3FW3A

Crystal structure of soluble domain of ca4 in complex with dorzolamide
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
Knots found
sequence length
262
structure length
249
Chain Sequence
WCYEVQAESSNCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 4
publication title Thioether benzenesulfonamide inhibitors of carbonic anhydrases II and IV: structure-based drug design, synthesis, and biological evaluation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 66
structure length 249
sequence length 262
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3fw3A00
4YGFA 3S77B 1DMXA 3V2JA 4YGNA 4KNNA 3KONA 4Q7WA 1CZMA 1HVAA 2CBAA 4CNWA 1CNHA 4WUPA 4ITPA 1CAJA 3K2FA 5JDVB 1G0FA 5CACA 5EH5A 5IPZA 2FOVA 3M5SA 4QK2A 2X7TA 3KS3A 2X7UA 1BN3A 2ABEA 3OIKA 1Z93A 4CNXA 5FL4A 3M1KA 3P44A 3V7XA 4RIUA 1DCAA 1RZCA 3S76A 4IDRX 4MDGA 4TWLA 4QJPA 5FLPA 5DSKA 4ZWYA 1BNQA 1IF6A 1V9EA 3BETA 1G3ZA 2Q1BA 1FLJA 1CVEA 1MOOA 4BCWA 3RYVB 4G0CA 4KNMA 1LG6A 4M2RA 4QTLA 5FNLA 4M2WA 3VBDA 5SZ3A 1AVNA 4Z1NA 2CBDA 1THKA 3M3XA 4HT0A 4YXIA 5A6HA 3U45X 1I9QA 3IBNA 3S72B 2X7SA 3RG3A 2WEOA 4QJXA 3IAIA 3K7KA 3DVBA 3V3IB 4QEFA 5DSJA 5DSLA 4Q8YA 5BRUA 4CNRA 1ZNCA 1CRMA 3EFIA 5JG5B 4N0XB 5FNMA 4WW6A 4CA2A 3PYKA 3T82A 5E5RA 3M2ZA 1TEUX 3MNAA 2WD2A 3V3HB 4XFWA 4K1QA 5DVXA 3MZCA 5SZ2A 4JSSA 4JSWA 3V5GA 1TG3A 2AX2A 3M98A 1CIMA 5FL5A 5L6KA 1MUAA 4WR7A 5E2SA 5AMDA 3PJJA 1FR4A 1BNUA 1YDDA 1BN4A 1RZDA 2EZ7A 5CJFA 3CZVA 5C8IA 2QOAA 1UGAA 2HNCA 3S9TA 1AZMA 1DCBA 1I90A 5FLQA 3IBIA 4L5VA 4KP8A 2GD8A 4E3HA 5DSPA 1UGCA 5FNKA 3SBIA 3V3JA 2NWYA 3MNUA 1HEDA 5FLSA 3M1JA 4PYXA 1I8ZA 5G01A 1LZVA 4XZ5A 1FSQA 1I9OA 4Q6DA 4M2VA 3KKXA 3KLDB 3UYNA 4HEYA 4Z1JA 3MWOA 1BZMA 3S97A 5EKHA 2HFWA 1V9IC 1UGBA 5JEPB 5SZ7A 2NXTA 3EFTA 3HKUA 1Y7WA 1G52A 2FOQA 1HCAA 2CA2A 3BL0A 1ZE8A 3MHMA 3FW3A 2NNVA 3OILA 3ML5A 3MNJA 5BNLA 3IBUA 4Q83A 1TTMA 4GL1X 5DOHA 1YO2A 1LUGA 3D8WA 4YHAA 2ILIA 1BICA 5FNGA 4G7AA 3D9ZA 4HT2A 4Q06A 4JS6A 1CNXA 4Q87A 5E5UA 1YDCA 3S78B 3RZ1B 3DBUA 4RUZA 5E2KA 5EKMA 4Q08A 3MNHA 5EKJA 1CINA 3DD8A 1TG9A 5EOIA 4MTYA 1ZFKA 3DD0A 3IEOA 4YWPA 4QSIA 3P58A 3W6HA 1CAOA 1FR7A 3W6IA 4YYTA 3IBLA 4ZWXA 5JGSB 1F2WA 5EHEA 1XQ0A 1FSNA 1CAIA 2H4NA 5CA2A 2POUA 2NXRA 4FVNA 2CABA 3GZ0A 1I9LA 3M2XA 4ETQC 3DCCA 2H15A 1BN1A 1CCTA 3DVCA 3MNIA 5DSNA 3F7BA 3ZP9A 1OKLA 4FU5A 3RG4A 5FNIA 1CANA 3RZ7A 3MHOA 4QSAA 5DSIA 2NN7A 3DCWA 1G48A 3RYZA 4R5AA 4DZ7A 1RZBA 2EU2A 2POWA 2NWPA 4R59A 1HEAA 3S74B 3M40A 1JD0A 2OSMA 4QIZA 4ILXA 1G4OA 1YDBA 4YVYA 3S71B 3TVNX 4E49A 4Z1KA 3M96A 2NN1A 4YGLA 1ZSBA 8CA2A 3OY0A 5SZ5A 1CAHA 3D0NA 3DAZA 1CNWA 4L5UA 4QSJA 3N0NA 4CACA 5FNJA 2FOUA 2WEJA 4E3GA 2FNKA 1CNIA 3CYUA 4QIYA 1ZSAA 1H4NA 3TVOX 2FMZA 1XEVA 3V2MA 4Q7PA 5G0BA 3RYYA 1KEQA 1I9NA 1YO0A 2Q38A 1EOUA 4Q9YA 1Z97A 3K34A 4MLXA 4QY3A 5DSRA 2FOSA 1KOQA 2ZNCA 5FLOA 4COQA 1YO1A 1G45A 1TE3X 3KWAA 3NI5A 1CNYA 1UGFA 4K0ZA 5BRWA 1CVBA 5BYIA 1CA2A 3RZ0B 3P4VA 3S75B 4QJWA 1UGEA 4E9OX 1RAZA 3V3FA 3P5AA 3CA2A 4RFDA 4ZWIA 5DSMA 1BNMA 2Q1QA 1RZEA 4HU1A 4Q6EA 4LP6A 3HS4A 4K0TA 1TH9A 4MLTA 3N3JA 5EZTX 4KNJA 5EIJA 3SAPA 3M1WA 4XE1A 5DOGA 5L3OA 4KP5A 1CVFA 3L14A 4HEZA 3V3GB 4QJOA 4E4AA 1JV0A 3HFPA 1IF9A 4KV0A 5AMLA 2NNSA 3U47A 3T5UA 5FLTA 1AM6A 5E2MA 1UGGA 3LXEA 1URTA 4RUYA 3QYKA 4JSAA 4YXOA 1JCZA 4WUQA 4MDLA 1FQNA 4YGKA 3U7CA 4PZHA 3MMFA 1I91A 3M2NA 4KNIA 1BNNA 4ITOA 4Q78A 4CNVA 3D92A 6CA2A 3DC3A 2FMGA 3MHIA 4KAPA 3S8XA 3RZ8A 4Q90A 4Q8XA 5SZ1A 2O4ZA 3FFPX 1CA3A 4MDMA 3M5EA 3T83A 3NJ9A 3KOKA 4YX4A 1RJ6A 5A25A 1RAYA 3PO6A 1UGDA 1G46A 4Q49A 4E3DA 3ZNCA 5JQTA 5G03A 4FL7A 3OYSA 5CLUA 2WEGA 4PQ7A 4QJMA 3P3JA 3R16A 4QK1A 1G0EA 4YGJA 3DCSA 4KUYA 3S73B 4IWZA 2NWZA 2NXSA 4RFCA 1G6VA 3RZ5A 5JGTB 2GEHA 1CNGA 4QJ0A 4FIKA 3N4BA 1ZH9A 3F7UA 4QK3A 5FDIA 1LGDA 5JG3B 3HLJA 5E2NA 5SZ4A 1BNTA 1BCDA 3RJ7A 3T85A 2EU3A 1FSRA 3M5TA 2VVAX 5LMDA 4LHIA 2AW1A 4N16A 5EHWA 1KOPA 3B4FA 3R17B 5DRSA 4Q0LA 1HECA 3HKNA 4FVOA 5SZ0A 3OKVA 3T84A 3M04A 9CA2A 4K0SA 2F14A 5DSOA 4JSZA 3M14A 5JQ0A 1IF8A 4C3TA 3UYQA 1I9MA 1ZGFA 1IF5A 3MYQA 3M1QA 1CNKA 5E28A 1TB0X 1TBTX 4UOVA 4XIWA 2NMXA 2HL4A 4QSBA 3OKUA 1CAYA 2FOYA 3JXGA 5FL6A 1CVDA 3JXHC 1CAKA 1YDAA 5DSQA 2OSFA 4RN4A 4BF6A 5EHVA 2VVBX 3F8EA 4RIVA 3U3AX 4KUWA 1T9NA 3KIGA 1I9PA 4Z1EA 3MHLA 4FPTA 4K13A 4FRCA 3DA2A 5JEGB 5G0CA 2WEHA 3MHCA 3HKTA 4PXXA 5EH8A 1FQLA 3OIMA 4BF1A 5AMGA 3MDZA 5EH7A 3N2PA 3C7PA 4HF3A 3BL1A 12CAA 1CNJA 4ZX1A 1CVHA 2FW4A 1CNBA 1G1DA 1RJ5A 4RUXA 3SBHA 2HOCA 3DC9A 3DVDA 4E5QA 1BNWA 4MO8A 1ZSCA 2WD3A 2NNOA 3NB5A 4HEWA 5FLRA 3P3HA 3M67A 2QO8A 1Z9YA 3D93A 2QP6A 1CCUA 2HKKA 3FE4A 4Q8ZA 4Q99A 4Y0JA 3OYQA 4DZ9A 3MNKA 1CRAA 1CVAA 4ZAOA 1CALA 3T5ZA 1IF4A 1KWRA 4XIXA 4Q7VA 1FQMA 5J8ZA 5FNHA 4M2UA 1A42A 3DV7A 5E2RA 1DMYA 4E3FA 3SAXA 1OKMA 1CCSA 4PYYA 1HCBA 4Q07A 4ZX0A 4Q7SA 1KWQA 2POVA 4CQ0A 2FNMA 5BRVA 1LG5A 4KUVA 4WW8A 1BNVA 1ZGEA 1FQRA 3P55A 3P5LA 1ZFQA 1G4JA 1OQ5A 1HUGA 4TWMA 1BV3A 3KOIA 1XPZA 2IT4A 3B1BA 4Q09A 5JEHB 1CAMA 3RYJB 4LU3A 5SZ6A 5FDCA 2CBEA 4RH2A 1H9QA 3Q31A 1G54A 3HKQA 2NNGA 4Z0QA 2CBCA 3RLDA 4R5BA 1CVCA 2NWOA 3ML2A 4X5SA 1XEGA 1OKNA 5JESB 5HPJA 3CAJA 4WL4A 3IGPA 1G53A 1RZAA 1CILA 1CNCA 3RGEA 1HEBA 2HD6A 1H9NA 3TMJA 3RYXB 3F4XA 4ZWZA 1HUHA 1TEQX 1J9WA 2CBBA 4HBAA 7CA2A 1CAZA 4L5WA 3KNEA 4YXUA 1IF7A 4Q81A 3JXFA 2W2JA 2FNNA 3M2YA
chains in the Genus database with same CATH superfamily
4YGFA 3S77B 1DMXA 3V2JA 4YGNA 4KNNA 3KONA 4Q7WA 1CZMA 1HVAA 2CBAA 4CNWA 1CNHA 4WUPA 4ITPA 1CAJA 3K2FA 5JDVB 1G0FA 5CACA 5EH5A 5IPZA 2FOVA 3M5SA 4QK2A 2X7TA 3KS3A 2X7UA 1BN3A 2ABEA 3OIKA 1Z93A 4CNXA 5FL4A 3M1KA 3P44A 3V7XA 4RIUA 1DCAA 1RZCA 3S76A 4IDRX 4MDGA 4TWLA 4QJPA 5FLPA 5DSKA 4ZWYA 1BNQA 1IF6A 1V9EA 3BETA 1G3ZA 2Q1BA 1FLJA 1CVEA 1MOOA 4BCWA 3RYVB 4G0CA 4KNMA 1LG6A 4M2RA 4QTLA 5FNLA 4M2WA 3VBDA 5SZ3A 1AVNA 4Z1NA 2CBDA 1THKA 3M3XA 4HT0A 4YXIA 5A6HA 3U45X 1I9QA 3IBNA 3S72B 2X7SA 3RG3A 2WEOA 4QJXA 3IAIA 3K7KA 3DVBA 3V3IB 4QEFA 5DSJA 5DSLA 4Q8YA 5BRUA 4CNRA 1ZNCA 1CRMA 3EFIA 5JG5B 4N0XB 5FNMA 4WW6A 4CA2A 3PYKA 3T82A 5E5RA 3M2ZA 1TEUX 3MNAA 2WD2A 3V3HB 4XFWA 4K1QA 5DVXA 3MZCA 5SZ2A 4JSSA 4JSWA 3V5GA 1TG3A 2AX2A 3M98A 1CIMA 5FL5A 5L6KA 1MUAA 4WR7A 5E2SA 5AMDA 3PJJA 1FR4A 1BNUA 1YDDA 1BN4A 1RZDA 2EZ7A 5CJFA 3CZVA 5C8IA 2QOAA 1UGAA 2HNCA 3S9TA 1AZMA 1DCBA 1I90A 5FLQA 3IBIA 4L5VA 4KP8A 2GD8A 4E3HA 5DSPA 1UGCA 5FNKA 3SBIA 3V3JA 2NWYA 3MNUA 1HEDA 5FLSA 3M1JA 4PYXA 1I8ZA 5G01A 1LZVA 4XZ5A 1FSQA 1I9OA 4Q6DA 4M2VA 3KKXA 3KLDB 3UYNA 4HEYA 4Z1JA 3MWOA 1BZMA 3S97A 5EKHA 2HFWA 1V9IC 1UGBA 5JEPB 5SZ7A 2NXTA 3EFTA 3HKUA 1Y7WA 1G52A 2FOQA 1HCAA 2CA2A 3BL0A 1ZE8A 3MHMA 3FW3A 2NNVA 3OILA 3ML5A 3MNJA 5BNLA 3IBUA 4Q83A 1TTMA 4GL1X 5DOHA 1YO2A 1LUGA 3D8WA 4YHAA 2ILIA 1BICA 5FNGA 4G7AA 3D9ZA 4HT2A 4Q06A 4JS6A 1CNXA 4Q87A 5E5UA 1YDCA 3S78B 3RZ1B 3DBUA 4RUZA 5E2KA 5EKMA 4Q08A 3MNHA 5EKJA 1CINA 3DD8A 1TG9A 5EOIA 4MTYA 1ZFKA 3DD0A 3IEOA 4YWPA 4QSIA 3P58A 3W6HA 1CAOA 1FR7A 3W6IA 4YYTA 3IBLA 4ZWXA 5JGSB 1F2WA 5EHEA 1XQ0A 1FSNA 1CAIA 2H4NA 5CA2A 2POUA 2NXRA 4FVNA 2CABA 3GZ0A 1I9LA 3M2XA 4ETQC 3DCCA 2H15A 1BN1A 1CCTA 3DVCA 3MNIA 5DSNA 3F7BA 3ZP9A 1OKLA 4FU5A 3RG4A 5FNIA 1CANA 3RZ7A 3MHOA 4QSAA 5DSIA 2NN7A 3DCWA 1G48A 3RYZA 4R5AA 4DZ7A 1RZBA 2EU2A 2POWA 2NWPA 4R59A 1HEAA 3S74B 3M40A 1JD0A 2OSMA 4QIZA 4ILXA 1G4OA 1YDBA 4YVYA 3S71B 3TVNX 4E49A 4Z1KA 3M96A 2NN1A 4YGLA 1ZSBA 8CA2A 3OY0A 5SZ5A 1CAHA 3D0NA 3DAZA 1CNWA 4L5UA 4QSJA 3N0NA 4CACA 5FNJA 2FOUA 2WEJA 4E3GA 2FNKA 1CNIA 3CYUA 4QIYA 1ZSAA 1H4NA 3TVOX 2FMZA 1XEVA 3V2MA 4Q7PA 5G0BA 3RYYA 1KEQA 1I9NA 1YO0A 2Q38A 1EOUA 4Q9YA 1Z97A 3K34A 4MLXA 4QY3A 5DSRA 2FOSA 1KOQA 2ZNCA 5FLOA 4COQA 1YO1A 1G45A 1TE3X 3KWAA 3NI5A 1CNYA 1UGFA 4K0ZA 5BRWA 1CVBA 5BYIA 1CA2A 3RZ0B 3P4VA 3S75B 4QJWA 1UGEA 4E9OX 1RAZA 3V3FA 3P5AA 3CA2A 4RFDA 4ZWIA 5DSMA 1BNMA 2Q1QA 1RZEA 4HU1A 4Q6EA 4LP6A 3HS4A 4K0TA 1TH9A 4MLTA 3N3JA 5EZTX 4KNJA 5EIJA 3SAPA 3M1WA 4XE1A 5DOGA 5L3OA 4KP5A 1CVFA 3L14A 4HEZA 3V3GB 4QJOA 4E4AA 1JV0A 3HFPA 1IF9A 4KV0A 5AMLA 2NNSA 3U47A 3T5UA 5FLTA 1AM6A 5E2MA 1UGGA 3LXEA 1URTA 4RUYA 3QYKA 4JSAA 4YXOA 1JCZA 4WUQA 4MDLA 1FQNA 4YGKA 3U7CA 4PZHA 3MMFA 1I91A 3M2NA 4KNIA 1BNNA 4ITOA 4Q78A 4CNVA 3D92A 6CA2A 3DC3A 2FMGA 3MHIA 4KAPA 3S8XA 3RZ8A 4Q90A 4Q8XA 5SZ1A 2O4ZA 3FFPX 1CA3A 4MDMA 3M5EA 3T83A 3NJ9A 3KOKA 4YX4A 1RJ6A 5A25A 1RAYA 3PO6A 1UGDA 1G46A 4Q49A 4E3DA 3ZNCA 5JQTA 5G03A 4FL7A 3OYSA 5CLUA 2WEGA 4PQ7A 4QJMA 3P3JA 3R16A 4QK1A 1G0EA 4YGJA 3DCSA 4KUYA 3S73B 4IWZA 2NWZA 2NXSA 4RFCA 1G6VA 3RZ5A 5JGTB 2GEHA 1CNGA 4QJ0A 4FIKA 3N4BA 1ZH9A 3F7UA 4QK3A 5FDIA 1LGDA 5JG3B 3HLJA 5E2NA 5SZ4A 1BNTA 1BCDA 3RJ7A 3T85A 2EU3A 1FSRA 3M5TA 2VVAX 5LMDA 4LHIA 2AW1A 4N16A 5EHWA 1KOPA 3B4FA 3R17B 5DRSA 4Q0LA 1HECA 3HKNA 4FVOA 5SZ0A 3OKVA 3T84A 3M04A 9CA2A 4K0SA 2F14A 5DSOA 4JSZA 3M14A 5JQ0A 1IF8A 4C3TA 3UYQA 1I9MA 1ZGFA 1IF5A 3MYQA 3M1QA 1CNKA 5E28A 1TB0X 1TBTX 4UOVA 4XIWA 2NMXA 2HL4A 4QSBA 3OKUA 1CAYA 2FOYA 3JXGA 5FL6A 1CVDA 3JXHC 1CAKA 1YDAA 5DSQA 2OSFA 4RN4A 4BF6A 5EHVA 2VVBX 3F8EA 4RIVA 3U3AX 4KUWA 1T9NA 3KIGA 1I9PA 4Z1EA 3MHLA 4FPTA 4K13A 4FRCA 3DA2A 5JEGB 5G0CA 2WEHA 3MHCA 3HKTA 4PXXA 5EH8A 1FQLA 3OIMA 4BF1A 5AMGA 3MDZA 5EH7A 3N2PA 3C7PA 4HF3A 3BL1A 12CAA 1CNJA 4ZX1A 1CVHA 2FW4A 1CNBA 1G1DA 1RJ5A 4RUXA 3SBHA 2HOCA 3DC9A 3DVDA 4E5QA 1BNWA 4MO8A 1ZSCA 2WD3A 2NNOA 3NB5A 4HEWA 5FLRA 3P3HA 3M67A 2QO8A 1Z9YA 3D93A 2QP6A 1CCUA 2HKKA 3FE4A 4Q8ZA 4Q99A 4Y0JA 3OYQA 4DZ9A 3MNKA 1CRAA 1CVAA 4ZAOA 1CALA 3T5ZA 1IF4A 1KWRA 4XIXA 4Q7VA 1FQMA 5J8ZA 5FNHA 4M2UA 1A42A 3DV7A 5E2RA 1DMYA 4E3FA 3SAXA 1OKMA 1CCSA 4PYYA 1HCBA 4Q07A 4ZX0A 4Q7SA 1KWQA 2POVA 4CQ0A 2FNMA 5BRVA 1LG5A 4KUVA 4WW8A 1BNVA 1ZGEA 1FQRA 3P55A 3P5LA 1ZFQA 1G4JA 1OQ5A 1HUGA 4TWMA 1BV3A 3KOIA 1XPZA 2IT4A 3B1BA 4Q09A 5JEHB 1CAMA 3RYJB 4LU3A 5SZ6A 5FDCA 2CBEA 4RH2A 1H9QA 3Q31A 1G54A 3HKQA 2NNGA 4Z0QA 2CBCA 3RLDA 4R5BA 1CVCA 2NWOA 3ML2A 4X5SA 1XEGA 1OKNA 5JESB 5HPJA 3CAJA 4WL4A 3IGPA 1G53A 1RZAA 1CILA 1CNCA 3RGEA 1HEBA 2HD6A 1H9NA 3TMJA 3RYXB 3F4XA 4ZWZA 1HUHA 1TEQX 1J9WA 2CBBA 4HBAA 7CA2A 1CAZA 4L5WA 3KNEA 4YXUA 1IF7A 4Q81A 3JXFA 2W2JA 2FNNA 3M2YA
chains in the Genus database with same CATH topology
4YGFA 3S77B 1DMXA 3V2JA 4YGNA 4KNNA 3KONA 4Q7WA 1CZMA 1HVAA 2CBAA 4CNWA 1CNHA 4WUPA 4ITPA 1CAJA 3K2FA 5JDVB 1G0FA 5CACA 5EH5A 5IPZA 2FOVA 3M5SA 4QK2A 2X7TA 3KS3A 2X7UA 1BN3A 2ABEA 3OIKA 1Z93A 4CNXA 5FL4A 3M1KA 3P44A 3V7XA 4RIUA 1DCAA 1RZCA 3S76A 4IDRX 4MDGA 4TWLA 4QJPA 5FLPA 5DSKA 4ZWYA 1BNQA 1IF6A 1V9EA 3BETA 1G3ZA 2Q1BA 1FLJA 1CVEA 1MOOA 4BCWA 3RYVB 4G0CA 4KNMA 1LG6A 4M2RA 4QTLA 5FNLA 4M2WA 3VBDA 5SZ3A 1AVNA 4Z1NA 2CBDA 1THKA 3M3XA 4HT0A 4YXIA 5A6HA 3U45X 1I9QA 3IBNA 3S72B 2X7SA 3RG3A 2WEOA 4QJXA 3IAIA 3K7KA 3DVBA 3V3IB 4QEFA 5DSJA 5DSLA 4Q8YA 5BRUA 4CNRA 1ZNCA 1CRMA 3EFIA 5JG5B 4N0XB 5FNMA 4WW6A 4CA2A 3PYKA 3T82A 5E5RA 3M2ZA 1TEUX 3MNAA 2WD2A 3V3HB 4XFWA 4K1QA 5DVXA 3MZCA 5SZ2A 4JSSA 4JSWA 3V5GA 1TG3A 2AX2A 3M98A 1CIMA 5FL5A 5L6KA 1MUAA 4WR7A 5E2SA 5AMDA 3PJJA 1FR4A 1BNUA 1YDDA 1BN4A 1RZDA 2EZ7A 5CJFA 3CZVA 5C8IA 2QOAA 1UGAA 2HNCA 3S9TA 1AZMA 1DCBA 1I90A 5FLQA 3IBIA 4L5VA 4KP8A 2GD8A 4E3HA 5DSPA 1UGCA 5FNKA 3SBIA 3V3JA 2NWYA 3MNUA 1HEDA 5FLSA 3M1JA 4PYXA 1I8ZA 5G01A 1LZVA 4XZ5A 1FSQA 1I9OA 4Q6DA 4M2VA 3KKXA 3KLDB 3UYNA 4HEYA 4Z1JA 3MWOA 1BZMA 3S97A 5EKHA 2HFWA 1V9IC 1UGBA 5JEPB 5SZ7A 2NXTA 3EFTA 3HKUA 1Y7WA 1G52A 2FOQA 1HCAA 2CA2A 3BL0A 1ZE8A 3MHMA 3FW3A 2NNVA 3OILA 3ML5A 3MNJA 5BNLA 3IBUA 4Q83A 1TTMA 4GL1X 5DOHA 1YO2A 1LUGA 3D8WA 4YHAA 2ILIA 1BICA 5FNGA 4G7AA 3D9ZA 4HT2A 4Q06A 4JS6A 1CNXA 4Q87A 5E5UA 1YDCA 3S78B 3RZ1B 3DBUA 4RUZA 5E2KA 5EKMA 4Q08A 3MNHA 5EKJA 1CINA 3DD8A 1TG9A 5EOIA 4MTYA 1ZFKA 3DD0A 3IEOA 4YWPA 4QSIA 3P58A 3W6HA 1CAOA 1FR7A 3W6IA 4YYTA 3IBLA 4ZWXA 5JGSB 1F2WA 5EHEA 1XQ0A 1FSNA 1CAIA 2H4NA 5CA2A 2POUA 2NXRA 4FVNA 2CABA 3GZ0A 1I9LA 3M2XA 4ETQC 3DCCA 2H15A 1BN1A 1CCTA 3DVCA 3MNIA 5DSNA 3F7BA 3ZP9A 1OKLA 4FU5A 3RG4A 5FNIA 1CANA 3RZ7A 3MHOA 4QSAA 5DSIA 2NN7A 3DCWA 1G48A 3RYZA 4R5AA 4DZ7A 1RZBA 2EU2A 2POWA 2NWPA 4R59A 1HEAA 3S74B 3M40A 1JD0A 2OSMA 4QIZA 4ILXA 1G4OA 1YDBA 4YVYA 3S71B 3TVNX 4E49A 4Z1KA 3M96A 2NN1A 4YGLA 1ZSBA 8CA2A 3OY0A 5SZ5A 1CAHA 3D0NA 3DAZA 1CNWA 4L5UA 4QSJA 3N0NA 4CACA 5FNJA 2FOUA 2WEJA 4E3GA 2FNKA 1CNIA 3CYUA 4QIYA 1ZSAA 1H4NA 3TVOX 2FMZA 1XEVA 3V2MA 4Q7PA 5G0BA 3RYYA 1KEQA 1I9NA 1YO0A 2Q38A 1EOUA 4Q9YA 1Z97A 3K34A 4MLXA 4QY3A 5DSRA 2FOSA 1KOQA 2ZNCA 5FLOA 4COQA 1YO1A 1G45A 1TE3X 3KWAA 3NI5A 1CNYA 1UGFA 4K0ZA 5BRWA 1CVBA 5BYIA 1CA2A 3RZ0B 3P4VA 3S75B 4QJWA 1UGEA 4E9OX 1RAZA 3V3FA 3P5AA 3CA2A 4RFDA 4ZWIA 5DSMA 1BNMA 2Q1QA 1RZEA 4HU1A 4Q6EA 4LP6A 3HS4A 4K0TA 1TH9A 4MLTA 3N3JA 5EZTX 4KNJA 5EIJA 3SAPA 3M1WA 4XE1A 5DOGA 5L3OA 4KP5A 1CVFA 3L14A 4HEZA 3V3GB 4QJOA 4E4AA 1JV0A 3HFPA 1IF9A 4KV0A 5AMLA 2NNSA 3U47A 3T5UA 5FLTA 1AM6A 5E2MA 1UGGA 3LXEA 1URTA 4RUYA 3QYKA 4JSAA 4YXOA 1JCZA 4WUQA 4MDLA 1FQNA 4YGKA 3U7CA 4PZHA 3MMFA 1I91A 3M2NA 4KNIA 1BNNA 4ITOA 4Q78A 4CNVA 3D92A 6CA2A 3DC3A 2FMGA 3MHIA 4KAPA 3S8XA 3RZ8A 4Q90A 4Q8XA 5SZ1A 2O4ZA 3FFPX 1CA3A 4MDMA 3M5EA 3T83A 3NJ9A 3KOKA 4YX4A 1RJ6A 5A25A 1RAYA 3PO6A 1UGDA 1G46A 4Q49A 4E3DA 3ZNCA 5JQTA 5G03A 4FL7A 3OYSA 5CLUA 2WEGA 4PQ7A 4QJMA 3P3JA 3R16A 4QK1A 1G0EA 4YGJA 3DCSA 4KUYA 3S73B 4IWZA 2NWZA 2NXSA 4RFCA 1G6VA 3RZ5A 5JGTB 2GEHA 1CNGA 4QJ0A 4FIKA 3N4BA 1ZH9A 3F7UA 4QK3A 5FDIA 1LGDA 5JG3B 3HLJA 5E2NA 5SZ4A 1BNTA 1BCDA 3RJ7A 3T85A 2EU3A 1FSRA 3M5TA 2VVAX 5LMDA 4LHIA 2AW1A 4N16A 5EHWA 1KOPA 3B4FA 3R17B 5DRSA 4Q0LA 1HECA 3HKNA 4FVOA 5SZ0A 3OKVA 3T84A 3M04A 9CA2A 4K0SA 2F14A 5DSOA 4JSZA 3M14A 5JQ0A 1IF8A 4C3TA 3UYQA 1I9MA 1ZGFA 1IF5A 3MYQA 3M1QA 1CNKA 5E28A 1TB0X 1TBTX 4UOVA 4XIWA 2NMXA 2HL4A 4QSBA 3OKUA 1CAYA 2FOYA 3JXGA 5FL6A 1CVDA 3JXHC 1CAKA 1YDAA 5DSQA 2OSFA 4RN4A 4BF6A 5EHVA 2VVBX 3F8EA 4RIVA 3U3AX 4KUWA 1T9NA 3KIGA 1I9PA 4Z1EA 3MHLA 4FPTA 4K13A 4FRCA 3DA2A 5JEGB 5G0CA 2WEHA 3MHCA 3HKTA 4PXXA 5EH8A 1FQLA 3OIMA 4BF1A 5AMGA 3MDZA 5EH7A 3N2PA 3C7PA 4HF3A 3BL1A 12CAA 1CNJA 4ZX1A 1CVHA 2FW4A 1CNBA 1G1DA 1RJ5A 4RUXA 3SBHA 2HOCA 3DC9A 3DVDA 4E5QA 1BNWA 4MO8A 1ZSCA 2WD3A 2NNOA 3NB5A 4HEWA 5FLRA 3P3HA 3M67A 2QO8A 1Z9YA 3D93A 2QP6A 1CCUA 2HKKA 3FE4A 4Q8ZA 4Q99A 4Y0JA 3OYQA 4DZ9A 3MNKA 1CRAA 1CVAA 4ZAOA 1CALA 3T5ZA 1IF4A 1KWRA 4XIXA 4Q7VA 1FQMA 5J8ZA 5FNHA 4M2UA 1A42A 3DV7A 5E2RA 1DMYA 4E3FA 3SAXA 1OKMA 1CCSA 4PYYA 1HCBA 4Q07A 4ZX0A 4Q7SA 1KWQA 2POVA 4CQ0A 2FNMA 5BRVA 1LG5A 4KUVA 4WW8A 1BNVA 1ZGEA 1FQRA 3P55A 3P5LA 1ZFQA 1G4JA 1OQ5A 1HUGA 4TWMA 1BV3A 3KOIA 1XPZA 2IT4A 3B1BA 4Q09A 5JEHB 1CAMA 3RYJB 4LU3A 5SZ6A 5FDCA 2CBEA 4RH2A 1H9QA 3Q31A 1G54A 3HKQA 2NNGA 4Z0QA 2CBCA 3RLDA 4R5BA 1CVCA 2NWOA 3ML2A 4X5SA 1XEGA 1OKNA 5JESB 5HPJA 3CAJA 4WL4A 3IGPA 1G53A 1RZAA 1CILA 1CNCA 3RGEA 1HEBA 2HD6A 1H9NA 3TMJA 3RYXB 3F4XA 4ZWZA 1HUHA 1TEQX 1J9WA 2CBBA 4HBAA 7CA2A 1CAZA 4L5WA 3KNEA 4YXUA 1IF7A 4Q81A 3JXFA 2W2JA 2FNNA 3M2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGF A;  3S77 B;  1DMX A;  3V2J A;  4YGN A;  4KNN A;  3KON A;  4Q7W A;  1CZM A;  1HVA A;  2CBA A;  4CNW A;  1CNH A;  4WUP A;  4ITP A;  1CAJ A;  3K2F A;  5JDV B;  1G0F A;  5CAC A;  5EH5 A;  5IPZ A;  2FOV A;  3M5S A;  4QK2 A;  2X7T A;  3KS3 A;  2X7U A;  1BN3 A;  2ABE A;  3OIK A;  1Z93 A;  4CNX A;  5FL4 A;  3M1K A;  3P44 A;  3V7X A;  4RIU A;  1DCA A;  1RZC A;  3S76 A;  4IDR X;  4MDG A;  4TWL A;  4QJP A;  5FLP A;  5DSK A;  4ZWY A;  1BNQ A;  1IF6 A;  1V9E A;  3BET A;  1G3Z A;  2Q1B A;  1FLJ A;  1CVE A;  1MOO A;  4BCW A;  3RYV B;  4G0C A;  4KNM A;  1LG6 A;  4M2R A;  4QTL A;  5FNL A;  4M2W A;  3VBD A;  5SZ3 A;  1AVN A;  4Z1N A;  2CBD A;  1THK A;  3M3X A;  4HT0 A;  4YXI A;  5A6H A;  3U45 X;  1I9Q A;  3IBN A;  3S72 B;  2X7S A;  3RG3 A;  2WEO A;  4QJX A;  3IAI A;  3K7K A;  3DVB A;  3V3I B;  4QEF A;  5DSJ A;  5DSL A;  4Q8Y A;  5BRU A;  4CNR A;  1ZNC A;  1CRM A;  3EFI A;  5JG5 B;  4N0X B;  5FNM A;  4WW6 A;  4CA2 A;  3PYK A;  3T82 A;  5E5R A;  3M2Z A;  1TEU X;  3MNA A;  2WD2 A;  3V3H B;  4XFW A;  4K1Q A;  5DVX A;  3MZC A;  5SZ2 A;  4JSS A;  4JSW A;  3V5G A;  1TG3 A;  2AX2 A;  3M98 A;  1CIM A;  5FL5 A;  5L6K A;  1MUA A;  4WR7 A;  5E2S A;  5AMD A;  3PJJ A;  1FR4 A;  1BNU A;  1YDD A;  1BN4 A;  1RZD A;  2EZ7 A;  5CJF A;  3CZV A;  5C8I A;  2QOA A;  1UGA A;  2HNC A;  3S9T A;  1AZM A;  1DCB A;  1I90 A;  5FLQ A;  3IBI A;  4L5V A;  4KP8 A;  2GD8 A;  4E3H A;  5DSP A;  1UGC A;  5FNK A;  3SBI A;  3V3J A;  2NWY A;  3MNU A;  1HED A;  5FLS A;  3M1J A;  4PYX A;  1I8Z A;  5G01 A;  1LZV A;  4XZ5 A;  1FSQ A;  1I9O A;  4Q6D A;  4M2V A;  3KKX A;  3KLD B;  3UYN A;  4HEY A;  4Z1J A;  3MWO A;  1BZM A;  3S97 A;  5EKH A;  2HFW A;  1V9I C;  1UGB A;  5JEP B;  5SZ7 A;  2NXT A;  3EFT A;  3HKU A;  1Y7W A;  1G52 A;  2FOQ A;  1HCA A;  2CA2 A;  3BL0 A;  1ZE8 A;  3MHM A;  3FW3 A;  2NNV A;  3OIL A;  3ML5 A;  3MNJ A;  5BNL A;  3IBU A;  4Q83 A;  1TTM A;  4GL1 X;  5DOH A;  1YO2 A;  1LUG A;  3D8W A;  4YHA A;  2ILI A;  1BIC A;  5FNG A;  4G7A A;  3D9Z A;  4HT2 A;  4Q06 A;  4JS6 A;  1CNX A;  4Q87 A;  5E5U A;  1YDC A;  3S78 B;  3RZ1 B;  3DBU A;  4RUZ A;  5E2K A;  5EKM A;  4Q08 A;  3MNH A;  5EKJ A;  1CIN A;  3DD8 A;  1TG9 A;  5EOI A;  4MTY A;  1ZFK A;  3DD0 A;  3IEO A;  4YWP A;  4QSI A;  3P58 A;  3W6H A;  1CAO A;  1FR7 A;  3W6I A;  4YYT A;  3IBL A;  4ZWX A;  5JGS B;  1F2W A;  5EHE A;  1XQ0 A;  1FSN A;  1CAI A;  2H4N A;  5CA2 A;  2POU A;  2NXR A;  4FVN A;  2CAB A;  3GZ0 A;  1I9L A;  3M2X A;  4ETQ C;  3DCC A;  2H15 A;  1BN1 A;  1CCT A;  3DVC A;  3MNI A;  5DSN A;  3F7B A;  3ZP9 A;  1OKL A;  4FU5 A;  3RG4 A;  5FNI A;  1CAN A;  3RZ7 A;  3MHO A;  4QSA A;  5DSI A;  2NN7 A;  3DCW A;  1G48 A;  3RYZ A;  4R5A A;  4DZ7 A;  1RZB A;  2EU2 A;  2POW A;  2NWP A;  4R59 A;  1HEA A;  3S74 B;  3M40 A;  1JD0 A;  2OSM A;  4QIZ A;  4ILX A;  1G4O A;  1YDB A;  4YVY A;  3S71 B;  3TVN X;  4E49 A;  4Z1K A;  3M96 A;  2NN1 A;  4YGL A;  1ZSB A;  8CA2 A;  3OY0 A;  5SZ5 A;  1CAH A;  3D0N A;  3DAZ A;  1CNW A;  4L5U A;  4QSJ A;  3N0N A;  4CAC A;  5FNJ A;  2FOU A;  2WEJ A;  4E3G A;  2FNK A;  1CNI A;  3CYU A;  4QIY A;  1ZSA A;  1H4N A;  3TVO X;  2FMZ A;  1XEV A;  3V2M A;  4Q7P A;  5G0B A;  3RYY A;  1KEQ A;  1I9N A;  1YO0 A;  2Q38 A;  1EOU A;  4Q9Y A;  1Z97 A;  3K34 A;  4MLX A;  4QY3 A;  5DSR A;  2FOS A;  1KOQ A;  2ZNC A;  5FLO A;  4COQ A;  1YO1 A;  1G45 A;  1TE3 X;  3KWA A;  3NI5 A;  1CNY A;  1UGF A;  4K0Z A;  5BRW A;  1CVB A;  5BYI A;  1CA2 A;  3RZ0 B;  3P4V A;  3S75 B;  4QJW A;  1UGE A;  4E9O X;  1RAZ A;  3V3F A;  3P5A A;  3CA2 A;  4RFD A;  4ZWI A;  5DSM A;  1BNM A;  2Q1Q A;  1RZE A;  4HU1 A;  4Q6E A;  4LP6 A;  3HS4 A;  4K0T A;  1TH9 A;  4MLT A;  3N3J A;  5EZT X;  4KNJ A;  5EIJ A;  3SAP A;  3M1W A;  4XE1 A;  5DOG A;  5L3O A;  4KP5 A;  1CVF A;  3L14 A;  4HEZ A;  3V3G B;  4QJO A;  4E4A A;  1JV0 A;  3HFP A;  1IF9 A;  4KV0 A;  5AML A;  2NNS A;  3U47 A;  3T5U A;  5FLT A;  1AM6 A;  5E2M A;  1UGG A;  3LXE A;  1URT A;  4RUY A;  3QYK A;  4JSA A;  4YXO A;  1JCZ A;  4WUQ A;  4MDL A;  1FQN A;  4YGK A;  3U7C A;  4PZH A;  3MMF A;  1I91 A;  3M2N A;  4KNI A;  1BNN A;  4ITO A;  4Q78 A;  4CNV A;  3D92 A;  6CA2 A;  3DC3 A;  2FMG A;  3MHI A;  4KAP A;  3S8X A;  3RZ8 A;  4Q90 A;  4Q8X A;  5SZ1 A;  2O4Z A;  3FFP X;  1CA3 A;  4MDM A;  3M5E A;  3T83 A;  3NJ9 A;  3KOK A;  4YX4 A;  1RJ6 A;  5A25 A;  1RAY A;  3PO6 A;  1UGD A;  1G46 A;  4Q49 A;  4E3D A;  3ZNC A;  5JQT A;  5G03 A;  4FL7 A;  3OYS A;  5CLU A;  2WEG A;  4PQ7 A;  4QJM A;  3P3J A;  3R16 A;  4QK1 A;  1G0E A;  4YGJ A;  3DCS A;  4KUY A;  3S73 B;  4IWZ A;  2NWZ A;  2NXS A;  4RFC A;  1G6V A;  3RZ5 A;  5JGT B;  2GEH A;  1CNG A;  4QJ0 A;  4FIK A;  3N4B A;  1ZH9 A;  3F7U A;  4QK3 A;  5FDI A;  1LGD A;  5JG3 B;  3HLJ A;  5E2N A;  5SZ4 A;  1BNT A;  1BCD A;  3RJ7 A;  3T85 A;  2EU3 A;  1FSR A;  3M5T A;  2VVA X;  5LMD A;  4LHI A;  2AW1 A;  4N16 A;  5EHW A;  1KOP A;  3B4F A;  3R17 B;  5DRS A;  4Q0L A;  1HEC A;  3HKN A;  4FVO A;  5SZ0 A;  3OKV A;  3T84 A;  3M04 A;  9CA2 A;  4K0S A;  2F14 A;  5DSO A;  4JSZ A;  3M14 A;  5JQ0 A;  1IF8 A;  4C3T A;  3UYQ A;  1I9M A;  1ZGF A;  1IF5 A;  3MYQ A;  3M1Q A;  1CNK A;  5E28 A;  1TB0 X;  1TBT X;  4UOV A;  4XIW A;  2NMX A;  2HL4 A;  4QSB A;  3OKU A;  1CAY A;  2FOY A;  3JXG A;  5FL6 A;  1CVD A;  3JXH C;  1CAK A;  1YDA A;  5DSQ A;  2OSF A;  4RN4 A;  4BF6 A;  5EHV A;  2VVB X;  3F8E A;  4RIV A;  3U3A X;  4KUW A;  1T9N A;  3KIG A;  1I9P A;  4Z1E A;  3MHL A;  4FPT A;  4K13 A;  4FRC A;  3DA2 A;  5JEG B;  5G0C A;  2WEH A;  3MHC A;  3HKT A;  4PXX A;  5EH8 A;  1FQL A;  3OIM A;  4BF1 A;  5AMG A;  3MDZ A;  5EH7 A;  3N2P A;  3C7P A;  4HF3 A;  3BL1 A;  12CA A;  1CNJ A;  4ZX1 A;  1CVH A;  2FW4 A;  1CNB A;  1G1D A;  1RJ5 A;  4RUX A;  3SBH A;  2HOC A;  3DC9 A;  3DVD A;  4E5Q A;  1BNW A;  4MO8 A;  1ZSC A;  2WD3 A;  2NNO A;  3NB5 A;  4HEW A;  5FLR A;  3P3H A;  3M67 A;  2QO8 A;  1Z9Y A;  3D93 A;  2QP6 A;  1CCU A;  2HKK A;  3FE4 A;  4Q8Z A;  4Q99 A;  4Y0J A;  3OYQ A;  4DZ9 A;  3MNK A;  1CRA A;  1CVA A;  4ZAO A;  1CAL A;  3T5Z A;  1IF4 A;  1KWR A;  4XIX A;  4Q7V A;  1FQM A;  5J8Z A;  5FNH A;  4M2U A;  1A42 A;  3DV7 A;  5E2R A;  1DMY A;  4E3F A;  3SAX A;  1OKM A;  1CCS A;  4PYY A;  1HCB A;  4Q07 A;  4ZX0 A;  4Q7S A;  1KWQ A;  2POV A;  4CQ0 A;  2FNM A;  5BRV A;  1LG5 A;  4KUV A;  4WW8 A;  1BNV A;  1ZGE A;  1FQR A;  3P55 A;  3P5L A;  1ZFQ A;  1G4J A;  1OQ5 A;  1HUG A;  4TWM A;  1BV3 A;  3KOI A;  1XPZ A;  2IT4 A;  3B1B A;  4Q09 A;  5JEH B;  1CAM A;  3RYJ B;  4LU3 A;  5SZ6 A;  5FDC A;  2CBE A;  4RH2 A;  1H9Q A;  3Q31 A;  1G54 A;  3HKQ A;  2NNG A;  4Z0Q A;  2CBC A;  3RLD A;  4R5B A;  1CVC A;  2NWO A;  3ML2 A;  4X5S A;  1XEG A;  1OKN A;  5JES B;  5HPJ A;  3CAJ A;  4WL4 A;  3IGP A;  1G53 A;  1RZA A;  1CIL A;  1CNC A;  3RGE A;  1HEB A;  2HD6 A;  1H9N A;  3TMJ A;  3RYX B;  3F4X A;  4ZWZ A;  1HUH A;  1TEQ X;  1J9W A;  2CBB A;  4HBA A;  7CA2 A;  1CAZ A;  4L5W A;  3KNE A;  4YXU A;  1IF7 A;  4Q81 A;  3JXF A;  2W2J A;  2FNN A;  3M2Y A; 
#chains in the Genus database with same CATH topology
 4YGF A;  3S77 B;  1DMX A;  3V2J A;  4YGN A;  4KNN A;  3KON A;  4Q7W A;  1CZM A;  1HVA A;  2CBA A;  4CNW A;  1CNH A;  4WUP A;  4ITP A;  1CAJ A;  3K2F A;  5JDV B;  1G0F A;  5CAC A;  5EH5 A;  5IPZ A;  2FOV A;  3M5S A;  4QK2 A;  2X7T A;  3KS3 A;  2X7U A;  1BN3 A;  2ABE A;  3OIK A;  1Z93 A;  4CNX A;  5FL4 A;  3M1K A;  3P44 A;  3V7X A;  4RIU A;  1DCA A;  1RZC A;  3S76 A;  4IDR X;  4MDG A;  4TWL A;  4QJP A;  5FLP A;  5DSK A;  4ZWY A;  1BNQ A;  1IF6 A;  1V9E A;  3BET A;  1G3Z A;  2Q1B A;  1FLJ A;  1CVE A;  1MOO A;  4BCW A;  3RYV B;  4G0C A;  4KNM A;  1LG6 A;  4M2R A;  4QTL A;  5FNL A;  4M2W A;  3VBD A;  5SZ3 A;  1AVN A;  4Z1N A;  2CBD A;  1THK A;  3M3X A;  4HT0 A;  4YXI A;  5A6H A;  3U45 X;  1I9Q A;  3IBN A;  3S72 B;  2X7S A;  3RG3 A;  2WEO A;  4QJX A;  3IAI A;  3K7K A;  3DVB A;  3V3I B;  4QEF A;  5DSJ A;  5DSL A;  4Q8Y A;  5BRU A;  4CNR A;  1ZNC A;  1CRM A;  3EFI A;  5JG5 B;  4N0X B;  5FNM A;  4WW6 A;  4CA2 A;  3PYK A;  3T82 A;  5E5R A;  3M2Z A;  1TEU X;  3MNA A;  2WD2 A;  3V3H B;  4XFW A;  4K1Q A;  5DVX A;  3MZC A;  5SZ2 A;  4JSS A;  4JSW A;  3V5G A;  1TG3 A;  2AX2 A;  3M98 A;  1CIM A;  5FL5 A;  5L6K A;  1MUA A;  4WR7 A;  5E2S A;  5AMD A;  3PJJ A;  1FR4 A;  1BNU A;  1YDD A;  1BN4 A;  1RZD A;  2EZ7 A;  5CJF A;  3CZV A;  5C8I A;  2QOA A;  1UGA A;  2HNC A;  3S9T A;  1AZM A;  1DCB A;  1I90 A;  5FLQ A;  3IBI A;  4L5V A;  4KP8 A;  2GD8 A;  4E3H A;  5DSP A;  1UGC A;  5FNK A;  3SBI A;  3V3J A;  2NWY A;  3MNU A;  1HED A;  5FLS A;  3M1J A;  4PYX A;  1I8Z A;  5G01 A;  1LZV A;  4XZ5 A;  1FSQ A;  1I9O A;  4Q6D A;  4M2V A;  3KKX A;  3KLD B;  3UYN A;  4HEY A;  4Z1J A;  3MWO A;  1BZM A;  3S97 A;  5EKH A;  2HFW A;  1V9I C;  1UGB A;  5JEP B;  5SZ7 A;  2NXT A;  3EFT A;  3HKU A;  1Y7W A;  1G52 A;  2FOQ A;  1HCA A;  2CA2 A;  3BL0 A;  1ZE8 A;  3MHM A;  3FW3 A;  2NNV A;  3OIL A;  3ML5 A;  3MNJ A;  5BNL A;  3IBU A;  4Q83 A;  1TTM A;  4GL1 X;  5DOH A;  1YO2 A;  1LUG A;  3D8W A;  4YHA A;  2ILI A;  1BIC A;  5FNG A;  4G7A A;  3D9Z A;  4HT2 A;  4Q06 A;  4JS6 A;  1CNX A;  4Q87 A;  5E5U A;  1YDC A;  3S78 B;  3RZ1 B;  3DBU A;  4RUZ A;  5E2K A;  5EKM A;  4Q08 A;  3MNH A;  5EKJ A;  1CIN A;  3DD8 A;  1TG9 A;  5EOI A;  4MTY A;  1ZFK A;  3DD0 A;  3IEO A;  4YWP A;  4QSI A;  3P58 A;  3W6H A;  1CAO A;  1FR7 A;  3W6I A;  4YYT A;  3IBL A;  4ZWX A;  5JGS B;  1F2W A;  5EHE A;  1XQ0 A;  1FSN A;  1CAI A;  2H4N A;  5CA2 A;  2POU A;  2NXR A;  4FVN A;  2CAB A;  3GZ0 A;  1I9L A;  3M2X A;  4ETQ C;  3DCC A;  2H15 A;  1BN1 A;  1CCT A;  3DVC A;  3MNI A;  5DSN A;  3F7B A;  3ZP9 A;  1OKL A;  4FU5 A;  3RG4 A;  5FNI A;  1CAN A;  3RZ7 A;  3MHO A;  4QSA A;  5DSI A;  2NN7 A;  3DCW A;  1G48 A;  3RYZ A;  4R5A A;  4DZ7 A;  1RZB A;  2EU2 A;  2POW A;  2NWP A;  4R59 A;  1HEA A;  3S74 B;  3M40 A;  1JD0 A;  2OSM A;  4QIZ A;  4ILX A;  1G4O A;  1YDB A;  4YVY A;  3S71 B;  3TVN X;  4E49 A;  4Z1K A;  3M96 A;  2NN1 A;  4YGL A;  1ZSB A;  8CA2 A;  3OY0 A;  5SZ5 A;  1CAH A;  3D0N A;  3DAZ A;  1CNW A;  4L5U A;  4QSJ A;  3N0N A;  4CAC A;  5FNJ A;  2FOU A;  2WEJ A;  4E3G A;  2FNK A;  1CNI A;  3CYU A;  4QIY A;  1ZSA A;  1H4N A;  3TVO X;  2FMZ A;  1XEV A;  3V2M A;  4Q7P A;  5G0B A;  3RYY A;  1KEQ A;  1I9N A;  1YO0 A;  2Q38 A;  1EOU A;  4Q9Y A;  1Z97 A;  3K34 A;  4MLX A;  4QY3 A;  5DSR A;  2FOS A;  1KOQ A;  2ZNC A;  5FLO A;  4COQ A;  1YO1 A;  1G45 A;  1TE3 X;  3KWA A;  3NI5 A;  1CNY A;  1UGF A;  4K0Z A;  5BRW A;  1CVB A;  5BYI A;  1CA2 A;  3RZ0 B;  3P4V A;  3S75 B;  4QJW A;  1UGE A;  4E9O X;  1RAZ A;  3V3F A;  3P5A A;  3CA2 A;  4RFD A;  4ZWI A;  5DSM A;  1BNM A;  2Q1Q A;  1RZE A;  4HU1 A;  4Q6E A;  4LP6 A;  3HS4 A;  4K0T A;  1TH9 A;  4MLT A;  3N3J A;  5EZT X;  4KNJ A;  5EIJ A;  3SAP A;  3M1W A;  4XE1 A;  5DOG A;  5L3O A;  4KP5 A;  1CVF A;  3L14 A;  4HEZ A;  3V3G B;  4QJO A;  4E4A A;  1JV0 A;  3HFP A;  1IF9 A;  4KV0 A;  5AML A;  2NNS A;  3U47 A;  3T5U A;  5FLT A;  1AM6 A;  5E2M A;  1UGG A;  3LXE A;  1URT A;  4RUY A;  3QYK A;  4JSA A;  4YXO A;  1JCZ A;  4WUQ A;  4MDL A;  1FQN A;  4YGK A;  3U7C A;  4PZH A;  3MMF A;  1I91 A;  3M2N A;  4KNI A;  1BNN A;  4ITO A;  4Q78 A;  4CNV A;  3D92 A;  6CA2 A;  3DC3 A;  2FMG A;  3MHI A;  4KAP A;  3S8X A;  3RZ8 A;  4Q90 A;  4Q8X A;  5SZ1 A;  2O4Z A;  3FFP X;  1CA3 A;  4MDM A;  3M5E A;  3T83 A;  3NJ9 A;  3KOK A;  4YX4 A;  1RJ6 A;  5A25 A;  1RAY A;  3PO6 A;  1UGD A;  1G46 A;  4Q49 A;  4E3D A;  3ZNC A;  5JQT A;  5G03 A;  4FL7 A;  3OYS A;  5CLU A;  2WEG A;  4PQ7 A;  4QJM A;  3P3J A;  3R16 A;  4QK1 A;  1G0E A;  4YGJ A;  3DCS A;  4KUY A;  3S73 B;  4IWZ A;  2NWZ A;  2NXS A;  4RFC A;  1G6V A;  3RZ5 A;  5JGT B;  2GEH A;  1CNG A;  4QJ0 A;  4FIK A;  3N4B A;  1ZH9 A;  3F7U A;  4QK3 A;  5FDI A;  1LGD A;  5JG3 B;  3HLJ A;  5E2N A;  5SZ4 A;  1BNT A;  1BCD A;  3RJ7 A;  3T85 A;  2EU3 A;  1FSR A;  3M5T A;  2VVA X;  5LMD A;  4LHI A;  2AW1 A;  4N16 A;  5EHW A;  1KOP A;  3B4F A;  3R17 B;  5DRS A;  4Q0L A;  1HEC A;  3HKN A;  4FVO A;  5SZ0 A;  3OKV A;  3T84 A;  3M04 A;  9CA2 A;  4K0S A;  2F14 A;  5DSO A;  4JSZ A;  3M14 A;  5JQ0 A;  1IF8 A;  4C3T A;  3UYQ A;  1I9M A;  1ZGF A;  1IF5 A;  3MYQ A;  3M1Q A;  1CNK A;  5E28 A;  1TB0 X;  1TBT X;  4UOV A;  4XIW A;  2NMX A;  2HL4 A;  4QSB A;  3OKU A;  1CAY A;  2FOY A;  3JXG A;  5FL6 A;  1CVD A;  3JXH C;  1CAK A;  1YDA A;  5DSQ A;  2OSF A;  4RN4 A;  4BF6 A;  5EHV A;  2VVB X;  3F8E A;  4RIV A;  3U3A X;  4KUW A;  1T9N A;  3KIG A;  1I9P A;  4Z1E A;  3MHL A;  4FPT A;  4K13 A;  4FRC A;  3DA2 A;  5JEG B;  5G0C A;  2WEH A;  3MHC A;  3HKT A;  4PXX A;  5EH8 A;  1FQL A;  3OIM A;  4BF1 A;  5AMG A;  3MDZ A;  5EH7 A;  3N2P A;  3C7P A;  4HF3 A;  3BL1 A;  12CA A;  1CNJ A;  4ZX1 A;  1CVH A;  2FW4 A;  1CNB A;  1G1D A;  1RJ5 A;  4RUX A;  3SBH A;  2HOC A;  3DC9 A;  3DVD A;  4E5Q A;  1BNW A;  4MO8 A;  1ZSC A;  2WD3 A;  2NNO A;  3NB5 A;  4HEW A;  5FLR A;  3P3H A;  3M67 A;  2QO8 A;  1Z9Y A;  3D93 A;  2QP6 A;  1CCU A;  2HKK A;  3FE4 A;  4Q8Z A;  4Q99 A;  4Y0J A;  3OYQ A;  4DZ9 A;  3MNK A;  1CRA A;  1CVA A;  4ZAO A;  1CAL A;  3T5Z A;  1IF4 A;  1KWR A;  4XIX A;  4Q7V A;  1FQM A;  5J8Z A;  5FNH A;  4M2U A;  1A42 A;  3DV7 A;  5E2R A;  1DMY A;  4E3F A;  3SAX A;  1OKM A;  1CCS A;  4PYY A;  1HCB A;  4Q07 A;  4ZX0 A;  4Q7S A;  1KWQ A;  2POV A;  4CQ0 A;  2FNM A;  5BRV A;  1LG5 A;  4KUV A;  4WW8 A;  1BNV A;  1ZGE A;  1FQR A;  3P55 A;  3P5L A;  1ZFQ A;  1G4J A;  1OQ5 A;  1HUG A;  4TWM A;  1BV3 A;  3KOI A;  1XPZ A;  2IT4 A;  3B1B A;  4Q09 A;  5JEH B;  1CAM A;  3RYJ B;  4LU3 A;  5SZ6 A;  5FDC A;  2CBE A;  4RH2 A;  1H9Q A;  3Q31 A;  1G54 A;  3HKQ A;  2NNG A;  4Z0Q A;  2CBC A;  3RLD A;  4R5B A;  1CVC A;  2NWO A;  3ML2 A;  4X5S A;  1XEG A;  1OKN A;  5JES B;  5HPJ A;  3CAJ A;  4WL4 A;  3IGP A;  1G53 A;  1RZA A;  1CIL A;  1CNC A;  3RGE A;  1HEB A;  2HD6 A;  1H9N A;  3TMJ A;  3RYX B;  3F4X A;  4ZWZ A;  1HUH A;  1TEQ X;  1J9W A;  2CBB A;  4HBA A;  7CA2 A;  1CAZ A;  4L5W A;  3KNE A;  4YXU A;  1IF7 A;  4Q81 A;  3JXF A;  2W2J A;  2FNN A;  3M2Y A; 
#chains in the Genus database with same CATH homology
 4YGF A;  3S77 B;  1DMX A;  3V2J A;  4YGN A;  4KNN A;  3KON A;  4Q7W A;  1CZM A;  1HVA A;  2CBA A;  4CNW A;  1CNH A;  4WUP A;  4ITP A;  1CAJ A;  3K2F A;  5JDV B;  1G0F A;  5CAC A;  5EH5 A;  5IPZ A;  2FOV A;  3M5S A;  4QK2 A;  2X7T A;  3KS3 A;  2X7U A;  1BN3 A;  2ABE A;  3OIK A;  1Z93 A;  4CNX A;  5FL4 A;  3M1K A;  3P44 A;  3V7X A;  4RIU A;  1DCA A;  1RZC A;  3S76 A;  4IDR X;  4MDG A;  4TWL A;  4QJP A;  5FLP A;  5DSK A;  4ZWY A;  1BNQ A;  1IF6 A;  1V9E A;  3BET A;  1G3Z A;  2Q1B A;  1FLJ A;  1CVE A;  1MOO A;  4BCW A;  3RYV B;  4G0C A;  4KNM A;  1LG6 A;  4M2R A;  4QTL A;  5FNL A;  4M2W A;  3VBD A;  5SZ3 A;  1AVN A;  4Z1N A;  2CBD A;  1THK A;  3M3X A;  4HT0 A;  4YXI A;  5A6H A;  3U45 X;  1I9Q A;  3IBN A;  3S72 B;  2X7S A;  3RG3 A;  2WEO A;  4QJX A;  3IAI A;  3K7K A;  3DVB A;  3V3I B;  4QEF A;  5DSJ A;  5DSL A;  4Q8Y A;  5BRU A;  4CNR A;  1ZNC A;  1CRM A;  3EFI A;  5JG5 B;  4N0X B;  5FNM A;  4WW6 A;  4CA2 A;  3PYK A;  3T82 A;  5E5R A;  3M2Z A;  1TEU X;  3MNA A;  2WD2 A;  3V3H B;  4XFW A;  4K1Q A;  5DVX A;  3MZC A;  5SZ2 A;  4JSS A;  4JSW A;  3V5G A;  1TG3 A;  2AX2 A;  3M98 A;  1CIM A;  5FL5 A;  5L6K A;  1MUA A;  4WR7 A;  5E2S A;  5AMD A;  3PJJ A;  1FR4 A;  1BNU A;  1YDD A;  1BN4 A;  1RZD A;  2EZ7 A;  5CJF A;  3CZV A;  5C8I A;  2QOA A;  1UGA A;  2HNC A;  3S9T A;  1AZM A;  1DCB A;  1I90 A;  5FLQ A;  3IBI A;  4L5V A;  4KP8 A;  2GD8 A;  4E3H A;  5DSP A;  1UGC A;  5FNK A;  3SBI A;  3V3J A;  2NWY A;  3MNU A;  1HED A;  5FLS A;  3M1J A;  4PYX A;  1I8Z A;  5G01 A;  1LZV A;  4XZ5 A;  1FSQ A;  1I9O A;  4Q6D A;  4M2V A;  3KKX A;  3KLD B;  3UYN A;  4HEY A;  4Z1J A;  3MWO A;  1BZM A;  3S97 A;  5EKH A;  2HFW A;  1V9I C;  1UGB A;  5JEP B;  5SZ7 A;  2NXT A;  3EFT A;  3HKU A;  1Y7W A;  1G52 A;  2FOQ A;  1HCA A;  2CA2 A;  3BL0 A;  1ZE8 A;  3MHM A;  3FW3 A;  2NNV A;  3OIL A;  3ML5 A;  3MNJ A;  5BNL A;  3IBU A;  4Q83 A;  1TTM A;  4GL1 X;  5DOH A;  1YO2 A;  1LUG A;  3D8W A;  4YHA A;  2ILI A;  1BIC A;  5FNG A;  4G7A A;  3D9Z A;  4HT2 A;  4Q06 A;  4JS6 A;  1CNX A;  4Q87 A;  5E5U A;  1YDC A;  3S78 B;  3RZ1 B;  3DBU A;  4RUZ A;  5E2K A;  5EKM A;  4Q08 A;  3MNH A;  5EKJ A;  1CIN A;  3DD8 A;  1TG9 A;  5EOI A;  4MTY A;  1ZFK A;  3DD0 A;  3IEO A;  4YWP A;  4QSI A;  3P58 A;  3W6H A;  1CAO A;  1FR7 A;  3W6I A;  4YYT A;  3IBL A;  4ZWX A;  5JGS B;  1F2W A;  5EHE A;  1XQ0 A;  1FSN A;  1CAI A;  2H4N A;  5CA2 A;  2POU A;  2NXR A;  4FVN A;  2CAB A;  3GZ0 A;  1I9L A;  3M2X A;  4ETQ C;  3DCC A;  2H15 A;  1BN1 A;  1CCT A;  3DVC A;  3MNI A;  5DSN A;  3F7B A;  3ZP9 A;  1OKL A;  4FU5 A;  3RG4 A;  5FNI A;  1CAN A;  3RZ7 A;  3MHO A;  4QSA A;  5DSI A;  2NN7 A;  3DCW A;  1G48 A;  3RYZ A;  4R5A A;  4DZ7 A;  1RZB A;  2EU2 A;  2POW A;  2NWP A;  4R59 A;  1HEA A;  3S74 B;  3M40 A;  1JD0 A;  2OSM A;  4QIZ A;  4ILX A;  1G4O A;  1YDB A;  4YVY A;  3S71 B;  3TVN X;  4E49 A;  4Z1K A;  3M96 A;  2NN1 A;  4YGL A;  1ZSB A;  8CA2 A;  3OY0 A;  5SZ5 A;  1CAH A;  3D0N A;  3DAZ A;  1CNW A;  4L5U A;  4QSJ A;  3N0N A;  4CAC A;  5FNJ A;  2FOU A;  2WEJ A;  4E3G A;  2FNK A;  1CNI A;  3CYU A;  4QIY A;  1ZSA A;  1H4N A;  3TVO X;  2FMZ A;  1XEV A;  3V2M A;  4Q7P A;  5G0B A;  3RYY A;  1KEQ A;  1I9N A;  1YO0 A;  2Q38 A;  1EOU A;  4Q9Y A;  1Z97 A;  3K34 A;  4MLX A;  4QY3 A;  5DSR A;  2FOS A;  1KOQ A;  2ZNC A;  5FLO A;  4COQ A;  1YO1 A;  1G45 A;  1TE3 X;  3KWA A;  3NI5 A;  1CNY A;  1UGF A;  4K0Z A;  5BRW A;  1CVB A;  5BYI A;  1CA2 A;  3RZ0 B;  3P4V A;  3S75 B;  4QJW A;  1UGE A;  4E9O X;  1RAZ A;  3V3F A;  3P5A A;  3CA2 A;  4RFD A;  4ZWI A;  5DSM A;  1BNM A;  2Q1Q A;  1RZE A;  4HU1 A;  4Q6E A;  4LP6 A;  3HS4 A;  4K0T A;  1TH9 A;  4MLT A;  3N3J A;  5EZT X;  4KNJ A;  5EIJ A;  3SAP A;  3M1W A;  4XE1 A;  5DOG A;  5L3O A;  4KP5 A;  1CVF A;  3L14 A;  4HEZ A;  3V3G B;  4QJO A;  4E4A A;  1JV0 A;  3HFP A;  1IF9 A;  4KV0 A;  5AML A;  2NNS A;  3U47 A;  3T5U A;  5FLT A;  1AM6 A;  5E2M A;  1UGG A;  3LXE A;  1URT A;  4RUY A;  3QYK A;  4JSA A;  4YXO A;  1JCZ A;  4WUQ A;  4MDL A;  1FQN A;  4YGK A;  3U7C A;  4PZH A;  3MMF A;  1I91 A;  3M2N A;  4KNI A;  1BNN A;  4ITO A;  4Q78 A;  4CNV A;  3D92 A;  6CA2 A;  3DC3 A;  2FMG A;  3MHI A;  4KAP A;  3S8X A;  3RZ8 A;  4Q90 A;  4Q8X A;  5SZ1 A;  2O4Z A;  3FFP X;  1CA3 A;  4MDM A;  3M5E A;  3T83 A;  3NJ9 A;  3KOK A;  4YX4 A;  1RJ6 A;  5A25 A;  1RAY A;  3PO6 A;  1UGD A;  1G46 A;  4Q49 A;  4E3D A;  3ZNC A;  5JQT A;  5G03 A;  4FL7 A;  3OYS A;  5CLU A;  2WEG A;  4PQ7 A;  4QJM A;  3P3J A;  3R16 A;  4QK1 A;  1G0E A;  4YGJ A;  3DCS A;  4KUY A;  3S73 B;  4IWZ A;  2NWZ A;  2NXS A;  4RFC A;  1G6V A;  3RZ5 A;  5JGT B;  2GEH A;  1CNG A;  4QJ0 A;  4FIK A;  3N4B A;  1ZH9 A;  3F7U A;  4QK3 A;  5FDI A;  1LGD A;  5JG3 B;  3HLJ A;  5E2N A;  5SZ4 A;  1BNT A;  1BCD A;  3RJ7 A;  3T85 A;  2EU3 A;  1FSR A;  3M5T A;  2VVA X;  5LMD A;  4LHI A;  2AW1 A;  4N16 A;  5EHW A;  1KOP A;  3B4F A;  3R17 B;  5DRS A;  4Q0L A;  1HEC A;  3HKN A;  4FVO A;  5SZ0 A;  3OKV A;  3T84 A;  3M04 A;  9CA2 A;  4K0S A;  2F14 A;  5DSO A;  4JSZ A;  3M14 A;  5JQ0 A;  1IF8 A;  4C3T A;  3UYQ A;  1I9M A;  1ZGF A;  1IF5 A;  3MYQ A;  3M1Q A;  1CNK A;  5E28 A;  1TB0 X;  1TBT X;  4UOV A;  4XIW A;  2NMX A;  2HL4 A;  4QSB A;  3OKU A;  1CAY A;  2FOY A;  3JXG A;  5FL6 A;  1CVD A;  3JXH C;  1CAK A;  1YDA A;  5DSQ A;  2OSF A;  4RN4 A;  4BF6 A;  5EHV A;  2VVB X;  3F8E A;  4RIV A;  3U3A X;  4KUW A;  1T9N A;  3KIG A;  1I9P A;  4Z1E A;  3MHL A;  4FPT A;  4K13 A;  4FRC A;  3DA2 A;  5JEG B;  5G0C A;  2WEH A;  3MHC A;  3HKT A;  4PXX A;  5EH8 A;  1FQL A;  3OIM A;  4BF1 A;  5AMG A;  3MDZ A;  5EH7 A;  3N2P A;  3C7P A;  4HF3 A;  3BL1 A;  12CA A;  1CNJ A;  4ZX1 A;  1CVH A;  2FW4 A;  1CNB A;  1G1D A;  1RJ5 A;  4RUX A;  3SBH A;  2HOC A;  3DC9 A;  3DVD A;  4E5Q A;  1BNW A;  4MO8 A;  1ZSC A;  2WD3 A;  2NNO A;  3NB5 A;  4HEW A;  5FLR A;  3P3H A;  3M67 A;  2QO8 A;  1Z9Y A;  3D93 A;  2QP6 A;  1CCU A;  2HKK A;  3FE4 A;  4Q8Z A;  4Q99 A;  4Y0J A;  3OYQ A;  4DZ9 A;  3MNK A;  1CRA A;  1CVA A;  4ZAO A;  1CAL A;  3T5Z A;  1IF4 A;  1KWR A;  4XIX A;  4Q7V A;  1FQM A;  5J8Z A;  5FNH A;  4M2U A;  1A42 A;  3DV7 A;  5E2R A;  1DMY A;  4E3F A;  3SAX A;  1OKM A;  1CCS A;  4PYY A;  1HCB A;  4Q07 A;  4ZX0 A;  4Q7S A;  1KWQ A;  2POV A;  4CQ0 A;  2FNM A;  5BRV A;  1LG5 A;  4KUV A;  4WW8 A;  1BNV A;  1ZGE A;  1FQR A;  3P55 A;  3P5L A;  1ZFQ A;  1G4J A;  1OQ5 A;  1HUG A;  4TWM A;  1BV3 A;  3KOI A;  1XPZ A;  2IT4 A;  3B1B A;  4Q09 A;  5JEH B;  1CAM A;  3RYJ B;  4LU3 A;  5SZ6 A;  5FDC A;  2CBE A;  4RH2 A;  1H9Q A;  3Q31 A;  1G54 A;  3HKQ A;  2NNG A;  4Z0Q A;  2CBC A;  3RLD A;  4R5B A;  1CVC A;  2NWO A;  3ML2 A;  4X5S A;  1XEG A;  1OKN A;  5JES B;  5HPJ A;  3CAJ A;  4WL4 A;  3IGP A;  1G53 A;  1RZA A;  1CIL A;  1CNC A;  3RGE A;  1HEB A;  2HD6 A;  1H9N A;  3TMJ A;  3RYX B;  3F4X A;  4ZWZ A;  1HUH A;  1TEQ X;  1J9W A;  2CBB A;  4HBA A;  7CA2 A;  1CAZ A;  4L5W A;  3KNE A;  4YXU A;  1IF7 A;  4Q81 A;  3JXF A;  2W2J A;  2FNN A;  3M2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...