3M2ZA

Fragment tethered to carbonic anhydrase ii h64c mutant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
257
structure length
257
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 2
publication title Fragment screening on Carbonic Anydrase II via Tethering approach
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 78
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3m2zA00
1G4JA 4KNJA 3K7KA 4WW6A 3D93A 5G0CA 1CNKA 2NNGA 5DSLA 1RJ5A 1UGFA 4FVOA 5HPJA 3M5SA 1H9NA 3P4VA 2VVAX 7CA2A 3JXHC 3BL1A 5SZ0A 4Q7WA 12CAA 3MHCA 5EHEA 4Q8XA 4QK3A 3LXEA 3V2MA 3S72B 1CRMA 3S75B 4E3GA 4YGFA 4E9OX 1RAYA 4YHAA 5EHWA 4K0ZA 4Q87A 3K34A 3MWOA 1CCSA 4Q7SA 4Y0JA 2ABEA 4X5SA 1TE3X 3P5AA 4UOVA 4HBAA 3RGEA 4FVNA 1UGAA 3V2JA 5JDVB 5DSJA 1TH9A 1KOQA 4JSWA 2WEHA 3HKUA 3M2YA 1G45A 3V3IB 5DSKA 1CAYA 3DD0A 2GEHA 4MDGA 4ZX1A 5CJFA 5CLUA 1OQ5A 4MLTA 1G3ZA 4TWLA 5JEGB 1RJ6A 2Q38A 4K1QA 2NXRA 2HNCA 4BF6A 3V3FA 1CNCA 3KNEA 1FR7A 3MNKA 4WL4A 5DRSA 3IBLA 1UGCA 2WD3A 2X7SA 4PYXA 4RFCA 4HF3A 3MNIA 4R5BA 5A25A 1I8ZA 1IF5A 3OIMA 4QSIA 1CAMA 2QOAA 3M2NA 2NWOA 5A6HA 4FPTA 1CIMA 2NWPA 4FRCA 3M40A 2F14A 1MUAA 3V3JA 2FMGA 1I9NA 3V7XA 3FW3A 4QJXA 2QP6A 3MNUA 4QSBA 1YDCA 1CNIA 1JV0A 5CACA 3IBUA 5BRUA 4LHIA 3DA2A 1FSNA 4Z1EA 4RIVA 5BNLA 1CNGA 4CNRA 3OILA 1CALA 4C3TA 4BCWA 4Q49A 4ZWZA 2NN7A 2W2JA 1CVCA 3D92A 5EIJA 2CABA 1YDDA 2FNKA 4ETQC 3V3GB 4PZHA 4YVYA 2AW1A 3RJ7A 1CCTA 1I9LA 2CBCA 3M96A 1CA3A 4KUVA 4MDLA 4YXOA 1FQMA 5FDCA 5DSNA 3JXGA 5AMGA 3S9TA 1ZFKA 3FFPX 4Q90A 2ILIA 5FL6A 3Q31A 4Q83A 3OYSA 1BN1A 1IF8A 4ZAOA 4PYYA 4CACA 4QSAA 3EFTA 3NB5A 3IEOA 2Q1QA 3S78B 3C7PA 1V9EA 1HVAA 1YDBA 3IBNA 3K2FA 4JSSA 1RZDA 3W6IA 1CNJA 5FNHA 1CRAA 4RUXA 5SZ4A 2HOCA 3BETA 4JS6A 4Z0QA 3SAXA 3L14A 4GL1X 3EFIA 1CAJA 1CAKA 4M2WA 4QJPA 5FDIA 3D9ZA 4HT0A 4KV0A 2Q1BA 2NNVA 5DSIA 1XEGA 1CVHA 3MHOA 3R17B 4Q0LA 4TWMA 4ZWYA 4YWPA 5DSRA 4E4AA 1HUGA 1I9MA 2CBDA 4Q8YA 4Q6EA 3MMFA 3DBUA 1ZFQA 3PO6A 5EH8A 2NNOA 3S97A 3KLDB 1FR4A 4PQ7A 5EHVA 1OKLA 1ZSCA 1CZMA 2FOQA 3RYYA 5IPZA 4K0TA 4L5VA 3OKVA 4FIKA 4Q6DA 3P3JA 4ILXA 3UYQA 2NXTA 1HEBA 5FL4A 5FLQA 4M2RA 2FOYA 1IF6A 1ZGEA 2FOVA 3B1BA 3HFPA 1G54A 3M1WA 3ML5A 4KP8A 4Q07A 2VVBX 3MHMA 4QY3A 3M14A 2IT4A 5SZ1A 3SAPA 3DC3A 3DVCA 3NI5A 4IWZA 3KOKA 5SZ5A 3OKUA 5FNJA 3S74B 3P55A 4LP6A 4YGLA 1FLJA 3PYKA 1CCUA 1Z93A 1ZE8A 1BN4A 1FQNA 1G6VA 4QJOA 1KWQA 5G03A 4Z1JA 1FSRA 2POUA 3DCSA 4CNXA 2QO8A 3QYKA 3CAJA 3NJ9A 4M2VA 4WUPA 1YO0A 5DSMA 3OIKA 1A42A 1BNQA 3S76A 4JSAA 5E2RA 5JESB 3P58A 3CA2A 3CYUA 1OKNA 1RZAA 5FLOA 4XIXA 4BF1A 3OY0A 2O4ZA 1LZVA 4YX4A 3KS3A 5EKMA 1EOUA 1G48A 4QJMA 1CNHA 1TG9A 3DCCA 5FLTA 1BNVA 4FU5A 3N0NA 2HL4A 3S73B 5BRVA 4KUYA 1BNTA 2NMXA 4Z1KA 2NN1A 3KOIA 4G7AA 1I9OA 2NXSA 5AMLA 5E2KA 3RG4A 4YXUA 4KUWA 5DSPA 1JD0A 1RAZA 4WW8A 3U3AX 1AZMA 2NWYA 3ZNCA 3M04A 4Z1NA 3OYQA 4YGJA 3DC9A 4R59A 5DSOA 3IBIA 4Q8ZA 1CILA 3F7UA 1CA2A 2POVA 1DCAA 5E2NA 3T82A 1BNWA 1KEQA 2FMZA 3KWAA 4XFWA 3N2PA 5JGTB 1I9QA 4YGKA 5FLPA 3T5ZA 1G52A 1RZEA 4YYTA 1BNMA 3B4FA 1TTMA 5E28A 2WEGA 2X7TA 4L5WA 3RLDA 3TVOX 1HECA 3ML2A 3HKQA 4HEWA 3MNAA 3P44A 3M3XA 3T84A 5AMDA 2OSFA 5EKJA 3T5UA 2HFWA 3V3HB 3S71B 1MOOA 9CA2A 4ZWXA 1IF4A 3MNHA 1YO2A 3N3JA 4G0CA 5JGSB 1TEQX 3M5EA 3P3HA 5JG5B 4QIYA 4LU3A 3JXFA 3F4XA 4HEZA 3F8EA 3RYJB 3VBDA 1G1DA 1TBTX 4K13A 1HCAA 4ITPA 3UYNA 5FNGA 4E3HA 2CBBA 4R5AA 3MHLA 1Z9YA 5DOGA 1BNNA 1KWRA 1CAOA 1LGDA 1UGGA 4KNNA 4CQ0A 1H9QA 3RYXB 3TMJA 2POWA 4MO8A 1BICA 5E5UA 2H15A 3GZ0A 3FE4A 4ZX0A 1JCZA 4QSJA 1HEDA 1DCBA 2FNMA 4L5UA 4WR7A 1ZSAA 1CVAA 1G0EA 5EZTX 5JQ0A 1BZMA 5CA2A 5E2MA 2OSMA 1CNYA 5L6KA 5J8ZA 2EU3A 4QTLA 3P5LA 4CA2A 3DCWA 1LG5A 3RZ5A 3V5GA 4HEYA 1BN3A 5EH7A 3RZ1B 3DD8A 4QJWA 3RZ7A 1XPZA 4CNVA 4Q09A 2WEJA 4MLXA 1CNXA 1G46A 1H4NA 1LG6A 3U7CA 1F2WA 1FQRA 1ZH9A 5SZ6A 4QK2A 3PJJA 4N16A 1T9NA 3M67A 2H4NA 3MZCA 1J9WA 4RN4A 2EU2A 3HKNA 4QIZA 4Q9YA 1TB0X 4QJ0A 2FNNA 3M98A 4YGNA 1UGBA 1BCDA 2NWZA 4K0SA 5FNLA 4WUQA 1I91A 3M1KA 5JEPB 1IF9A 1ZSBA 3N4BA 6CA2A 1Y7WA 3CZVA 5FL5A 3RG3A 8CA2A 4E3DA 3RZ0B 5E5RA 3HS4A 4Q7VA 4Q99A 4Q06A 3MHIA 2EZ7A 4MDMA 2NNSA 4MTYA 4HU1A 4XZ5A 3DVDA 3IAIA 1UGDA 3M5TA 4XE1A 1KOPA 1V9IC 2FW4A 3M1QA 1LUGA 3U45X 1I9PA 3HKTA 4IDRX 1THKA 3KIGA 3DVBA 3D8WA 3F7BA 3S77B 3W6HA 2HD6A 5EKHA 3IGPA 3D0NA 1ZNCA 4XIWA 1URTA 1CAHA 4ZWIA 1HEAA 4PXXA 5DVXA 1AM6A 2WD2A 4RIUA 3T85A 1RZBA 5FLSA 3MNJA 3DAZA 4KNIA 1CNWA 3DV7A 4RUYA 3SBHA 4DZ9A 4E5QA 3S8XA 1CVFA 4E49A 5EH5A 1G0FA 5JG3B 1RZCA 5L3OA 2FOSA 2CA2A 5BRWA 1HUHA 1G4OA 3KONA 4QEFA 4COQA 3MDZA 3RZ8A 4QK1A 1XEVA 4Q08A 5LMDA 2AX2A 1CINA 1Z97A 4HT2A 1FQLA 4FL7A 1DMXA 1YO1A 5EOIA 1FSQA 2FOUA 4CNWA 1CAZA 1CNBA 5FNIA 1TG3A 4YXIA 4RH2A 3TVNX 5BYIA 2GD8A 3KKXA 4N0XB 2ZNCA 5G01A 4RUZA 5DSQA 1YDAA 4Q81A 1CAIA 3R16A 4KAPA 5JEHB 4KNMA 5SZ7A 2WEOA 5DOHA 3ZP9A 5E2SA 5SZ2A 3RYVB 4DZ7A 1CANA 5C8IA 2HKKA 3T83A 1IF7A 5FNKA 1DMYA 1I90A 1UGEA 2CBEA 3BL0A 1G53A 4Q7PA 4ITOA 5SZ3A 4JSZA 1CVBA 1CVEA 4M2UA 5JQTA 5G0BA 1TEUX 1BV3A 3M2XA 4Q78A 5FLRA 3HLJA 3RYZA 1BNUA 4KP5A 4E3FA 3U47A 3M1JA 3SBIA 5FNMA 3M2ZA 1CVDA 2X7UA 1ZGFA 1HCBA 2CBAA 1XQ0A 4RFDA 3MYQA 1OKMA 1AVNA
chains in the Genus database with same CATH superfamily
1G4JA 4KNJA 3K7KA 4WW6A 3D93A 5G0CA 1CNKA 2NNGA 5DSLA 1RJ5A 1UGFA 4FVOA 5HPJA 3M5SA 1H9NA 3P4VA 2VVAX 7CA2A 3JXHC 3BL1A 5SZ0A 4Q7WA 12CAA 3MHCA 5EHEA 4Q8XA 4QK3A 3LXEA 3V2MA 3S72B 1CRMA 3S75B 4E3GA 4YGFA 4E9OX 1RAYA 4YHAA 5EHWA 4K0ZA 4Q87A 3K34A 3MWOA 1CCSA 4Q7SA 4Y0JA 2ABEA 4X5SA 1TE3X 3P5AA 4UOVA 4HBAA 3RGEA 4FVNA 1UGAA 3V2JA 5JDVB 5DSJA 1TH9A 1KOQA 4JSWA 2WEHA 3HKUA 3M2YA 1G45A 3V3IB 5DSKA 1CAYA 3DD0A 2GEHA 4MDGA 4ZX1A 5CJFA 5CLUA 1OQ5A 4MLTA 1G3ZA 4TWLA 5JEGB 1RJ6A 2Q38A 4K1QA 2NXRA 2HNCA 4BF6A 3V3FA 1CNCA 3KNEA 1FR7A 3MNKA 4WL4A 5DRSA 3IBLA 1UGCA 2WD3A 2X7SA 4PYXA 4RFCA 4HF3A 3MNIA 4R5BA 5A25A 1I8ZA 1IF5A 3OIMA 4QSIA 1CAMA 2QOAA 3M2NA 2NWOA 5A6HA 4FPTA 1CIMA 2NWPA 4FRCA 3M40A 2F14A 1MUAA 3V3JA 2FMGA 1I9NA 3V7XA 3FW3A 4QJXA 2QP6A 3MNUA 4QSBA 1YDCA 1CNIA 1JV0A 5CACA 3IBUA 5BRUA 4LHIA 3DA2A 1FSNA 4Z1EA 4RIVA 5BNLA 1CNGA 4CNRA 3OILA 1CALA 4C3TA 4BCWA 4Q49A 4ZWZA 2NN7A 2W2JA 1CVCA 3D92A 5EIJA 2CABA 1YDDA 2FNKA 4ETQC 3V3GB 4PZHA 4YVYA 2AW1A 3RJ7A 1CCTA 1I9LA 2CBCA 3M96A 1CA3A 4KUVA 4MDLA 4YXOA 1FQMA 5FDCA 5DSNA 3JXGA 5AMGA 3S9TA 1ZFKA 3FFPX 4Q90A 2ILIA 5FL6A 3Q31A 4Q83A 3OYSA 1BN1A 1IF8A 4ZAOA 4PYYA 4CACA 4QSAA 3EFTA 3NB5A 3IEOA 2Q1QA 3S78B 3C7PA 1V9EA 1HVAA 1YDBA 3IBNA 3K2FA 4JSSA 1RZDA 3W6IA 1CNJA 5FNHA 1CRAA 4RUXA 5SZ4A 2HOCA 3BETA 4JS6A 4Z0QA 3SAXA 3L14A 4GL1X 3EFIA 1CAJA 1CAKA 4M2WA 4QJPA 5FDIA 3D9ZA 4HT0A 4KV0A 2Q1BA 2NNVA 5DSIA 1XEGA 1CVHA 3MHOA 3R17B 4Q0LA 4TWMA 4ZWYA 4YWPA 5DSRA 4E4AA 1HUGA 1I9MA 2CBDA 4Q8YA 4Q6EA 3MMFA 3DBUA 1ZFQA 3PO6A 5EH8A 2NNOA 3S97A 3KLDB 1FR4A 4PQ7A 5EHVA 1OKLA 1ZSCA 1CZMA 2FOQA 3RYYA 5IPZA 4K0TA 4L5VA 3OKVA 4FIKA 4Q6DA 3P3JA 4ILXA 3UYQA 2NXTA 1HEBA 5FL4A 5FLQA 4M2RA 2FOYA 1IF6A 1ZGEA 2FOVA 3B1BA 3HFPA 1G54A 3M1WA 3ML5A 4KP8A 4Q07A 2VVBX 3MHMA 4QY3A 3M14A 2IT4A 5SZ1A 3SAPA 3DC3A 3DVCA 3NI5A 4IWZA 3KOKA 5SZ5A 3OKUA 5FNJA 3S74B 3P55A 4LP6A 4YGLA 1FLJA 3PYKA 1CCUA 1Z93A 1ZE8A 1BN4A 1FQNA 1G6VA 4QJOA 1KWQA 5G03A 4Z1JA 1FSRA 2POUA 3DCSA 4CNXA 2QO8A 3QYKA 3CAJA 3NJ9A 4M2VA 4WUPA 1YO0A 5DSMA 3OIKA 1A42A 1BNQA 3S76A 4JSAA 5E2RA 5JESB 3P58A 3CA2A 3CYUA 1OKNA 1RZAA 5FLOA 4XIXA 4BF1A 3OY0A 2O4ZA 1LZVA 4YX4A 3KS3A 5EKMA 1EOUA 1G48A 4QJMA 1CNHA 1TG9A 3DCCA 5FLTA 1BNVA 4FU5A 3N0NA 2HL4A 3S73B 5BRVA 4KUYA 1BNTA 2NMXA 4Z1KA 2NN1A 3KOIA 4G7AA 1I9OA 2NXSA 5AMLA 5E2KA 3RG4A 4YXUA 4KUWA 5DSPA 1JD0A 1RAZA 4WW8A 3U3AX 1AZMA 2NWYA 3ZNCA 3M04A 4Z1NA 3OYQA 4YGJA 3DC9A 4R59A 5DSOA 3IBIA 4Q8ZA 1CILA 3F7UA 1CA2A 2POVA 1DCAA 5E2NA 3T82A 1BNWA 1KEQA 2FMZA 3KWAA 4XFWA 3N2PA 5JGTB 1I9QA 4YGKA 5FLPA 3T5ZA 1G52A 1RZEA 4YYTA 1BNMA 3B4FA 1TTMA 5E28A 2WEGA 2X7TA 4L5WA 3RLDA 3TVOX 1HECA 3ML2A 3HKQA 4HEWA 3MNAA 3P44A 3M3XA 3T84A 5AMDA 2OSFA 5EKJA 3T5UA 2HFWA 3V3HB 3S71B 1MOOA 9CA2A 4ZWXA 1IF4A 3MNHA 1YO2A 3N3JA 4G0CA 5JGSB 1TEQX 3M5EA 3P3HA 5JG5B 4QIYA 4LU3A 3JXFA 3F4XA 4HEZA 3F8EA 3RYJB 3VBDA 1G1DA 1TBTX 4K13A 1HCAA 4ITPA 3UYNA 5FNGA 4E3HA 2CBBA 4R5AA 3MHLA 1Z9YA 5DOGA 1BNNA 1KWRA 1CAOA 1LGDA 1UGGA 4KNNA 4CQ0A 1H9QA 3RYXB 3TMJA 2POWA 4MO8A 1BICA 5E5UA 2H15A 3GZ0A 3FE4A 4ZX0A 1JCZA 4QSJA 1HEDA 1DCBA 2FNMA 4L5UA 4WR7A 1ZSAA 1CVAA 1G0EA 5EZTX 5JQ0A 1BZMA 5CA2A 5E2MA 2OSMA 1CNYA 5L6KA 5J8ZA 2EU3A 4QTLA 3P5LA 4CA2A 3DCWA 1LG5A 3RZ5A 3V5GA 4HEYA 1BN3A 5EH7A 3RZ1B 3DD8A 4QJWA 3RZ7A 1XPZA 4CNVA 4Q09A 2WEJA 4MLXA 1CNXA 1G46A 1H4NA 1LG6A 3U7CA 1F2WA 1FQRA 1ZH9A 5SZ6A 4QK2A 3PJJA 4N16A 1T9NA 3M67A 2H4NA 3MZCA 1J9WA 4RN4A 2EU2A 3HKNA 4QIZA 4Q9YA 1TB0X 4QJ0A 2FNNA 3M98A 4YGNA 1UGBA 1BCDA 2NWZA 4K0SA 5FNLA 4WUQA 1I91A 3M1KA 5JEPB 1IF9A 1ZSBA 3N4BA 6CA2A 1Y7WA 3CZVA 5FL5A 3RG3A 8CA2A 4E3DA 3RZ0B 5E5RA 3HS4A 4Q7VA 4Q99A 4Q06A 3MHIA 2EZ7A 4MDMA 2NNSA 4MTYA 4HU1A 4XZ5A 3DVDA 3IAIA 1UGDA 3M5TA 4XE1A 1KOPA 1V9IC 2FW4A 3M1QA 1LUGA 3U45X 1I9PA 3HKTA 4IDRX 1THKA 3KIGA 3DVBA 3D8WA 3F7BA 3S77B 3W6HA 2HD6A 5EKHA 3IGPA 3D0NA 1ZNCA 4XIWA 1URTA 1CAHA 4ZWIA 1HEAA 4PXXA 5DVXA 1AM6A 2WD2A 4RIUA 3T85A 1RZBA 5FLSA 3MNJA 3DAZA 4KNIA 1CNWA 3DV7A 4RUYA 3SBHA 4DZ9A 4E5QA 3S8XA 1CVFA 4E49A 5EH5A 1G0FA 5JG3B 1RZCA 5L3OA 2FOSA 2CA2A 5BRWA 1HUHA 1G4OA 3KONA 4QEFA 4COQA 3MDZA 3RZ8A 4QK1A 1XEVA 4Q08A 5LMDA 2AX2A 1CINA 1Z97A 4HT2A 1FQLA 4FL7A 1DMXA 1YO1A 5EOIA 1FSQA 2FOUA 4CNWA 1CAZA 1CNBA 5FNIA 1TG3A 4YXIA 4RH2A 3TVNX 5BYIA 2GD8A 3KKXA 4N0XB 2ZNCA 5G01A 4RUZA 5DSQA 1YDAA 4Q81A 1CAIA 3R16A 4KAPA 5JEHB 4KNMA 5SZ7A 2WEOA 5DOHA 3ZP9A 5E2SA 5SZ2A 3RYVB 4DZ7A 1CANA 5C8IA 2HKKA 3T83A 1IF7A 5FNKA 1DMYA 1I90A 1UGEA 2CBEA 3BL0A 1G53A 4Q7PA 4ITOA 5SZ3A 4JSZA 1CVBA 1CVEA 4M2UA 5JQTA 5G0BA 1TEUX 1BV3A 3M2XA 4Q78A 5FLRA 3HLJA 3RYZA 1BNUA 4KP5A 4E3FA 3U47A 3M1JA 3SBIA 5FNMA 3M2ZA 1CVDA 2X7UA 1ZGFA 1HCBA 2CBAA 1XQ0A 4RFDA 3MYQA 1OKMA 1AVNA
chains in the Genus database with same CATH topology
1G4JA 4KNJA 3K7KA 4WW6A 3D93A 5G0CA 1CNKA 2NNGA 5DSLA 1RJ5A 1UGFA 4FVOA 5HPJA 3M5SA 1H9NA 3P4VA 2VVAX 7CA2A 3JXHC 3BL1A 5SZ0A 4Q7WA 12CAA 3MHCA 5EHEA 4Q8XA 4QK3A 3LXEA 3V2MA 3S72B 1CRMA 3S75B 4E3GA 4YGFA 4E9OX 1RAYA 4YHAA 5EHWA 4K0ZA 4Q87A 3K34A 3MWOA 1CCSA 4Q7SA 4Y0JA 2ABEA 4X5SA 1TE3X 3P5AA 4UOVA 4HBAA 3RGEA 4FVNA 1UGAA 3V2JA 5JDVB 5DSJA 1TH9A 1KOQA 4JSWA 2WEHA 3HKUA 3M2YA 1G45A 3V3IB 5DSKA 1CAYA 3DD0A 2GEHA 4MDGA 4ZX1A 5CJFA 5CLUA 1OQ5A 4MLTA 1G3ZA 4TWLA 5JEGB 1RJ6A 2Q38A 4K1QA 2NXRA 2HNCA 4BF6A 3V3FA 1CNCA 3KNEA 1FR7A 3MNKA 4WL4A 5DRSA 3IBLA 1UGCA 2WD3A 2X7SA 4PYXA 4RFCA 4HF3A 3MNIA 4R5BA 5A25A 1I8ZA 1IF5A 3OIMA 4QSIA 1CAMA 2QOAA 3M2NA 2NWOA 5A6HA 4FPTA 1CIMA 2NWPA 4FRCA 3M40A 2F14A 1MUAA 3V3JA 2FMGA 1I9NA 3V7XA 3FW3A 4QJXA 2QP6A 3MNUA 4QSBA 1YDCA 1CNIA 1JV0A 5CACA 3IBUA 5BRUA 4LHIA 3DA2A 1FSNA 4Z1EA 4RIVA 5BNLA 1CNGA 4CNRA 3OILA 1CALA 4C3TA 4BCWA 4Q49A 4ZWZA 2NN7A 2W2JA 1CVCA 3D92A 5EIJA 2CABA 1YDDA 2FNKA 4ETQC 3V3GB 4PZHA 4YVYA 2AW1A 3RJ7A 1CCTA 1I9LA 2CBCA 3M96A 1CA3A 4KUVA 4MDLA 4YXOA 1FQMA 5FDCA 5DSNA 3JXGA 5AMGA 3S9TA 1ZFKA 3FFPX 4Q90A 2ILIA 5FL6A 3Q31A 4Q83A 3OYSA 1BN1A 1IF8A 4ZAOA 4PYYA 4CACA 4QSAA 3EFTA 3NB5A 3IEOA 2Q1QA 3S78B 3C7PA 1V9EA 1HVAA 1YDBA 3IBNA 3K2FA 4JSSA 1RZDA 3W6IA 1CNJA 5FNHA 1CRAA 4RUXA 5SZ4A 2HOCA 3BETA 4JS6A 4Z0QA 3SAXA 3L14A 4GL1X 3EFIA 1CAJA 1CAKA 4M2WA 4QJPA 5FDIA 3D9ZA 4HT0A 4KV0A 2Q1BA 2NNVA 5DSIA 1XEGA 1CVHA 3MHOA 3R17B 4Q0LA 4TWMA 4ZWYA 4YWPA 5DSRA 4E4AA 1HUGA 1I9MA 2CBDA 4Q8YA 4Q6EA 3MMFA 3DBUA 1ZFQA 3PO6A 5EH8A 2NNOA 3S97A 3KLDB 1FR4A 4PQ7A 5EHVA 1OKLA 1ZSCA 1CZMA 2FOQA 3RYYA 5IPZA 4K0TA 4L5VA 3OKVA 4FIKA 4Q6DA 3P3JA 4ILXA 3UYQA 2NXTA 1HEBA 5FL4A 5FLQA 4M2RA 2FOYA 1IF6A 1ZGEA 2FOVA 3B1BA 3HFPA 1G54A 3M1WA 3ML5A 4KP8A 4Q07A 2VVBX 3MHMA 4QY3A 3M14A 2IT4A 5SZ1A 3SAPA 3DC3A 3DVCA 3NI5A 4IWZA 3KOKA 5SZ5A 3OKUA 5FNJA 3S74B 3P55A 4LP6A 4YGLA 1FLJA 3PYKA 1CCUA 1Z93A 1ZE8A 1BN4A 1FQNA 1G6VA 4QJOA 1KWQA 5G03A 4Z1JA 1FSRA 2POUA 3DCSA 4CNXA 2QO8A 3QYKA 3CAJA 3NJ9A 4M2VA 4WUPA 1YO0A 5DSMA 3OIKA 1A42A 1BNQA 3S76A 4JSAA 5E2RA 5JESB 3P58A 3CA2A 3CYUA 1OKNA 1RZAA 5FLOA 4XIXA 4BF1A 3OY0A 2O4ZA 1LZVA 4YX4A 3KS3A 5EKMA 1EOUA 1G48A 4QJMA 1CNHA 1TG9A 3DCCA 5FLTA 1BNVA 4FU5A 3N0NA 2HL4A 3S73B 5BRVA 4KUYA 1BNTA 2NMXA 4Z1KA 2NN1A 3KOIA 4G7AA 1I9OA 2NXSA 5AMLA 5E2KA 3RG4A 4YXUA 4KUWA 5DSPA 1JD0A 1RAZA 4WW8A 3U3AX 1AZMA 2NWYA 3ZNCA 3M04A 4Z1NA 3OYQA 4YGJA 3DC9A 4R59A 5DSOA 3IBIA 4Q8ZA 1CILA 3F7UA 1CA2A 2POVA 1DCAA 5E2NA 3T82A 1BNWA 1KEQA 2FMZA 3KWAA 4XFWA 3N2PA 5JGTB 1I9QA 4YGKA 5FLPA 3T5ZA 1G52A 1RZEA 4YYTA 1BNMA 3B4FA 1TTMA 5E28A 2WEGA 2X7TA 4L5WA 3RLDA 3TVOX 1HECA 3ML2A 3HKQA 4HEWA 3MNAA 3P44A 3M3XA 3T84A 5AMDA 2OSFA 5EKJA 3T5UA 2HFWA 3V3HB 3S71B 1MOOA 9CA2A 4ZWXA 1IF4A 3MNHA 1YO2A 3N3JA 4G0CA 5JGSB 1TEQX 3M5EA 3P3HA 5JG5B 4QIYA 4LU3A 3JXFA 3F4XA 4HEZA 3F8EA 3RYJB 3VBDA 1G1DA 1TBTX 4K13A 1HCAA 4ITPA 3UYNA 5FNGA 4E3HA 2CBBA 4R5AA 3MHLA 1Z9YA 5DOGA 1BNNA 1KWRA 1CAOA 1LGDA 1UGGA 4KNNA 4CQ0A 1H9QA 3RYXB 3TMJA 2POWA 4MO8A 1BICA 5E5UA 2H15A 3GZ0A 3FE4A 4ZX0A 1JCZA 4QSJA 1HEDA 1DCBA 2FNMA 4L5UA 4WR7A 1ZSAA 1CVAA 1G0EA 5EZTX 5JQ0A 1BZMA 5CA2A 5E2MA 2OSMA 1CNYA 5L6KA 5J8ZA 2EU3A 4QTLA 3P5LA 4CA2A 3DCWA 1LG5A 3RZ5A 3V5GA 4HEYA 1BN3A 5EH7A 3RZ1B 3DD8A 4QJWA 3RZ7A 1XPZA 4CNVA 4Q09A 2WEJA 4MLXA 1CNXA 1G46A 1H4NA 1LG6A 3U7CA 1F2WA 1FQRA 1ZH9A 5SZ6A 4QK2A 3PJJA 4N16A 1T9NA 3M67A 2H4NA 3MZCA 1J9WA 4RN4A 2EU2A 3HKNA 4QIZA 4Q9YA 1TB0X 4QJ0A 2FNNA 3M98A 4YGNA 1UGBA 1BCDA 2NWZA 4K0SA 5FNLA 4WUQA 1I91A 3M1KA 5JEPB 1IF9A 1ZSBA 3N4BA 6CA2A 1Y7WA 3CZVA 5FL5A 3RG3A 8CA2A 4E3DA 3RZ0B 5E5RA 3HS4A 4Q7VA 4Q99A 4Q06A 3MHIA 2EZ7A 4MDMA 2NNSA 4MTYA 4HU1A 4XZ5A 3DVDA 3IAIA 1UGDA 3M5TA 4XE1A 1KOPA 1V9IC 2FW4A 3M1QA 1LUGA 3U45X 1I9PA 3HKTA 4IDRX 1THKA 3KIGA 3DVBA 3D8WA 3F7BA 3S77B 3W6HA 2HD6A 5EKHA 3IGPA 3D0NA 1ZNCA 4XIWA 1URTA 1CAHA 4ZWIA 1HEAA 4PXXA 5DVXA 1AM6A 2WD2A 4RIUA 3T85A 1RZBA 5FLSA 3MNJA 3DAZA 4KNIA 1CNWA 3DV7A 4RUYA 3SBHA 4DZ9A 4E5QA 3S8XA 1CVFA 4E49A 5EH5A 1G0FA 5JG3B 1RZCA 5L3OA 2FOSA 2CA2A 5BRWA 1HUHA 1G4OA 3KONA 4QEFA 4COQA 3MDZA 3RZ8A 4QK1A 1XEVA 4Q08A 5LMDA 2AX2A 1CINA 1Z97A 4HT2A 1FQLA 4FL7A 1DMXA 1YO1A 5EOIA 1FSQA 2FOUA 4CNWA 1CAZA 1CNBA 5FNIA 1TG3A 4YXIA 4RH2A 3TVNX 5BYIA 2GD8A 3KKXA 4N0XB 2ZNCA 5G01A 4RUZA 5DSQA 1YDAA 4Q81A 1CAIA 3R16A 4KAPA 5JEHB 4KNMA 5SZ7A 2WEOA 5DOHA 3ZP9A 5E2SA 5SZ2A 3RYVB 4DZ7A 1CANA 5C8IA 2HKKA 3T83A 1IF7A 5FNKA 1DMYA 1I90A 1UGEA 2CBEA 3BL0A 1G53A 4Q7PA 4ITOA 5SZ3A 4JSZA 1CVBA 1CVEA 4M2UA 5JQTA 5G0BA 1TEUX 1BV3A 3M2XA 4Q78A 5FLRA 3HLJA 3RYZA 1BNUA 4KP5A 4E3FA 3U47A 3M1JA 3SBIA 5FNMA 3M2ZA 1CVDA 2X7UA 1ZGFA 1HCBA 2CBAA 1XQ0A 4RFDA 3MYQA 1OKMA 1AVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4J A;  4KNJ A;  3K7K A;  4WW6 A;  3D93 A;  5G0C A;  1CNK A;  2NNG A;  5DSL A;  1RJ5 A;  1UGF A;  4FVO A;  5HPJ A;  3M5S A;  1H9N A;  3P4V A;  2VVA X;  7CA2 A;  3JXH C;  3BL1 A;  5SZ0 A;  4Q7W A;  12CA A;  3MHC A;  5EHE A;  4Q8X A;  4QK3 A;  3LXE A;  3V2M A;  3S72 B;  1CRM A;  3S75 B;  4E3G A;  4YGF A;  4E9O X;  1RAY A;  4YHA A;  5EHW A;  4K0Z A;  4Q87 A;  3K34 A;  3MWO A;  1CCS A;  4Q7S A;  4Y0J A;  2ABE A;  4X5S A;  1TE3 X;  3P5A A;  4UOV A;  4HBA A;  3RGE A;  4FVN A;  1UGA A;  3V2J A;  5JDV B;  5DSJ A;  1TH9 A;  1KOQ A;  4JSW A;  2WEH A;  3HKU A;  3M2Y A;  1G45 A;  3V3I B;  5DSK A;  1CAY A;  3DD0 A;  2GEH A;  4MDG A;  4ZX1 A;  5CJF A;  5CLU A;  1OQ5 A;  4MLT A;  1G3Z A;  4TWL A;  5JEG B;  1RJ6 A;  2Q38 A;  4K1Q A;  2NXR A;  2HNC A;  4BF6 A;  3V3F A;  1CNC A;  3KNE A;  1FR7 A;  3MNK A;  4WL4 A;  5DRS A;  3IBL A;  1UGC A;  2WD3 A;  2X7S A;  4PYX A;  4RFC A;  4HF3 A;  3MNI A;  4R5B A;  5A25 A;  1I8Z A;  1IF5 A;  3OIM A;  4QSI A;  1CAM A;  2QOA A;  3M2N A;  2NWO A;  5A6H A;  4FPT A;  1CIM A;  2NWP A;  4FRC A;  3M40 A;  2F14 A;  1MUA A;  3V3J A;  2FMG A;  1I9N A;  3V7X A;  3FW3 A;  4QJX A;  2QP6 A;  3MNU A;  4QSB A;  1YDC A;  1CNI A;  1JV0 A;  5CAC A;  3IBU A;  5BRU A;  4LHI A;  3DA2 A;  1FSN A;  4Z1E A;  4RIV A;  5BNL A;  1CNG A;  4CNR A;  3OIL A;  1CAL A;  4C3T A;  4BCW A;  4Q49 A;  4ZWZ A;  2NN7 A;  2W2J A;  1CVC A;  3D92 A;  5EIJ A;  2CAB A;  1YDD A;  2FNK A;  4ETQ C;  3V3G B;  4PZH A;  4YVY A;  2AW1 A;  3RJ7 A;  1CCT A;  1I9L A;  2CBC A;  3M96 A;  1CA3 A;  4KUV A;  4MDL A;  4YXO A;  1FQM A;  5FDC A;  5DSN A;  3JXG A;  5AMG A;  3S9T A;  1ZFK A;  3FFP X;  4Q90 A;  2ILI A;  5FL6 A;  3Q31 A;  4Q83 A;  3OYS A;  1BN1 A;  1IF8 A;  4ZAO A;  4PYY A;  4CAC A;  4QSA A;  3EFT A;  3NB5 A;  3IEO A;  2Q1Q A;  3S78 B;  3C7P A;  1V9E A;  1HVA A;  1YDB A;  3IBN A;  3K2F A;  4JSS A;  1RZD A;  3W6I A;  1CNJ A;  5FNH A;  1CRA A;  4RUX A;  5SZ4 A;  2HOC A;  3BET A;  4JS6 A;  4Z0Q A;  3SAX A;  3L14 A;  4GL1 X;  3EFI A;  1CAJ A;  1CAK A;  4M2W A;  4QJP A;  5FDI A;  3D9Z A;  4HT0 A;  4KV0 A;  2Q1B A;  2NNV A;  5DSI A;  1XEG A;  1CVH A;  3MHO A;  3R17 B;  4Q0L A;  4TWM A;  4ZWY A;  4YWP A;  5DSR A;  4E4A A;  1HUG A;  1I9M A;  2CBD A;  4Q8Y A;  4Q6E A;  3MMF A;  3DBU A;  1ZFQ A;  3PO6 A;  5EH8 A;  2NNO A;  3S97 A;  3KLD B;  1FR4 A;  4PQ7 A;  5EHV A;  1OKL A;  1ZSC A;  1CZM A;  2FOQ A;  3RYY A;  5IPZ A;  4K0T A;  4L5V A;  3OKV A;  4FIK A;  4Q6D A;  3P3J A;  4ILX A;  3UYQ A;  2NXT A;  1HEB A;  5FL4 A;  5FLQ A;  4M2R A;  2FOY A;  1IF6 A;  1ZGE A;  2FOV A;  3B1B A;  3HFP A;  1G54 A;  3M1W A;  3ML5 A;  4KP8 A;  4Q07 A;  2VVB X;  3MHM A;  4QY3 A;  3M14 A;  2IT4 A;  5SZ1 A;  3SAP A;  3DC3 A;  3DVC A;  3NI5 A;  4IWZ A;  3KOK A;  5SZ5 A;  3OKU A;  5FNJ A;  3S74 B;  3P55 A;  4LP6 A;  4YGL A;  1FLJ A;  3PYK A;  1CCU A;  1Z93 A;  1ZE8 A;  1BN4 A;  1FQN A;  1G6V A;  4QJO A;  1KWQ A;  5G03 A;  4Z1J A;  1FSR A;  2POU A;  3DCS A;  4CNX A;  2QO8 A;  3QYK A;  3CAJ A;  3NJ9 A;  4M2V A;  4WUP A;  1YO0 A;  5DSM A;  3OIK A;  1A42 A;  1BNQ A;  3S76 A;  4JSA A;  5E2R A;  5JES B;  3P58 A;  3CA2 A;  3CYU A;  1OKN A;  1RZA A;  5FLO A;  4XIX A;  4BF1 A;  3OY0 A;  2O4Z A;  1LZV A;  4YX4 A;  3KS3 A;  5EKM A;  1EOU A;  1G48 A;  4QJM A;  1CNH A;  1TG9 A;  3DCC A;  5FLT A;  1BNV A;  4FU5 A;  3N0N A;  2HL4 A;  3S73 B;  5BRV A;  4KUY A;  1BNT A;  2NMX A;  4Z1K A;  2NN1 A;  3KOI A;  4G7A A;  1I9O A;  2NXS A;  5AML A;  5E2K A;  3RG4 A;  4YXU A;  4KUW A;  5DSP A;  1JD0 A;  1RAZ A;  4WW8 A;  3U3A X;  1AZM A;  2NWY A;  3ZNC A;  3M04 A;  4Z1N A;  3OYQ A;  4YGJ A;  3DC9 A;  4R59 A;  5DSO A;  3IBI A;  4Q8Z A;  1CIL A;  3F7U A;  1CA2 A;  2POV A;  1DCA A;  5E2N A;  3T82 A;  1BNW A;  1KEQ A;  2FMZ A;  3KWA A;  4XFW A;  3N2P A;  5JGT B;  1I9Q A;  4YGK A;  5FLP A;  3T5Z A;  1G52 A;  1RZE A;  4YYT A;  1BNM A;  3B4F A;  1TTM A;  5E28 A;  2WEG A;  2X7T A;  4L5W A;  3RLD A;  3TVO X;  1HEC A;  3ML2 A;  3HKQ A;  4HEW A;  3MNA A;  3P44 A;  3M3X A;  3T84 A;  5AMD A;  2OSF A;  5EKJ A;  3T5U A;  2HFW A;  3V3H B;  3S71 B;  1MOO A;  9CA2 A;  4ZWX A;  1IF4 A;  3MNH A;  1YO2 A;  3N3J A;  4G0C A;  5JGS B;  1TEQ X;  3M5E A;  3P3H A;  5JG5 B;  4QIY A;  4LU3 A;  3JXF A;  3F4X A;  4HEZ A;  3F8E A;  3RYJ B;  3VBD A;  1G1D A;  1TBT X;  4K13 A;  1HCA A;  4ITP A;  3UYN A;  5FNG A;  4E3H A;  2CBB A;  4R5A A;  3MHL A;  1Z9Y A;  5DOG A;  1BNN A;  1KWR A;  1CAO A;  1LGD A;  1UGG A;  4KNN A;  4CQ0 A;  1H9Q A;  3RYX B;  3TMJ A;  2POW A;  4MO8 A;  1BIC A;  5E5U A;  2H15 A;  3GZ0 A;  3FE4 A;  4ZX0 A;  1JCZ A;  4QSJ A;  1HED A;  1DCB A;  2FNM A;  4L5U A;  4WR7 A;  1ZSA A;  1CVA A;  1G0E A;  5EZT X;  5JQ0 A;  1BZM A;  5CA2 A;  5E2M A;  2OSM A;  1CNY A;  5L6K A;  5J8Z A;  2EU3 A;  4QTL A;  3P5L A;  4CA2 A;  3DCW A;  1LG5 A;  3RZ5 A;  3V5G A;  4HEY A;  1BN3 A;  5EH7 A;  3RZ1 B;  3DD8 A;  4QJW A;  3RZ7 A;  1XPZ A;  4CNV A;  4Q09 A;  2WEJ A;  4MLX A;  1CNX A;  1G46 A;  1H4N A;  1LG6 A;  3U7C A;  1F2W A;  1FQR A;  1ZH9 A;  5SZ6 A;  4QK2 A;  3PJJ A;  4N16 A;  1T9N A;  3M67 A;  2H4N A;  3MZC A;  1J9W A;  4RN4 A;  2EU2 A;  3HKN A;  4QIZ A;  4Q9Y A;  1TB0 X;  4QJ0 A;  2FNN A;  3M98 A;  4YGN A;  1UGB A;  1BCD A;  2NWZ A;  4K0S A;  5FNL A;  4WUQ A;  1I91 A;  3M1K A;  5JEP B;  1IF9 A;  1ZSB A;  3N4B A;  6CA2 A;  1Y7W A;  3CZV A;  5FL5 A;  3RG3 A;  8CA2 A;  4E3D A;  3RZ0 B;  5E5R A;  3HS4 A;  4Q7V A;  4Q99 A;  4Q06 A;  3MHI A;  2EZ7 A;  4MDM A;  2NNS A;  4MTY A;  4HU1 A;  4XZ5 A;  3DVD A;  3IAI A;  1UGD A;  3M5T A;  4XE1 A;  1KOP A;  1V9I C;  2FW4 A;  3M1Q A;  1LUG A;  3U45 X;  1I9P A;  3HKT A;  4IDR X;  1THK A;  3KIG A;  3DVB A;  3D8W A;  3F7B A;  3S77 B;  3W6H A;  2HD6 A;  5EKH A;  3IGP A;  3D0N A;  1ZNC A;  4XIW A;  1URT A;  1CAH A;  4ZWI A;  1HEA A;  4PXX A;  5DVX A;  1AM6 A;  2WD2 A;  4RIU A;  3T85 A;  1RZB A;  5FLS A;  3MNJ A;  3DAZ A;  4KNI A;  1CNW A;  3DV7 A;  4RUY A;  3SBH A;  4DZ9 A;  4E5Q A;  3S8X A;  1CVF A;  4E49 A;  5EH5 A;  1G0F A;  5JG3 B;  1RZC A;  5L3O A;  2FOS A;  2CA2 A;  5BRW A;  1HUH A;  1G4O A;  3KON A;  4QEF A;  4COQ A;  3MDZ A;  3RZ8 A;  4QK1 A;  1XEV A;  4Q08 A;  5LMD A;  2AX2 A;  1CIN A;  1Z97 A;  4HT2 A;  1FQL A;  4FL7 A;  1DMX A;  1YO1 A;  5EOI A;  1FSQ A;  2FOU A;  4CNW A;  1CAZ A;  1CNB A;  5FNI A;  1TG3 A;  4YXI A;  4RH2 A;  3TVN X;  5BYI A;  2GD8 A;  3KKX A;  4N0X B;  2ZNC A;  5G01 A;  4RUZ A;  5DSQ A;  1YDA A;  4Q81 A;  1CAI A;  3R16 A;  4KAP A;  5JEH B;  4KNM A;  5SZ7 A;  2WEO A;  5DOH A;  3ZP9 A;  5E2S A;  5SZ2 A;  3RYV B;  4DZ7 A;  1CAN A;  5C8I A;  2HKK A;  3T83 A;  1IF7 A;  5FNK A;  1DMY A;  1I90 A;  1UGE A;  2CBE A;  3BL0 A;  1G53 A;  4Q7P A;  4ITO A;  5SZ3 A;  4JSZ A;  1CVB A;  1CVE A;  4M2U A;  5JQT A;  5G0B A;  1TEU X;  1BV3 A;  3M2X A;  4Q78 A;  5FLR A;  3HLJ A;  3RYZ A;  1BNU A;  4KP5 A;  4E3F A;  3U47 A;  3M1J A;  3SBI A;  5FNM A;  3M2Z A;  1CVD A;  2X7U A;  1ZGF A;  1HCB A;  2CBA A;  1XQ0 A;  4RFD A;  3MYQ A;  1OKM A;  1AVN A; 
#chains in the Genus database with same CATH topology
 1G4J A;  4KNJ A;  3K7K A;  4WW6 A;  3D93 A;  5G0C A;  1CNK A;  2NNG A;  5DSL A;  1RJ5 A;  1UGF A;  4FVO A;  5HPJ A;  3M5S A;  1H9N A;  3P4V A;  2VVA X;  7CA2 A;  3JXH C;  3BL1 A;  5SZ0 A;  4Q7W A;  12CA A;  3MHC A;  5EHE A;  4Q8X A;  4QK3 A;  3LXE A;  3V2M A;  3S72 B;  1CRM A;  3S75 B;  4E3G A;  4YGF A;  4E9O X;  1RAY A;  4YHA A;  5EHW A;  4K0Z A;  4Q87 A;  3K34 A;  3MWO A;  1CCS A;  4Q7S A;  4Y0J A;  2ABE A;  4X5S A;  1TE3 X;  3P5A A;  4UOV A;  4HBA A;  3RGE A;  4FVN A;  1UGA A;  3V2J A;  5JDV B;  5DSJ A;  1TH9 A;  1KOQ A;  4JSW A;  2WEH A;  3HKU A;  3M2Y A;  1G45 A;  3V3I B;  5DSK A;  1CAY A;  3DD0 A;  2GEH A;  4MDG A;  4ZX1 A;  5CJF A;  5CLU A;  1OQ5 A;  4MLT A;  1G3Z A;  4TWL A;  5JEG B;  1RJ6 A;  2Q38 A;  4K1Q A;  2NXR A;  2HNC A;  4BF6 A;  3V3F A;  1CNC A;  3KNE A;  1FR7 A;  3MNK A;  4WL4 A;  5DRS A;  3IBL A;  1UGC A;  2WD3 A;  2X7S A;  4PYX A;  4RFC A;  4HF3 A;  3MNI A;  4R5B A;  5A25 A;  1I8Z A;  1IF5 A;  3OIM A;  4QSI A;  1CAM A;  2QOA A;  3M2N A;  2NWO A;  5A6H A;  4FPT A;  1CIM A;  2NWP A;  4FRC A;  3M40 A;  2F14 A;  1MUA A;  3V3J A;  2FMG A;  1I9N A;  3V7X A;  3FW3 A;  4QJX A;  2QP6 A;  3MNU A;  4QSB A;  1YDC A;  1CNI A;  1JV0 A;  5CAC A;  3IBU A;  5BRU A;  4LHI A;  3DA2 A;  1FSN A;  4Z1E A;  4RIV A;  5BNL A;  1CNG A;  4CNR A;  3OIL A;  1CAL A;  4C3T A;  4BCW A;  4Q49 A;  4ZWZ A;  2NN7 A;  2W2J A;  1CVC A;  3D92 A;  5EIJ A;  2CAB A;  1YDD A;  2FNK A;  4ETQ C;  3V3G B;  4PZH A;  4YVY A;  2AW1 A;  3RJ7 A;  1CCT A;  1I9L A;  2CBC A;  3M96 A;  1CA3 A;  4KUV A;  4MDL A;  4YXO A;  1FQM A;  5FDC A;  5DSN A;  3JXG A;  5AMG A;  3S9T A;  1ZFK A;  3FFP X;  4Q90 A;  2ILI A;  5FL6 A;  3Q31 A;  4Q83 A;  3OYS A;  1BN1 A;  1IF8 A;  4ZAO A;  4PYY A;  4CAC A;  4QSA A;  3EFT A;  3NB5 A;  3IEO A;  2Q1Q A;  3S78 B;  3C7P A;  1V9E A;  1HVA A;  1YDB A;  3IBN A;  3K2F A;  4JSS A;  1RZD A;  3W6I A;  1CNJ A;  5FNH A;  1CRA A;  4RUX A;  5SZ4 A;  2HOC A;  3BET A;  4JS6 A;  4Z0Q A;  3SAX A;  3L14 A;  4GL1 X;  3EFI A;  1CAJ A;  1CAK A;  4M2W A;  4QJP A;  5FDI A;  3D9Z A;  4HT0 A;  4KV0 A;  2Q1B A;  2NNV A;  5DSI A;  1XEG A;  1CVH A;  3MHO A;  3R17 B;  4Q0L A;  4TWM A;  4ZWY A;  4YWP A;  5DSR A;  4E4A A;  1HUG A;  1I9M A;  2CBD A;  4Q8Y A;  4Q6E A;  3MMF A;  3DBU A;  1ZFQ A;  3PO6 A;  5EH8 A;  2NNO A;  3S97 A;  3KLD B;  1FR4 A;  4PQ7 A;  5EHV A;  1OKL A;  1ZSC A;  1CZM A;  2FOQ A;  3RYY A;  5IPZ A;  4K0T A;  4L5V A;  3OKV A;  4FIK A;  4Q6D A;  3P3J A;  4ILX A;  3UYQ A;  2NXT A;  1HEB A;  5FL4 A;  5FLQ A;  4M2R A;  2FOY A;  1IF6 A;  1ZGE A;  2FOV A;  3B1B A;  3HFP A;  1G54 A;  3M1W A;  3ML5 A;  4KP8 A;  4Q07 A;  2VVB X;  3MHM A;  4QY3 A;  3M14 A;  2IT4 A;  5SZ1 A;  3SAP A;  3DC3 A;  3DVC A;  3NI5 A;  4IWZ A;  3KOK A;  5SZ5 A;  3OKU A;  5FNJ A;  3S74 B;  3P55 A;  4LP6 A;  4YGL A;  1FLJ A;  3PYK A;  1CCU A;  1Z93 A;  1ZE8 A;  1BN4 A;  1FQN A;  1G6V A;  4QJO A;  1KWQ A;  5G03 A;  4Z1J A;  1FSR A;  2POU A;  3DCS A;  4CNX A;  2QO8 A;  3QYK A;  3CAJ A;  3NJ9 A;  4M2V A;  4WUP A;  1YO0 A;  5DSM A;  3OIK A;  1A42 A;  1BNQ A;  3S76 A;  4JSA A;  5E2R A;  5JES B;  3P58 A;  3CA2 A;  3CYU A;  1OKN A;  1RZA A;  5FLO A;  4XIX A;  4BF1 A;  3OY0 A;  2O4Z A;  1LZV A;  4YX4 A;  3KS3 A;  5EKM A;  1EOU A;  1G48 A;  4QJM A;  1CNH A;  1TG9 A;  3DCC A;  5FLT A;  1BNV A;  4FU5 A;  3N0N A;  2HL4 A;  3S73 B;  5BRV A;  4KUY A;  1BNT A;  2NMX A;  4Z1K A;  2NN1 A;  3KOI A;  4G7A A;  1I9O A;  2NXS A;  5AML A;  5E2K A;  3RG4 A;  4YXU A;  4KUW A;  5DSP A;  1JD0 A;  1RAZ A;  4WW8 A;  3U3A X;  1AZM A;  2NWY A;  3ZNC A;  3M04 A;  4Z1N A;  3OYQ A;  4YGJ A;  3DC9 A;  4R59 A;  5DSO A;  3IBI A;  4Q8Z A;  1CIL A;  3F7U A;  1CA2 A;  2POV A;  1DCA A;  5E2N A;  3T82 A;  1BNW A;  1KEQ A;  2FMZ A;  3KWA A;  4XFW A;  3N2P A;  5JGT B;  1I9Q A;  4YGK A;  5FLP A;  3T5Z A;  1G52 A;  1RZE A;  4YYT A;  1BNM A;  3B4F A;  1TTM A;  5E28 A;  2WEG A;  2X7T A;  4L5W A;  3RLD A;  3TVO X;  1HEC A;  3ML2 A;  3HKQ A;  4HEW A;  3MNA A;  3P44 A;  3M3X A;  3T84 A;  5AMD A;  2OSF A;  5EKJ A;  3T5U A;  2HFW A;  3V3H B;  3S71 B;  1MOO A;  9CA2 A;  4ZWX A;  1IF4 A;  3MNH A;  1YO2 A;  3N3J A;  4G0C A;  5JGS B;  1TEQ X;  3M5E A;  3P3H A;  5JG5 B;  4QIY A;  4LU3 A;  3JXF A;  3F4X A;  4HEZ A;  3F8E A;  3RYJ B;  3VBD A;  1G1D A;  1TBT X;  4K13 A;  1HCA A;  4ITP A;  3UYN A;  5FNG A;  4E3H A;  2CBB A;  4R5A A;  3MHL A;  1Z9Y A;  5DOG A;  1BNN A;  1KWR A;  1CAO A;  1LGD A;  1UGG A;  4KNN A;  4CQ0 A;  1H9Q A;  3RYX B;  3TMJ A;  2POW A;  4MO8 A;  1BIC A;  5E5U A;  2H15 A;  3GZ0 A;  3FE4 A;  4ZX0 A;  1JCZ A;  4QSJ A;  1HED A;  1DCB A;  2FNM A;  4L5U A;  4WR7 A;  1ZSA A;  1CVA A;  1G0E A;  5EZT X;  5JQ0 A;  1BZM A;  5CA2 A;  5E2M A;  2OSM A;  1CNY A;  5L6K A;  5J8Z A;  2EU3 A;  4QTL A;  3P5L A;  4CA2 A;  3DCW A;  1LG5 A;  3RZ5 A;  3V5G A;  4HEY A;  1BN3 A;  5EH7 A;  3RZ1 B;  3DD8 A;  4QJW A;  3RZ7 A;  1XPZ A;  4CNV A;  4Q09 A;  2WEJ A;  4MLX A;  1CNX A;  1G46 A;  1H4N A;  1LG6 A;  3U7C A;  1F2W A;  1FQR A;  1ZH9 A;  5SZ6 A;  4QK2 A;  3PJJ A;  4N16 A;  1T9N A;  3M67 A;  2H4N A;  3MZC A;  1J9W A;  4RN4 A;  2EU2 A;  3HKN A;  4QIZ A;  4Q9Y A;  1TB0 X;  4QJ0 A;  2FNN A;  3M98 A;  4YGN A;  1UGB A;  1BCD A;  2NWZ A;  4K0S A;  5FNL A;  4WUQ A;  1I91 A;  3M1K A;  5JEP B;  1IF9 A;  1ZSB A;  3N4B A;  6CA2 A;  1Y7W A;  3CZV A;  5FL5 A;  3RG3 A;  8CA2 A;  4E3D A;  3RZ0 B;  5E5R A;  3HS4 A;  4Q7V A;  4Q99 A;  4Q06 A;  3MHI A;  2EZ7 A;  4MDM A;  2NNS A;  4MTY A;  4HU1 A;  4XZ5 A;  3DVD A;  3IAI A;  1UGD A;  3M5T A;  4XE1 A;  1KOP A;  1V9I C;  2FW4 A;  3M1Q A;  1LUG A;  3U45 X;  1I9P A;  3HKT A;  4IDR X;  1THK A;  3KIG A;  3DVB A;  3D8W A;  3F7B A;  3S77 B;  3W6H A;  2HD6 A;  5EKH A;  3IGP A;  3D0N A;  1ZNC A;  4XIW A;  1URT A;  1CAH A;  4ZWI A;  1HEA A;  4PXX A;  5DVX A;  1AM6 A;  2WD2 A;  4RIU A;  3T85 A;  1RZB A;  5FLS A;  3MNJ A;  3DAZ A;  4KNI A;  1CNW A;  3DV7 A;  4RUY A;  3SBH A;  4DZ9 A;  4E5Q A;  3S8X A;  1CVF A;  4E49 A;  5EH5 A;  1G0F A;  5JG3 B;  1RZC A;  5L3O A;  2FOS A;  2CA2 A;  5BRW A;  1HUH A;  1G4O A;  3KON A;  4QEF A;  4COQ A;  3MDZ A;  3RZ8 A;  4QK1 A;  1XEV A;  4Q08 A;  5LMD A;  2AX2 A;  1CIN A;  1Z97 A;  4HT2 A;  1FQL A;  4FL7 A;  1DMX A;  1YO1 A;  5EOI A;  1FSQ A;  2FOU A;  4CNW A;  1CAZ A;  1CNB A;  5FNI A;  1TG3 A;  4YXI A;  4RH2 A;  3TVN X;  5BYI A;  2GD8 A;  3KKX A;  4N0X B;  2ZNC A;  5G01 A;  4RUZ A;  5DSQ A;  1YDA A;  4Q81 A;  1CAI A;  3R16 A;  4KAP A;  5JEH B;  4KNM A;  5SZ7 A;  2WEO A;  5DOH A;  3ZP9 A;  5E2S A;  5SZ2 A;  3RYV B;  4DZ7 A;  1CAN A;  5C8I A;  2HKK A;  3T83 A;  1IF7 A;  5FNK A;  1DMY A;  1I90 A;  1UGE A;  2CBE A;  3BL0 A;  1G53 A;  4Q7P A;  4ITO A;  5SZ3 A;  4JSZ A;  1CVB A;  1CVE A;  4M2U A;  5JQT A;  5G0B A;  1TEU X;  1BV3 A;  3M2X A;  4Q78 A;  5FLR A;  3HLJ A;  3RYZ A;  1BNU A;  4KP5 A;  4E3F A;  3U47 A;  3M1J A;  3SBI A;  5FNM A;  3M2Z A;  1CVD A;  2X7U A;  1ZGF A;  1HCB A;  2CBA A;  1XQ0 A;  4RFD A;  3MYQ A;  1OKM A;  1AVN A; 
#chains in the Genus database with same CATH homology
 1G4J A;  4KNJ A;  3K7K A;  4WW6 A;  3D93 A;  5G0C A;  1CNK A;  2NNG A;  5DSL A;  1RJ5 A;  1UGF A;  4FVO A;  5HPJ A;  3M5S A;  1H9N A;  3P4V A;  2VVA X;  7CA2 A;  3JXH C;  3BL1 A;  5SZ0 A;  4Q7W A;  12CA A;  3MHC A;  5EHE A;  4Q8X A;  4QK3 A;  3LXE A;  3V2M A;  3S72 B;  1CRM A;  3S75 B;  4E3G A;  4YGF A;  4E9O X;  1RAY A;  4YHA A;  5EHW A;  4K0Z A;  4Q87 A;  3K34 A;  3MWO A;  1CCS A;  4Q7S A;  4Y0J A;  2ABE A;  4X5S A;  1TE3 X;  3P5A A;  4UOV A;  4HBA A;  3RGE A;  4FVN A;  1UGA A;  3V2J A;  5JDV B;  5DSJ A;  1TH9 A;  1KOQ A;  4JSW A;  2WEH A;  3HKU A;  3M2Y A;  1G45 A;  3V3I B;  5DSK A;  1CAY A;  3DD0 A;  2GEH A;  4MDG A;  4ZX1 A;  5CJF A;  5CLU A;  1OQ5 A;  4MLT A;  1G3Z A;  4TWL A;  5JEG B;  1RJ6 A;  2Q38 A;  4K1Q A;  2NXR A;  2HNC A;  4BF6 A;  3V3F A;  1CNC A;  3KNE A;  1FR7 A;  3MNK A;  4WL4 A;  5DRS A;  3IBL A;  1UGC A;  2WD3 A;  2X7S A;  4PYX A;  4RFC A;  4HF3 A;  3MNI A;  4R5B A;  5A25 A;  1I8Z A;  1IF5 A;  3OIM A;  4QSI A;  1CAM A;  2QOA A;  3M2N A;  2NWO A;  5A6H A;  4FPT A;  1CIM A;  2NWP A;  4FRC A;  3M40 A;  2F14 A;  1MUA A;  3V3J A;  2FMG A;  1I9N A;  3V7X A;  3FW3 A;  4QJX A;  2QP6 A;  3MNU A;  4QSB A;  1YDC A;  1CNI A;  1JV0 A;  5CAC A;  3IBU A;  5BRU A;  4LHI A;  3DA2 A;  1FSN A;  4Z1E A;  4RIV A;  5BNL A;  1CNG A;  4CNR A;  3OIL A;  1CAL A;  4C3T A;  4BCW A;  4Q49 A;  4ZWZ A;  2NN7 A;  2W2J A;  1CVC A;  3D92 A;  5EIJ A;  2CAB A;  1YDD A;  2FNK A;  4ETQ C;  3V3G B;  4PZH A;  4YVY A;  2AW1 A;  3RJ7 A;  1CCT A;  1I9L A;  2CBC A;  3M96 A;  1CA3 A;  4KUV A;  4MDL A;  4YXO A;  1FQM A;  5FDC A;  5DSN A;  3JXG A;  5AMG A;  3S9T A;  1ZFK A;  3FFP X;  4Q90 A;  2ILI A;  5FL6 A;  3Q31 A;  4Q83 A;  3OYS A;  1BN1 A;  1IF8 A;  4ZAO A;  4PYY A;  4CAC A;  4QSA A;  3EFT A;  3NB5 A;  3IEO A;  2Q1Q A;  3S78 B;  3C7P A;  1V9E A;  1HVA A;  1YDB A;  3IBN A;  3K2F A;  4JSS A;  1RZD A;  3W6I A;  1CNJ A;  5FNH A;  1CRA A;  4RUX A;  5SZ4 A;  2HOC A;  3BET A;  4JS6 A;  4Z0Q A;  3SAX A;  3L14 A;  4GL1 X;  3EFI A;  1CAJ A;  1CAK A;  4M2W A;  4QJP A;  5FDI A;  3D9Z A;  4HT0 A;  4KV0 A;  2Q1B A;  2NNV A;  5DSI A;  1XEG A;  1CVH A;  3MHO A;  3R17 B;  4Q0L A;  4TWM A;  4ZWY A;  4YWP A;  5DSR A;  4E4A A;  1HUG A;  1I9M A;  2CBD A;  4Q8Y A;  4Q6E A;  3MMF A;  3DBU A;  1ZFQ A;  3PO6 A;  5EH8 A;  2NNO A;  3S97 A;  3KLD B;  1FR4 A;  4PQ7 A;  5EHV A;  1OKL A;  1ZSC A;  1CZM A;  2FOQ A;  3RYY A;  5IPZ A;  4K0T A;  4L5V A;  3OKV A;  4FIK A;  4Q6D A;  3P3J A;  4ILX A;  3UYQ A;  2NXT A;  1HEB A;  5FL4 A;  5FLQ A;  4M2R A;  2FOY A;  1IF6 A;  1ZGE A;  2FOV A;  3B1B A;  3HFP A;  1G54 A;  3M1W A;  3ML5 A;  4KP8 A;  4Q07 A;  2VVB X;  3MHM A;  4QY3 A;  3M14 A;  2IT4 A;  5SZ1 A;  3SAP A;  3DC3 A;  3DVC A;  3NI5 A;  4IWZ A;  3KOK A;  5SZ5 A;  3OKU A;  5FNJ A;  3S74 B;  3P55 A;  4LP6 A;  4YGL A;  1FLJ A;  3PYK A;  1CCU A;  1Z93 A;  1ZE8 A;  1BN4 A;  1FQN A;  1G6V A;  4QJO A;  1KWQ A;  5G03 A;  4Z1J A;  1FSR A;  2POU A;  3DCS A;  4CNX A;  2QO8 A;  3QYK A;  3CAJ A;  3NJ9 A;  4M2V A;  4WUP A;  1YO0 A;  5DSM A;  3OIK A;  1A42 A;  1BNQ A;  3S76 A;  4JSA A;  5E2R A;  5JES B;  3P58 A;  3CA2 A;  3CYU A;  1OKN A;  1RZA A;  5FLO A;  4XIX A;  4BF1 A;  3OY0 A;  2O4Z A;  1LZV A;  4YX4 A;  3KS3 A;  5EKM A;  1EOU A;  1G48 A;  4QJM A;  1CNH A;  1TG9 A;  3DCC A;  5FLT A;  1BNV A;  4FU5 A;  3N0N A;  2HL4 A;  3S73 B;  5BRV A;  4KUY A;  1BNT A;  2NMX A;  4Z1K A;  2NN1 A;  3KOI A;  4G7A A;  1I9O A;  2NXS A;  5AML A;  5E2K A;  3RG4 A;  4YXU A;  4KUW A;  5DSP A;  1JD0 A;  1RAZ A;  4WW8 A;  3U3A X;  1AZM A;  2NWY A;  3ZNC A;  3M04 A;  4Z1N A;  3OYQ A;  4YGJ A;  3DC9 A;  4R59 A;  5DSO A;  3IBI A;  4Q8Z A;  1CIL A;  3F7U A;  1CA2 A;  2POV A;  1DCA A;  5E2N A;  3T82 A;  1BNW A;  1KEQ A;  2FMZ A;  3KWA A;  4XFW A;  3N2P A;  5JGT B;  1I9Q A;  4YGK A;  5FLP A;  3T5Z A;  1G52 A;  1RZE A;  4YYT A;  1BNM A;  3B4F A;  1TTM A;  5E28 A;  2WEG A;  2X7T A;  4L5W A;  3RLD A;  3TVO X;  1HEC A;  3ML2 A;  3HKQ A;  4HEW A;  3MNA A;  3P44 A;  3M3X A;  3T84 A;  5AMD A;  2OSF A;  5EKJ A;  3T5U A;  2HFW A;  3V3H B;  3S71 B;  1MOO A;  9CA2 A;  4ZWX A;  1IF4 A;  3MNH A;  1YO2 A;  3N3J A;  4G0C A;  5JGS B;  1TEQ X;  3M5E A;  3P3H A;  5JG5 B;  4QIY A;  4LU3 A;  3JXF A;  3F4X A;  4HEZ A;  3F8E A;  3RYJ B;  3VBD A;  1G1D A;  1TBT X;  4K13 A;  1HCA A;  4ITP A;  3UYN A;  5FNG A;  4E3H A;  2CBB A;  4R5A A;  3MHL A;  1Z9Y A;  5DOG A;  1BNN A;  1KWR A;  1CAO A;  1LGD A;  1UGG A;  4KNN A;  4CQ0 A;  1H9Q A;  3RYX B;  3TMJ A;  2POW A;  4MO8 A;  1BIC A;  5E5U A;  2H15 A;  3GZ0 A;  3FE4 A;  4ZX0 A;  1JCZ A;  4QSJ A;  1HED A;  1DCB A;  2FNM A;  4L5U A;  4WR7 A;  1ZSA A;  1CVA A;  1G0E A;  5EZT X;  5JQ0 A;  1BZM A;  5CA2 A;  5E2M A;  2OSM A;  1CNY A;  5L6K A;  5J8Z A;  2EU3 A;  4QTL A;  3P5L A;  4CA2 A;  3DCW A;  1LG5 A;  3RZ5 A;  3V5G A;  4HEY A;  1BN3 A;  5EH7 A;  3RZ1 B;  3DD8 A;  4QJW A;  3RZ7 A;  1XPZ A;  4CNV A;  4Q09 A;  2WEJ A;  4MLX A;  1CNX A;  1G46 A;  1H4N A;  1LG6 A;  3U7C A;  1F2W A;  1FQR A;  1ZH9 A;  5SZ6 A;  4QK2 A;  3PJJ A;  4N16 A;  1T9N A;  3M67 A;  2H4N A;  3MZC A;  1J9W A;  4RN4 A;  2EU2 A;  3HKN A;  4QIZ A;  4Q9Y A;  1TB0 X;  4QJ0 A;  2FNN A;  3M98 A;  4YGN A;  1UGB A;  1BCD A;  2NWZ A;  4K0S A;  5FNL A;  4WUQ A;  1I91 A;  3M1K A;  5JEP B;  1IF9 A;  1ZSB A;  3N4B A;  6CA2 A;  1Y7W A;  3CZV A;  5FL5 A;  3RG3 A;  8CA2 A;  4E3D A;  3RZ0 B;  5E5R A;  3HS4 A;  4Q7V A;  4Q99 A;  4Q06 A;  3MHI A;  2EZ7 A;  4MDM A;  2NNS A;  4MTY A;  4HU1 A;  4XZ5 A;  3DVD A;  3IAI A;  1UGD A;  3M5T A;  4XE1 A;  1KOP A;  1V9I C;  2FW4 A;  3M1Q A;  1LUG A;  3U45 X;  1I9P A;  3HKT A;  4IDR X;  1THK A;  3KIG A;  3DVB A;  3D8W A;  3F7B A;  3S77 B;  3W6H A;  2HD6 A;  5EKH A;  3IGP A;  3D0N A;  1ZNC A;  4XIW A;  1URT A;  1CAH A;  4ZWI A;  1HEA A;  4PXX A;  5DVX A;  1AM6 A;  2WD2 A;  4RIU A;  3T85 A;  1RZB A;  5FLS A;  3MNJ A;  3DAZ A;  4KNI A;  1CNW A;  3DV7 A;  4RUY A;  3SBH A;  4DZ9 A;  4E5Q A;  3S8X A;  1CVF A;  4E49 A;  5EH5 A;  1G0F A;  5JG3 B;  1RZC A;  5L3O A;  2FOS A;  2CA2 A;  5BRW A;  1HUH A;  1G4O A;  3KON A;  4QEF A;  4COQ A;  3MDZ A;  3RZ8 A;  4QK1 A;  1XEV A;  4Q08 A;  5LMD A;  2AX2 A;  1CIN A;  1Z97 A;  4HT2 A;  1FQL A;  4FL7 A;  1DMX A;  1YO1 A;  5EOI A;  1FSQ A;  2FOU A;  4CNW A;  1CAZ A;  1CNB A;  5FNI A;  1TG3 A;  4YXI A;  4RH2 A;  3TVN X;  5BYI A;  2GD8 A;  3KKX A;  4N0X B;  2ZNC A;  5G01 A;  4RUZ A;  5DSQ A;  1YDA A;  4Q81 A;  1CAI A;  3R16 A;  4KAP A;  5JEH B;  4KNM A;  5SZ7 A;  2WEO A;  5DOH A;  3ZP9 A;  5E2S A;  5SZ2 A;  3RYV B;  4DZ7 A;  1CAN A;  5C8I A;  2HKK A;  3T83 A;  1IF7 A;  5FNK A;  1DMY A;  1I90 A;  1UGE A;  2CBE A;  3BL0 A;  1G53 A;  4Q7P A;  4ITO A;  5SZ3 A;  4JSZ A;  1CVB A;  1CVE A;  4M2U A;  5JQT A;  5G0B A;  1TEU X;  1BV3 A;  3M2X A;  4Q78 A;  5FLR A;  3HLJ A;  3RYZ A;  1BNU A;  4KP5 A;  4E3F A;  3U47 A;  3M1J A;  3SBI A;  5FNM A;  3M2Z A;  1CVD A;  2X7U A;  1ZGF A;  1HCB A;  2CBA A;  1XQ0 A;  4RFD A;  3MYQ A;  1OKM A;  1AVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...