN1 A;  5JG3 B;  3V3I B;  1JCZ A;  5BRW A;  3MNI A;  5CJF A;  2NMX A;  4MO8 A;  4PQ7 A;  1BNU A;  3CYU A;  3MNH A;  4QY3 A;  3DV7 A;  1TH9 A;  2CBD A;  4M2U A;  2NXS A;  2VVB X;  1AZM A;  3ML2 A;  4ILX A;  4Z1J A;  3F7U A;  1FR7 A;  3M04 A;  3M5S A;  4JSA A;  3OIL A;  5JGS B;  5SZ2 A;  5E5R A;  3KLD B;  1CVD A;  1CVC A;  4ZWI A;  3M2Z A;  4M2W A;  3F8E A;  5DSR A;  2W2J A;  2ABE A;  4Q49 A;  4E3H A;  2WD3 A;  5DSJ A;  2OSF A;  3U45 X;  3UYN A;  5EKH A;  3HFP A;  5SZ7 A;  3JXG A;  3S76 A;  6CA2 A;  4JSZ A;  3MMF A;  3DA2 A;  1BN3 A;  1TG3 A;  1BV3 A;  5DOH A;  2WEG A;  4KNI A;  4Y0J A;  1T9N A;  1CAY A;  3FW3 A;  1F2W A;  1H4N A;  5JQ0 A;  1HCA A;  4CAC A;  2AW1 A;  2Q38 A;  4FL7 A;  1CVF A;  4LHI A;  4FPT A;  1CNG A;  1MOO A;  1ZSB A;  4RUX A;  5EHV A;  1TE3 X;  2X7U A;  1BZM A;  2X7T A;  3D8W A;  3M96 A;  3LXE A;  1OKL A;  1G6V A;  1DCA A;  4Q08 A;  5E2M A;  1IF4 A;  3S73 B;  4YXO A;  3R16 A;  1CAJ A;  5G01 A;  1UGD A;  2H4N A;  4Z1K A;  2HOC A;  12CA A;  5BRV A;  1CAN A;  3FE4 A;  5CLU A;  5FNI A;  1BNV A;  5EH5 A;  4HU1 A;  5J8Z A;  3MNA A;  3DAZ A;  4KNN A;  5EHW A;  4Z1N A;  4Q06 A;  1KOQ A;  1CIN A;  3DD0 A;  1DMX A;  4Q83 A;  1UGA A;  4HEW A;  3S74 B;  3V3G B;  1BCD A;  4PZH A;  4HBA A;  1I9P A;  4HT2 A;  3T5U A;  2POV A;  1A42 A;  1G52 A;  1RZC A;  4FRC A;  1HED A;  2NNV A;  2HFW A;  4ZWX A;  4MDG A;  4JS6 A;  1CNJ A;  3SBH A;  1CNK A;  3N0N A;  3RLD A;  1DMY A;  3DC9 A;  4JSS A;  1CIL A;  3RZ7 A;  4Q9Y A;  1RJ6 A;  4KAP A;  2H15 A;  3K2F A;  4Q09 A;  1Z9Y A;  5BNL A;  3HKT A;  3IBI A;  1CVA A;  4QK1 A;  5JEG B;  3KNE A;  4HT0 A;  4WL4 A;  5SZ6 A;  2NN7 A;  3KOK A;  1ZGF A;  3M5E A;  1LG6 A;  4HF3 A;  2WD2 A;  2NNO A;  1KWQ A;  4Q6D A;  4KUY A;  3HLJ A;  1BNM A;  5EKM A;  1JV0 A;  3ZP9 A;  5E2S A;  1CAO A;  1I9N A;  5DSK A;  2O4Z A;  4YXU A;  1FSN A;  2FNN A;  1LUG A;  2IT4 A;  1CCT A;  3IBL A;  1Z97 A;  4R5A A;  4WW6 A;  1CAL A;  3K34 A;  1G0F A;  4WR7 A;  4QJW A;  1ZSC A;  5JQT A;  5FNK A;  3NJ9 A;  3M2N A;  2FOQ A;  4IDR X;  4Q87 A;  4Q8Z A;  3JXF A;  1AM6 A;  1CNB A;  1G4J A;  4XZ5 A;  2FOU A;  3MWO A;  3RGE A;  1CAH A;  3OYS A;  5FL6 A;  2FMG A;  3MNJ A;  4QIZ A;  1CNC A;  5E2N A;  3QYK A;  3MHL A;  5FDI A;  1G54 A;  2NXR A;  4KV0 A;  5FLT A;  3TVN X;  1H9Q A;  2GD8 A;  8CA2 A;  4E4A A;  3M40 A;  3F4X A;  4QJO A;  3DCC A;  4XFW A;  4E3F A;  4RIV A;  3RYV B;  1ZGE A;  3T84 A;  1G46 A;  4Q81 A;  3P4V A;  4MDL A;  3HKQ A;  5A25 A;  5SZ4 A;  1CNH A;  4LU3 A;  1KEQ A;  4LP6 A;  3RYX B;  3CA2 A;  1CNX A;  1YO2 A;  1I9O A;  4TWL A;  3TMJ A;  2QOA A;  1CRM A;  1I8Z A;  3OKU A;  9CA2 A;  3S78 B;  1YDC A;  3P58 A;  1TBT X;  4RFD A;  3IAI A;  1XQ0 A;  1CAI A;  4HEY A;  1IF6 A;  4X5S A;  3R17 B;  5G0B A;  4E3D A;  3D0N A;  1BN4 A;  1ZE8 A;  5FLP A;  4DZ7 A;  4QJP A;  1XEG A;  1I90 A;  1G45 A;  5FNG A;  2QO8 A;  4Q99 A;  5HPJ A;  3RJ7 A;  3M98 A;  4L5W A;  1G48 A;  4KNM A;  1G3Z A;  4QJM A;  3U47 A;  5FL4 A;  4ZWZ A;  4K0S A;  5FNL A;  4C3T A;  4QSI A;  3OIM A;  3Q31 A;  3IEO A;  4WUQ A;  3SAX A;  1Z93 A;  4BF6 A;  4Q7S A;  1ZNC A;  3M2Y A;  2EU2 A;  4YHA A;  4MTY A;  4ZWY A;  4FIK A;  1YO1 A;  4HEZ A;  1LGD A;  4M2R A;  4YX4 A;  3KKX A;  4L5U A;  2POW A;  3OYQ A;  5L6K A;  1TB0 X;  3W6I A;  2FNM A;  4MLX A;  1CNI A;  1HEA A;  3V5G A;  1CNW A;  1V9E A;  4YGF A;  3P3H A;  5EH8 A;  4E9O X;  1ZH9 A;  4Q6E A;  5L3O A;  1UGG A;  1FQR A;  4Q7P A;  1HVA A;  5E28 A;  4QJ0 A;  4CQ0 A;  5SZ0 A;  1FQN A;  1KWR A;  4RUY A;  3RYZ A;  3PYK A;  4Q90 A;  4ZX1 A;  3RG3 A;  2NWP A;  5DSI A;  5FLO A;  5EHE A;  1CIM A;  3C7P A;  2ILI A;  1I9M A;  1CVE A;  1G1D A;  1UGE A;  1XPZ A;  1UGC A;  1URT A;  1RAZ A;  5EZT X;  5LMD A;  3RZ5 A;  4QEF A;  3V3F A;  1CCU A;  2CA2 A;  2Q1Q A;  4BCW A;  3P44 A;  4PYY A;  3V2M A;  4ZAO A;  2CBE A;  2OSM A;  5G03 A;  4ITO A;  1G0E A;  5FL5 A;  1IF7 A;  3SBI A;  5DRS A;  4KP8 A;  3P55 A;  4XE1 A;  1FQL A;  5G0C A;  1HEC A;  1RAY A;  1MUA A;  1I9Q A;  1I9L A;  3N4B A;  1OKN A;  1HUH A;  3EFI A;  3ZNC A;  1ZFQ A;  3P5L A;  1ZFK A;  1AVN A;  4Q7V A;  5DSL A;  3S71 B;  2NWY A;  1HEB A;  1CVB A;  1EOU A;  3DD8 A;  3HKU A;  4CNX A;  5FNM A;  3V3H B;  3F7B A;  1YDD A;  3V3J A;  4KP5 A;  1FSQ A;  1IF8 A;  1OKM A;  3N3J A;  2EU3 A;  5A6H A;  3B1B A;  2ZNC A;  2VVA X;  4G0C A;  4QSA A;  5JEH B;  4YXI A;  2WEO A;  4TWM A;  1CRA A;  4JSW A;  4WW8 A;  1BNQ A;  2CBA A;  3T85 A;  4YYT A;  3VBD A;  1CNY A;  1THK A;  3DVB A;  1CAM A;  1FSR A;  3P3J A;  1RZE A;  5AMD A;  3NI5 A;  1TEU X;  4QSB A;  1J9W A;  3M1K A;  3S8X A;  2EZ7 A;  4CNR A;  1BIC A;  3RZ0 B;  3EFT A;  5IPZ A;  5FDC A;  2CAB A;  3S72 B;  5C8I A;  4MDM A;  1BNW A;  1YDA A;  3TVO X;  2HD6 A;  2CBC A;  3K7K A;  3NB5 A;  1FQM A;  2FW4 A;  3MDZ A;  2GEH A;  5E5U A;  1DCB A;  4QK3 A;  3U7C A;  5DSM A;  4L5V A;  3CZV A;  3V7X A;  3U3A X;  3PJJ A;  4R59 A;  4Q8Y A;  3T82 A;  1BNN A;  3S77 B;  5JDV B;  3HS4 A;  2NWO A;  3IBN A;  1V9I C;  3KOI A;  4QJX A;  4YVY A;  5EOI A;  4Q07 A;  5DVX A;  4WUP A;  1JD0 A;  4E3G A;  1OQ5 A;  5AMG A;  3KIG A;  2CBB A;  2HNC A;  3N2P A;  4FVO A;  3MNU A;  1TEQ X;  4DZ9 A;  1HCB A;  1CAZ A;  4G7A A;  3M2X A;  4R5B A;  2FMZ A;  3M1W A;  4RN4 A;  3MHM A;  1FR4 A;  4QIY A;  2WEJ A;  1BN1 A;  4N0X B;  3M14 A;  3L14 A;  5DSO A;  1YO0 A;  4YGK A;  5SZ1 A;  1RZA A;  5BYI A;  3KS3 A;  5CAC A;  2X7S A;  4K0Z A;  3S97 A;  1BNT A;  3OY0 A;  2FOS A;  1RZB A;  3MYQ A;  4IWZ A;  1G53 A;  3M3X A;  4KNJ A;  4RIU A;  3RZ1 B;  4K13 A;  3D92 A;  1CZM A;  3PO6 A;  1KOP A;  5JEP B;  1UGF A;  3S9T A;  3DCS A;  3V2J A;  5EKJ A;  3HKN A;  4QSJ A;  3M1Q A;  1LZV A;  4YGJ A;  3BL0 A;  1IF5 A;  4BF1 A;  4ZX0 A;  4M2V A;  3MHI A;  4YWP A;  1RJ5 A;  3MHC A;  5SZ5 A;  2HL4 A;  4KUW A;  3MZC A;  5EH7 A;  4YGL A;  5JGT B;  3DCW A;  1G4O A;  3M67 A;  3T83 A;  1CCS A;  3KON A;  4Q0L A;  4COQ A;  3D93 A;  1Y7W A;  5FLR A;  3IGP A;  3DBU A;  4PYX A;  4Z0Q A;  4ITP A;  3DC3 A;  2WEH A;  3FFP X;  5E2K A;  3RYJ B;  3W6H A;  2NWZ A;  4CNW A;  2QP6 A;  5EIJ A;  4QK2 A;  3P5A A;  2F14 A;  3DVC A;  4PXX A;  4Q7W A;  1UGB A;  5JES B;  2NNS A;  3SAP A;  4YGN A;  5E2R A;  4UOV A;  4E5Q A; 
#chains in the Genus database with same CATH homology
 5FNH A;  3RZ8 A;  3D9Z A;  3M1J A;  5DSQ A;  5SZ3 A;  5BRU A;  4RUZ A;  5DOG A;  4RFC A;  4E49 A;  5JG5 B;  1CAK A;  2NXT A;  4FVN A;  3OIK A;  5AML A;  4CA2 A;  1RZD A;  4CNV A;  4Q78 A;  1I91 A;  4RH2 A;  3RYY A;  4Z1E A;  2NNG A;  3OKV A;  4K1Q A;  4QTL A;  4ETQ C;  3JXH C;  3MNK A;  1CVH A;  3MHO A;  3DVD A;  5FNJ A;  2Q1B A;  1H9N A;  4MLT A;  3CAJ A;  7CA2 A;  3S75 B;  5DSP A;  5CA2 A;  1TTM A;  3GZ0 A;  2HKK A;  3BET A;  1FLJ A;  2POU A;  1CA2 A;  3KWA A;  2AX2 A;  3T5Z A;  5FLQ A;  3UYQ A;  3B4F A;  1CA3 A;  4GL1 X;  4FU5 A;  4KUV A;  2FOV A;  3ML5 A;  5DSN A;  1ZSA A;  1TG9 A;  5FLS A;  1IF9 A;  1HUG A;  3BL1 A;  3M5T A;  1YDB A;  4Q8X A;  2FNK A;  1XEV A;  1LG5 A;  4N16 A;  4XIX A;  3IBU A;  3RG4 A;  4XIW A;  2FOY A;  4K0T A;  2NN1 A;  5JG3 B;  3V3I B;  1JCZ A;  5BRW A;  3MNI A;  5CJF A;  2NMX A;  4MO8 A;  4PQ7 A;  1BNU A;  3CYU A;  3MNH A;  4QY3 A;  3DV7 A;  1TH9 A;  2CBD A;  4M2U A;  2NXS A;  2VVB X;  1AZM A;  3ML2 A;  4ILX A;  4Z1J A;  3F7U A;  1FR7 A;  3M04 A;  3M5S A;  4JSA A;  3OIL A;  5JGS B;  5SZ2 A;  5E5R A;  3KLD B;  1CVD A;  1CVC A;  4ZWI A;  3M2Z A;  4M2W A;  3F8E A;  5DSR A;  2W2J A;  2ABE A;  4Q49 A;  4E3H A;  2WD3 A;  5DSJ A;  2OSF A;  3U45 X;  3UYN A;  5EKH A;  3HFP A;  5SZ7 A;  3JXG A;  3S76 A;  6CA2 A;  4JSZ A;  3MMF A;  3DA2 A;  1BN3 A;  1TG3 A;  1BV3 A;  5DOH A;  2WEG A;  4KNI A;  4Y0J A;  1T9N A;  1CAY A;  3FW3 A;  1F2W A;  1H4N A;  5JQ0 A;  1HCA A;  4CAC A;  2AW1 A;  2Q38 A;  4FL7 A;  1CVF A;  4LHI A;  4FPT A;  1CNG A;  1MOO A;  1ZSB A;  4RUX A;  5EHV A;  1TE3 X;  2X7U A;  1BZM A;  2X7T A;  3D8W A;  3M96 A;  3LXE A;  1OKL A;  1G6V A;  1DCA A;  4Q08 A;  5E2M A;  1IF4 A;  3S73 B;  4YXO A;  3R16 A;  1CAJ A;  5G01 A;  1UGD A;  2H4N A;  4Z1K A;  2HOC A;  12CA A;  5BRV A;  1CAN A;  3FE4 A;  5CLU A;  5FNI A;  1BNV A;  5EH5 A;  4HU1 A;  5J8Z A;  3MNA A;  3DAZ A;  4KNN A;  5EHW A;  4Z1N A;  4Q06 A;  1KOQ A;  1CIN A;  3DD0 A;  1DMX A;  4Q83 A;  1UGA A;  4HEW A;  3S74 B;  3V3G B;  1BCD A;  4PZH A;  4HBA A;  1I9P A;  4HT2 A;  3T5U A;  2POV A;  1A42 A;  1G52 A;  1RZC A;  4FRC A;  1HED A;  2NNV A;  2HFW A;  4ZWX A;  4MDG A;  4JS6 A;  1CNJ A;  3SBH A;  1CNK A;  3N0N A;  3RLD A;  1DMY A;  3DC9 A;  4JSS A;  1CIL A;  3RZ7 A;  4Q9Y A;  1RJ6 A;  4KAP A;  2H15 A;  3K2F A;  4Q09 A;  1Z9Y A;  5BNL A;  3HKT A;  3IBI A;  1CVA A;  4QK1 A;  5JEG B;  3KNE A;  4HT0 A;  4WL4 A;  5SZ6 A;  2NN7 A;  3KOK A;  1ZGF A;  3M5E A;  1LG6 A;  4HF3 A;  2WD2 A;  2NNO A;  1KWQ A;  4Q6D A;  4KUY A;  3HLJ A;  1BNM A;  5EKM A;  1JV0 A;  3ZP9 A;  5E2S A;  1CAO A;  1I9N A;  5DSK A;  2O4Z A;  4YXU A;  1FSN A;  2FNN A;  1LUG A;  2IT4 A;  1CCT A;  3IBL A;  1Z97 A;  4R5A A;  4WW6 A;  1CAL A;  3K34 A;  1G0F A;  4WR7 A;  4QJW A;  1ZSC A;  5JQT A;  5FNK A;  3NJ9 A;  3M2N A;  2FOQ A;  4IDR X;  4Q87 A;  4Q8Z A;  3JXF A;  1AM6 A;  1CNB A;  1G4J A;  4XZ5 A;  2FOU A;  3MWO A;  3RGE A;  1CAH A;  3OYS A;  5FL6 A;  2FMG A;  3MNJ A;  4QIZ A;  1CNC A;  5E2N A;  3QYK A;  3MHL A;  5FDI A;  1G54 A;  2NXR A;  4KV0 A;  5FLT A;  3TVN X;  1H9Q A;  2GD8 A;  8CA2 A;  4E4A A;  3M40 A;  3F4X A;  4QJO A;  3DCC A;  4XFW A;  4E3F A;  4RIV A;  3RYV B;  1ZGE A;  3T84 A;  1G46 A;  4Q81 A;  3P4V A;  4MDL A;  3HKQ A;  5A25 A;  5SZ4 A;  1CNH A;  4LU3 A;  1KEQ A;  4LP6 A;  3RYX B;  3CA2 A;  1CNX A;  1YO2 A;  1I9O A;  4TWL A;  3TMJ A;  2QOA A;  1CRM A;  1I8Z A;  3OKU A;  9CA2 A;  3S78 B;  1YDC A;  3P58 A;  1TBT X;  4RFD A;  3IAI A;  1XQ0 A;  1CAI A;  4HEY A;  1IF6 A;  4X5S A;  3R17 B;  5G0B A;  4E3D A;  3D0N A;  1BN4 A;  1ZE8 A;  5FLP A;  4DZ7 A;  4QJP A;  1XEG A;  1I90 A;  1G45 A;  5FNG A;  2QO8 A;  4Q99 A;  5HPJ A;  3RJ7 A;  3M98 A;  4L5W A;  1G48 A;  4KNM A;  1G3Z A;  4QJM A;  3U47 A;  5FL4 A;  4ZWZ A;  4K0S A;  5FNL A;  4C3T A;  4QSI A;  3OIM A;  3Q31 A;  3IEO A;  4WUQ A;  3SAX A;  1Z93 A;  4BF6 A;  4Q7S A;  1ZNC A;  3M2Y A;  2EU2 A;  4YHA A;  4MTY A;  4ZWY A;  4FIK A;  1YO1 A;  4HEZ A;  1LGD A;  4M2R A;  4YX4 A;  3KKX A;  4L5U A;  2POW A;  3OYQ A;  5L6K A;  1TB0 X;  3W6I A;  2FNM A;  4MLX A;  1CNI A;  1HEA A;  3V5G A;  1CNW A;  1V9E A;  4YGF A;  3P3H A;  5EH8 A;  4E9O X;  1ZH9 A;  4Q6E A;  5L3O A;  1UGG A;  1FQR A;  4Q7P A;  1HVA A;  5E28 A;  4QJ0 A;  4CQ0 A;  5SZ0 A;  1FQN A;  1KWR A;  4RUY A;  3RYZ A;  3PYK A;  4Q90 A;  4ZX1 A;  3RG3 A;  2NWP A;  5DSI A;  5FLO A;  5EHE A;  1CIM A;  3C7P A;  2ILI A;  1I9M A;  1CVE A;  1G1D A;  1UGE A;  1XPZ A;  1UGC A;  1URT A;  1RAZ A;  5EZT X;  5LMD A;  3RZ5 A;  4QEF A;  3V3F A;  1CCU A;  2CA2 A;  2Q1Q A;  4BCW A;  3P44 A;  4PYY A;  3V2M A;  4ZAO A;  2CBE A;  2OSM A;  5G03 A;  4ITO A;  1G0E A;  5FL5 A;  1IF7 A;  3SBI A;  5DRS A;  4KP8 A;  3P55 A;  4XE1 A;  1FQL A;  5G0C A;  1HEC A;  1RAY A;  1MUA A;  1I9Q A;  1I9L A;  3N4B A;  1OKN A;  1HUH A;  3EFI A;  3ZNC A;  1ZFQ A;  3P5L A;  1ZFK A;  1AVN A;  4Q7V A;  5DSL A;  3S71 B;  2NWY A;  1HEB A;  1CVB A;  1EOU A;  3DD8 A;  3HKU A;  4CNX A;  5FNM A;  3V3H B;  3F7B A;  1YDD A;  3V3J A;  4KP5 A;  1FSQ A;  1IF8 A;  1OKM A;  3N3J A;  2EU3 A;  5A6H A;  3B1B A;  2ZNC A;  2VVA X;  4G0C A;  4QSA A;  5JEH B;  4YXI A;  2WEO A;  4TWM A;  1CRA A;  4JSW A;  4WW8 A;  1BNQ A;  2CBA A;  3T85 A;  4YYT A;  3VBD A;  1CNY A;  1THK A;  3DVB A;  1CAM A;  1FSR A;  3P3J A;  1RZE A;  5AMD A;  3NI5 A;  1TEU X;  4QSB A;  1J9W A;  3M1K A;  3S8X A;  2EZ7 A;  4CNR A;  1BIC A;  3RZ0 B;  3EFT A;  5IPZ A;  5FDC A;  2CAB A;  3S72 B;  5C8I A;  4MDM A;  1BNW A;  1YDA A;  3TVO X;  2HD6 A;  2CBC A;  3K7K A;  3NB5 A;  1FQM A;  2FW4 A;  3MDZ A;  2GEH A;  5E5U A;  1DCB A;  4QK3 A;  3U7C A;  5DSM A;  4L5V A;  3CZV A;  3V7X A;  3U3A X;  3PJJ A;  4R59 A;  4Q8Y A;  3T82 A;  1BNN A;  3S77 B;  5JDV B;  3HS4 A;  2NWO A;  3IBN A;  1V9I C;  3KOI A;  4QJX A;  4YVY A;  5EOI A;  4Q07 A;  5DVX A;  4WUP A;  1JD0 A;  4E3G A;  1OQ5 A;  5AMG A;  3KIG A;  2CBB A;  2HNC A;  3N2P A;  4FVO A;  3MNU A;  1TEQ X;  4DZ9 A;  1HCB A;  1CAZ A;  4G7A A;  3M2X A;  4R5B A;  2FMZ A;  3M1W A;  4RN4 A;  3MHM A;  1FR4 A;  4QIY A;  2WEJ A;  1BN1 A;  4N0X B;  3M14 A;  3L14 A;  5DSO A;  1YO0 A;  4YGK A;  5SZ1 A;  1RZA A;  5BYI A;  3KS3 A;  5CAC A;  2X7S A;  4K0Z A;  3S97 A;  1BNT A;  3OY0 A;  2FOS A;  1RZB A;  3MYQ A;  4IWZ A;  1G53 A;  3M3X A;  4KNJ A;  4RIU A;  3RZ1 B;  4K13 A;  3D92 A;  1CZM A;  3PO6 A;  1KOP A;  5JEP B;  1UGF A;  3S9T A;  3DCS A;  3V2J A;  5EKJ A;  3HKN A;  4QSJ A;  3M1Q A;  1LZV A;  4YGJ A;  3BL0 A;  1IF5 A;  4BF1 A;  4ZX0 A;  4M2V A;  3MHI A;  4YWP A;  1RJ5 A;  3MHC A;  5SZ5 A;  2HL4 A;  4KUW A;  3MZC A;  5EH7 A;  4YGL A;  5JGT B;  3DCW A;  1G4O A;  3M67 A;  3T83 A;  1CCS A;  3KON A;  4Q0L A;  4COQ A;  3D93 A;  1Y7W A;  5FLR A;  3IGP A;  3DBU A;  4PYX A;  4Z0Q A;  4ITP A;  3DC3 A;  2WEH A;  3FFP X;  5E2K A;  3RYJ B;  3W6H A;  2NWZ A;  4CNW A;  2QP6 A;  5EIJ A;  4QK2 A;  3P5A A;  2F14 A;  3DVC A;  4PXX A;  4Q7W A;  1UGB A;  5JES B;  2NNS A;  3SAP A;  4YGN A;  5E2R A;  4UOV A;  4E5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...