3M5TA

Fragment tethered to carbonic anhydrase ii h64c mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 2
publication title Fragment screening on Carbonic Anhydrase II via Tethering approach
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 77
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3m5tA00
3P4VA 4YXIA 3ML5A 2CBAA 3MNUA 5DSMA 5JQ0A 4MDLA 5FLOA 5E2RA 3JXGA 3BL0A 5E2SA 4QJMA 3D93A 4Q99A 3CA2A 5JEGB 2GEHA 1ZE8A 1Z93A 4GL1X 5SZ7A 4Y0JA 2FOQA 3BL1A 4Q78A 5FLPA 1H4NA 3RGEA 3VBDA 3OILA 2H4NA 1CVAA 1TB0X 3QYKA 5EHWA 2NN1A 3CYUA 1ZFKA 4Q90A 4WR7A 1AVNA 1ZGEA 4KP8A 4MTYA 5FNMA 4E9OX 5JG3B 1HEAA 4QJWA 2WEOA 1CNHA 4XIWA 2EU2A 1UGGA 1Z9YA 2ZNCA 1G4JA 4WL4A 3M67A 1IF7A 3DC3A 3HKQA 3MNKA 4N0XB 4CNXA 1G48A 1ZFQA 4KV0A 4R5AA 1CNBA 3N2PA 1KWRA 2CBBA 4LU3A 6CA2A 4ITOA 2POWA 4HEZA 1JV0A 4RH2A 2ABEA 4RUXA 4Q8YA 4QTLA 4YHAA 1CVFA 3MDZA 4JSZA 5SZ6A 1LG5A 1G6VA 3N3JA 2FOVA 2WEHA 4TWLA 1TTMA 3F4XA 2POVA 4RN4A 2HFWA 4K13A 3V7XA 1HEDA 3S8XA 4FVNA 1I9QA 5DOGA 3KIGA 4YXOA 4YGLA 4R59A 2HD6A 5DSRA 1UGEA 5DSOA 5FNKA 5EH8A 3U47A 1ZH9A 3M1KA 1I90A 4L5WA 3DVBA 4K1QA 1CINA 3V3GB 3IEOA 3F7BA 3JXHC 4FIKA 1KOPA 3ZP9A 5EOIA 3W6IA 5SZ5A 3GZ0A 4QIYA 1KWQA 1F2WA 1A42A 1I91A 3KLDB 4QEFA 1TE3X 1YDDA 2W2JA 4RIUA 5FLQA 5CA2A 1CNJA 1G53A 1UGDA 4E5QA 3OYQA 2H15A 2FW4A 3KNEA 3P58A 2FNKA 3IBIA 4Q8XA 1TG3A 3KONA 5JQTA 5SZ1A 4FRCA 1BICA 5DOHA 5CLUA 1HCAA 1XQ0A 1XEVA 4XIXA 2Q1BA 1CVEA 3S9TA 2OSMA 8CA2A 3MNAA 4HEYA 2AW1A 1ZSBA 4MDGA 5DSQA 1H9QA 2FOSA 4Q9YA 4E4AA 3MYQA 5CJFA 5BRUA 3SBHA 2OSFA 3T85A 1CAIA 4PZHA 3P55A 4ILXA 1YO1A 3EFTA 1G4OA 4M2WA 5FNIA 3RYVB 1T9NA 4QSIA 4QK2A 4UOVA 3MHLA 3W6HA 1YDAA 1G46A 4WW8A 5DSJA 1BN4A 1FSQA 4HEWA 3MHMA 4HT2A 5DSPA 1XPZA 4Q6EA 1LZVA 4HBAA 3SAXA 3OKUA 1RJ6A 3CZVA 3DD8A 1UGAA 4M2UA 1V9IC 4CQ0A 4QY3A 3HLJA 1BNNA 3V2MA 4ZX1A 1JCZA 2NXTA 5DSIA 5JESB 1OKNA 4MDMA 3MNJA 5AMLA 4M2RA 5DVXA 5G0CA 4RIVA 1CCSA 2NWZA 3IAIA 4KP5A 2CA2A 4Z1EA 3N0NA 1G3ZA 1CAZA 2FMZA 3JXFA 2NNVA 3T83A 5L3OA 1KEQA 3V5GA 4MLTA 4QK3A 3P44A 1CNWA 4Q08A 1G52A 3NJ9A 3S72B 3FE4A 5A6HA 1BZMA 4FU5A 3RJ7A 2NXRA 2HL4A 4ZX0A 3M2NA 5SZ0A 1HUGA 1CVDA 4RUYA 5EKJA 4Q6DA 3T5UA 1G0FA 5DSNA 3T5ZA 3U45X 1ZNCA 3FW3A 2X7TA 4E3HA 3DC9A 3OY0A 3C7PA 2O4ZA 4K0ZA 3S78B 1JD0A 3N4BA 1IF8A 5FDCA 3T82A 4MLXA 1I9PA 1EOUA 4QSJA 5LMDA 4KUWA 3DCSA 1YO0A 2VVAX 5FLRA 3RYJB 3RZ8A 1FQLA 4QJPA 4PXXA 1DCAA 4HF3A 3FFPX 4KUYA 1G54A 1BV3A 3RZ0B 4HT0A 2CABA 1FQNA 1FR7A 3D0NA 3MWOA 3ZNCA 2IT4A 4L5UA 2QOAA 3U7CA 5EKMA 3DA2A 3M5TA 4Q09A 5JEHB 3P3JA 3OKVA 3IBLA 1CCUA 4YGKA 1OKLA 1URTA 3S75B 2POUA 1CAKA 3RZ5A 4BF6A 2FMGA 3RYYA 1CRMA 3CAJA 2FOYA 3DD0A 4DZ7A 2X7SA 3EFIA 4Q8ZA 3DAZA 4QJ0A 4R5BA 3RYXB 3S76A 4JSWA 5FNHA 2HKKA 3IGPA 4M2VA 4XFWA 3TMJA 3TVNX 1DMYA 4G7AA 4JS6A 1CA2A 1HECA 5E28A 3R16A 1UGCA 3S73B 4QK1A 4K0SA 4KUVA 4FVOA 5G01A 1XEGA 3B4FA 4QIZA 4E3FA 5AMDA 1CCTA 1ZGFA 1BNTA 4IWZA 5EKHA 4XZ5A 4QSBA 5FL4A 5JEPB 1G45A 4PYXA 5E5RA 3KWAA 2FNNA 1RZBA 4COQA 4YYTA 5DRSA 4KAPA 4MO8A 3HKTA 3D9ZA 2WEJA 5J8ZA 2NN7A 1CA3A 1CRAA 3M1JA 3T84A 3DVDA 3U3AX 4L5VA 3K7KA 3S97A 2ILIA 1KOQA 1CILA 5DSKA 2NNOA 3P5LA 5C8IA 3SBIA 1LUGA 4YGNA 1CAOA 4LHIA 1FLJA 2CBCA 1CNXA 1CVCA 4KNNA 3OIMA 3LXEA 4ETQC 4WUPA 5EH7A 5FNJA 3V3JA 2HNCA 3NI5A 5E5UA 3V3IB 2CBDA 1CAHA 4ITPA 3M5EA 2FOUA 3DV7A 3UYQA 3M1WA 5FDIA 4KNMA 3M2YA 4E3DA 4CA2A 3DVCA 4KNJA 1IF4A 5JG5B 1CNCA 2QO8A 5FLSA 3R17B 1AZMA 2NWYA 2QP6A 4CNVA 4HU1A 4X5SA 2Q38A 5BRVA 4YGJA 5BNLA 4YXUA 3M40A 1CNIA 1BN3A 4XE1A 4N16A 1I9OA 1RAZA 4Q7SA 1CANA 3L14A 1FSRA 1YDBA 4JSAA 5JDVB 5E2NA 2WEGA 3K34A 3M1QA 4QSAA 3OYSA 3M14A 1DMXA 4ZWXA 3UYNA 2EZ7A 5EH5A 3KKXA 1CAMA 1HCBA 3PYKA 3S71B 1TG9A 1MOOA 4YGFA 2GD8A 1FQMA 4Q7PA 2F14A 1H9NA 1CALA 5AMGA 5EIJA 5JGTB 4PQ7A 3F7UA 1TEUX 4K0TA 1OKMA 3S77B 4Z1KA 1LGDA 5EHVA 3MHOA 4YX4A 1CIMA 1CVBA 1TEQX 5IPZA 1AM6A 5HPJA 2NWOA 4YVYA 1TBTX 3TVOX 2Q1QA 4ZWIA 3M5SA 5A25A 5L6KA 1RZEA 1I8ZA 1HVAA 3MHIA 5FNLA 3MHCA 3RLDA 2X7UA 3M3XA 3KOKA 4TWMA 5SZ3A 3OIKA 1UGBA 3HKNA 4CNRA 5SZ2A 3RG4A 4Q0LA 4DZ9A 4Q81A 1FQRA 3RZ1B 1CZMA 4FL7A 4KNIA 2WD3A 3M98A 4CNWA 1UGFA 1V9EA 4ZWZA 1YDCA 3K2FA 4JSSA 3V2JA 4C3TA 1BN1A 4Q7VA 1IF9A 2WD2A 2VVBX 3IBNA 3M96A 4Q87A 3P5AA 1CVHA 5E2MA 1Y7WA 3IBUA 4WUQA 3B1BA 3ML2A 5FL6A 1RZCA 2AX2A 3PJJA 3SAPA 4YWPA 2EU3A 3PO6A 1IF6A 1G0EA 3M04A 1YO2A 3HS4A 1RJ5A 3P3HA 1I9NA 1CAYA 3DCCA 4Q83A 4WW6A 5BRWA 4QJXA 4BF1A 3D92A 5EZTX 3HKUA 1Z97A 1BNVA 2HOCA 4RUZA 1RZDA 4IDRX 3MNIA 12CAA 4RFDA 3NB5A 1THKA 1BNWA 4Z1NA 4ZWYA 4BCWA 4Q49A 1OQ5A 1RAYA 3V3HB 2CBEA 1J9WA 4Z0QA 3RZ7A 3KOIA 2NXSA 1RZAA 1FR4A 4Q07A 2FNMA 3DBUA 5BYIA 1DCBA 4E3GA 3MNHA 3Q31A 1CNGA 3S74B 9CA2A 3DCWA 5EHEA 5G0BA 1LG6A 3D8WA 4FPTA 1CNKA 3M2ZA 4ZAOA 1BCDA 3F8EA 5FNGA 4Z1JA 7CA2A 1HUHA 5FL5A 4Q7WA 1ZSCA 5DSLA 1BNQA 1TH9A 3HFPA 5SZ4A 5E2KA 3MMFA 5CACA 3RG3A 1ZSAA 2NNGA 5FLTA 3RYZA 1BNMA 1CNYA 1BNUA 1I9LA 4LP6A 1FSNA 5JGSB 1CAJA 4G0CA 2NWPA 1I9MA 4PYYA 4Q06A 1IF5A 1G1DA 3V3FA 1MUAA 5G03A 2NNSA 3M2XA 3KS3A 4CACA 4RFCA 4E49A 1HEBA 3MZCA 4QJOA 3BETA 2NMXA
chains in the Genus database with same CATH superfamily
3P4VA 4YXIA 3ML5A 2CBAA 3MNUA 5DSMA 5JQ0A 4MDLA 5FLOA 5E2RA 3JXGA 3BL0A 5E2SA 4QJMA 3D93A 4Q99A 3CA2A 5JEGB 2GEHA 1ZE8A 1Z93A 4GL1X 5SZ7A 4Y0JA 2FOQA 3BL1A 4Q78A 5FLPA 1H4NA 3RGEA 3VBDA 3OILA 2H4NA 1CVAA 1TB0X 3QYKA 5EHWA 2NN1A 3CYUA 1ZFKA 4Q90A 4WR7A 1AVNA 1ZGEA 4KP8A 4MTYA 5FNMA 4E9OX 5JG3B 1HEAA 4QJWA 2WEOA 1CNHA 4XIWA 2EU2A 1UGGA 1Z9YA 2ZNCA 1G4JA 4WL4A 3M67A 1IF7A 3DC3A 3HKQA 3MNKA 4N0XB 4CNXA 1G48A 1ZFQA 4KV0A 4R5AA 1CNBA 3N2PA 1KWRA 2CBBA 4LU3A 6CA2A 4ITOA 2POWA 4HEZA 1JV0A 4RH2A 2ABEA 4RUXA 4Q8YA 4QTLA 4YHAA 1CVFA 3MDZA 4JSZA 5SZ6A 1LG5A 1G6VA 3N3JA 2FOVA 2WEHA 4TWLA 1TTMA 3F4XA 2POVA 4RN4A 2HFWA 4K13A 3V7XA 1HEDA 3S8XA 4FVNA 1I9QA 5DOGA 3KIGA 4YXOA 4YGLA 4R59A 2HD6A 5DSRA 1UGEA 5DSOA 5FNKA 5EH8A 3U47A 1ZH9A 3M1KA 1I90A 4L5WA 3DVBA 4K1QA 1CINA 3V3GB 3IEOA 3F7BA 3JXHC 4FIKA 1KOPA 3ZP9A 5EOIA 3W6IA 5SZ5A 3GZ0A 4QIYA 1KWQA 1F2WA 1A42A 1I91A 3KLDB 4QEFA 1TE3X 1YDDA 2W2JA 4RIUA 5FLQA 5CA2A 1CNJA 1G53A 1UGDA 4E5QA 3OYQA 2H15A 2FW4A 3KNEA 3P58A 2FNKA 3IBIA 4Q8XA 1TG3A 3KONA 5JQTA 5SZ1A 4FRCA 1BICA 5DOHA 5CLUA 1HCAA 1XQ0A 1XEVA 4XIXA 2Q1BA 1CVEA 3S9TA 2OSMA 8CA2A 3MNAA 4HEYA 2AW1A 1ZSBA 4MDGA 5DSQA 1H9QA 2FOSA 4Q9YA 4E4AA 3MYQA 5CJFA 5BRUA 3SBHA 2OSFA 3T85A 1CAIA 4PZHA 3P55A 4ILXA 1YO1A 3EFTA 1G4OA 4M2WA 5FNIA 3RYVB 1T9NA 4QSIA 4QK2A 4UOVA 3MHLA 3W6HA 1YDAA 1G46A 4WW8A 5DSJA 1BN4A 1FSQA 4HEWA 3MHMA 4HT2A 5DSPA 1XPZA 4Q6EA 1LZVA 4HBAA 3SAXA 3OKUA 1RJ6A 3CZVA 3DD8A 1UGAA 4M2UA 1V9IC 4CQ0A 4QY3A 3HLJA 1BNNA 3V2MA 4ZX1A 1JCZA 2NXTA 5DSIA 5JESB 1OKNA 4MDMA 3MNJA 5AMLA 4M2RA 5DVXA 5G0CA 4RIVA 1CCSA 2NWZA 3IAIA 4KP5A 2CA2A 4Z1EA 3N0NA 1G3ZA 1CAZA 2FMZA 3JXFA 2NNVA 3T83A 5L3OA 1KEQA 3V5GA 4MLTA 4QK3A 3P44A 1CNWA 4Q08A 1G52A 3NJ9A 3S72B 3FE4A 5A6HA 1BZMA 4FU5A 3RJ7A 2NXRA 2HL4A 4ZX0A 3M2NA 5SZ0A 1HUGA 1CVDA 4RUYA 5EKJA 4Q6DA 3T5UA 1G0FA 5DSNA 3T5ZA 3U45X 1ZNCA 3FW3A 2X7TA 4E3HA 3DC9A 3OY0A 3C7PA 2O4ZA 4K0ZA 3S78B 1JD0A 3N4BA 1IF8A 5FDCA 3T82A 4MLXA 1I9PA 1EOUA 4QSJA 5LMDA 4KUWA 3DCSA 1YO0A 2VVAX 5FLRA 3RYJB 3RZ8A 1FQLA 4QJPA 4PXXA 1DCAA 4HF3A 3FFPX 4KUYA 1G54A 1BV3A 3RZ0B 4HT0A 2CABA 1FQNA 1FR7A 3D0NA 3MWOA 3ZNCA 2IT4A 4L5UA 2QOAA 3U7CA 5EKMA 3DA2A 3M5TA 4Q09A 5JEHB 3P3JA 3OKVA 3IBLA 1CCUA 4YGKA 1OKLA 1URTA 3S75B 2POUA 1CAKA 3RZ5A 4BF6A 2FMGA 3RYYA 1CRMA 3CAJA 2FOYA 3DD0A 4DZ7A 2X7SA 3EFIA 4Q8ZA 3DAZA 4QJ0A 4R5BA 3RYXB 3S76A 4JSWA 5FNHA 2HKKA 3IGPA 4M2VA 4XFWA 3TMJA 3TVNX 1DMYA 4G7AA 4JS6A 1CA2A 1HECA 5E28A 3R16A 1UGCA 3S73B 4QK1A 4K0SA 4KUVA 4FVOA 5G01A 1XEGA 3B4FA 4QIZA 4E3FA 5AMDA 1CCTA 1ZGFA 1BNTA 4IWZA 5EKHA 4XZ5A 4QSBA 5FL4A 5JEPB 1G45A 4PYXA 5E5RA 3KWAA 2FNNA 1RZBA 4COQA 4YYTA 5DRSA 4KAPA 4MO8A 3HKTA 3D9ZA 2WEJA 5J8ZA 2NN7A 1CA3A 1CRAA 3M1JA 3T84A 3DVDA 3U3AX 4L5VA 3K7KA 3S97A 2ILIA 1KOQA 1CILA 5DSKA 2NNOA 3P5LA 5C8IA 3SBIA 1LUGA 4YGNA 1CAOA 4LHIA 1FLJA 2CBCA 1CNXA 1CVCA 4KNNA 3OIMA 3LXEA 4ETQC 4WUPA 5EH7A 5FNJA 3V3JA 2HNCA 3NI5A 5E5UA 3V3IB 2CBDA 1CAHA 4ITPA 3M5EA 2FOUA 3DV7A 3UYQA 3M1WA 5FDIA 4KNMA 3M2YA 4E3DA 4CA2A 3DVCA 4KNJA 1IF4A 5JG5B 1CNCA 2QO8A 5FLSA 3R17B 1AZMA 2NWYA 2QP6A 4CNVA 4HU1A 4X5SA 2Q38A 5BRVA 4YGJA 5BNLA 4YXUA 3M40A 1CNIA 1BN3A 4XE1A 4N16A 1I9OA 1RAZA 4Q7SA 1CANA 3L14A 1FSRA 1YDBA 4JSAA 5JDVB 5E2NA 2WEGA 3K34A 3M1QA 4QSAA 3OYSA 3M14A 1DMXA 4ZWXA 3UYNA 2EZ7A 5EH5A 3KKXA 1CAMA 1HCBA 3PYKA 3S71B 1TG9A 1MOOA 4YGFA 2GD8A 1FQMA 4Q7PA 2F14A 1H9NA 1CALA 5AMGA 5EIJA 5JGTB 4PQ7A 3F7UA 1TEUX 4K0TA 1OKMA 3S77B 4Z1KA 1LGDA 5EHVA 3MHOA 4YX4A 1CIMA 1CVBA 1TEQX 5IPZA 1AM6A 5HPJA 2NWOA 4YVYA 1TBTX 3TVOX 2Q1QA 4ZWIA 3M5SA 5A25A 5L6KA 1RZEA 1I8ZA 1HVAA 3MHIA 5FNLA 3MHCA 3RLDA 2X7UA 3M3XA 3KOKA 4TWMA 5SZ3A 3OIKA 1UGBA 3HKNA 4CNRA 5SZ2A 3RG4A 4Q0LA 4DZ9A 4Q81A 1FQRA 3RZ1B 1CZMA 4FL7A 4KNIA 2WD3A 3M98A 4CNWA 1UGFA 1V9EA 4ZWZA 1YDCA 3K2FA 4JSSA 3V2JA 4C3TA 1BN1A 4Q7VA 1IF9A 2WD2A 2VVBX 3IBNA 3M96A 4Q87A 3P5AA 1CVHA 5E2MA 1Y7WA 3IBUA 4WUQA 3B1BA 3ML2A 5FL6A 1RZCA 2AX2A 3PJJA 3SAPA 4YWPA 2EU3A 3PO6A 1IF6A 1G0EA 3M04A 1YO2A 3HS4A 1RJ5A 3P3HA 1I9NA 1CAYA 3DCCA 4Q83A 4WW6A 5BRWA 4QJXA 4BF1A 3D92A 5EZTX 3HKUA 1Z97A 1BNVA 2HOCA 4RUZA 1RZDA 4IDRX 3MNIA 12CAA 4RFDA 3NB5A 1THKA 1BNWA 4Z1NA 4ZWYA 4BCWA 4Q49A 1OQ5A 1RAYA 3V3HB 2CBEA 1J9WA 4Z0QA 3RZ7A 3KOIA 2NXSA 1RZAA 1FR4A 4Q07A 2FNMA 3DBUA 5BYIA 1DCBA 4E3GA 3MNHA 3Q31A 1CNGA 3S74B 9CA2A 3DCWA 5EHEA 5G0BA 1LG6A 3D8WA 4FPTA 1CNKA 3M2ZA 4ZAOA 1BCDA 3F8EA 5FNGA 4Z1JA 7CA2A 1HUHA 5FL5A 4Q7WA 1ZSCA 5DSLA 1BNQA 1TH9A 3HFPA 5SZ4A 5E2KA 3MMFA 5CACA 3RG3A 1ZSAA 2NNGA 5FLTA 3RYZA 1BNMA 1CNYA 1BNUA 1I9LA 4LP6A 1FSNA 5JGSB 1CAJA 4G0CA 2NWPA 1I9MA 4PYYA 4Q06A 1IF5A 1G1DA 3V3FA 1MUAA 5G03A 2NNSA 3M2XA 3KS3A 4CACA 4RFCA 4E49A 1HEBA 3MZCA 4QJOA 3BETA 2NMXA
chains in the Genus database with same CATH topology
3P4VA 4YXIA 3ML5A 2CBAA 3MNUA 5DSMA 5JQ0A 4MDLA 5FLOA 5E2RA 3JXGA 3BL0A 5E2SA 4QJMA 3D93A 4Q99A 3CA2A 5JEGB 2GEHA 1ZE8A 1Z93A 4GL1X 5SZ7A 4Y0JA 2FOQA 3BL1A 4Q78A 5FLPA 1H4NA 3RGEA 3VBDA 3OILA 2H4NA 1CVAA 1TB0X 3QYKA 5EHWA 2NN1A 3CYUA 1ZFKA 4Q90A 4WR7A 1AVNA 1ZGEA 4KP8A 4MTYA 5FNMA 4E9OX 5JG3B 1HEAA 4QJWA 2WEOA 1CNHA 4XIWA 2EU2A 1UGGA 1Z9YA 2ZNCA 1G4JA 4WL4A 3M67A 1IF7A 3DC3A 3HKQA 3MNKA 4N0XB 4CNXA 1G48A 1ZFQA 4KV0A 4R5AA 1CNBA 3N2PA 1KWRA 2CBBA 4LU3A 6CA2A 4ITOA 2POWA 4HEZA 1JV0A 4RH2A 2ABEA 4RUXA 4Q8YA 4QTLA 4YHAA 1CVFA 3MDZA 4JSZA 5SZ6A 1LG5A 1G6VA 3N3JA 2FOVA 2WEHA 4TWLA 1TTMA 3F4XA 2POVA 4RN4A 2HFWA 4K13A 3V7XA 1HEDA 3S8XA 4FVNA 1I9QA 5DOGA 3KIGA 4YXOA 4YGLA 4R59A 2HD6A 5DSRA 1UGEA 5DSOA 5FNKA 5EH8A 3U47A 1ZH9A 3M1KA 1I90A 4L5WA 3DVBA 4K1QA 1CINA 3V3GB 3IEOA 3F7BA 3JXHC 4FIKA 1KOPA 3ZP9A 5EOIA 3W6IA 5SZ5A 3GZ0A 4QIYA 1KWQA 1F2WA 1A42A 1I91A 3KLDB 4QEFA 1TE3X 1YDDA 2W2JA 4RIUA 5FLQA 5CA2A 1CNJA 1G53A 1UGDA 4E5QA 3OYQA 2H15A 2FW4A 3KNEA 3P58A 2FNKA 3IBIA 4Q8XA 1TG3A 3KONA 5JQTA 5SZ1A 4FRCA 1BICA 5DOHA 5CLUA 1HCAA 1XQ0A 1XEVA 4XIXA 2Q1BA 1CVEA 3S9TA 2OSMA 8CA2A 3MNAA 4HEYA 2AW1A 1ZSBA 4MDGA 5DSQA 1H9QA 2FOSA 4Q9YA 4E4AA 3MYQA 5CJFA 5BRUA 3SBHA 2OSFA 3T85A 1CAIA 4PZHA 3P55A 4ILXA 1YO1A 3EFTA 1G4OA 4M2WA 5FNIA 3RYVB 1T9NA 4QSIA 4QK2A 4UOVA 3MHLA 3W6HA 1YDAA 1G46A 4WW8A 5DSJA 1BN4A 1FSQA 4HEWA 3MHMA 4HT2A 5DSPA 1XPZA 4Q6EA 1LZVA 4HBAA 3SAXA 3OKUA 1RJ6A 3CZVA 3DD8A 1UGAA 4M2UA 1V9IC 4CQ0A 4QY3A 3HLJA 1BNNA 3V2MA 4ZX1A 1JCZA 2NXTA 5DSIA 5JESB 1OKNA 4MDMA 3MNJA 5AMLA 4M2RA 5DVXA 5G0CA 4RIVA 1CCSA 2NWZA 3IAIA 4KP5A 2CA2A 4Z1EA 3N0NA 1G3ZA 1CAZA 2FMZA 3JXFA 2NNVA 3T83A 5L3OA 1KEQA 3V5GA 4MLTA 4QK3A 3P44A 1CNWA 4Q08A 1G52A 3NJ9A 3S72B 3FE4A 5A6HA 1BZMA 4FU5A 3RJ7A 2NXRA 2HL4A 4ZX0A 3M2NA 5SZ0A 1HUGA 1CVDA 4RUYA 5EKJA 4Q6DA 3T5UA 1G0FA 5DSNA 3T5ZA 3U45X 1ZNCA 3FW3A 2X7TA 4E3HA 3DC9A 3OY0A 3C7PA 2O4ZA 4K0ZA 3S78B 1JD0A 3N4BA 1IF8A 5FDCA 3T82A 4MLXA 1I9PA 1EOUA 4QSJA 5LMDA 4KUWA 3DCSA 1YO0A 2VVAX 5FLRA 3RYJB 3RZ8A 1FQLA 4QJPA 4PXXA 1DCAA 4HF3A 3FFPX 4KUYA 1G54A 1BV3A 3RZ0B 4HT0A 2CABA 1FQNA 1FR7A 3D0NA 3MWOA 3ZNCA 2IT4A 4L5UA 2QOAA 3U7CA 5EKMA 3DA2A 3M5TA 4Q09A 5JEHB 3P3JA 3OKVA 3IBLA 1CCUA 4YGKA 1OKLA 1URTA 3S75B 2POUA 1CAKA 3RZ5A 4BF6A 2FMGA 3RYYA 1CRMA 3CAJA 2FOYA 3DD0A 4DZ7A 2X7SA 3EFIA 4Q8ZA 3DAZA 4QJ0A 4R5BA 3RYXB 3S76A 4JSWA 5FNHA 2HKKA 3IGPA 4M2VA 4XFWA 3TMJA 3TVNX 1DMYA 4G7AA 4JS6A 1CA2A 1HECA 5E28A 3R16A 1UGCA 3S73B 4QK1A 4K0SA 4KUVA 4FVOA 5G01A 1XEGA 3B4FA 4QIZA 4E3FA 5AMDA 1CCTA 1ZGFA 1BNTA 4IWZA 5EKHA 4XZ5A 4QSBA 5FL4A 5JEPB 1G45A 4PYXA 5E5RA 3KWAA 2FNNA 1RZBA 4COQA 4YYTA 5DRSA 4KAPA 4MO8A 3HKTA 3D9ZA 2WEJA 5J8ZA 2NN7A 1CA3A 1CRAA 3M1JA 3T84A 3DVDA 3U3AX 4L5VA 3K7KA 3S97A 2ILIA 1KOQA 1CILA 5DSKA 2NNOA 3P5LA 5C8IA 3SBIA 1LUGA 4YGNA 1CAOA 4LHIA 1FLJA 2CBCA 1CNXA 1CVCA 4KNNA 3OIMA 3LXEA 4ETQC 4WUPA 5EH7A 5FNJA 3V3JA 2HNCA 3NI5A 5E5UA 3V3IB 2CBDA 1CAHA 4ITPA 3M5EA 2FOUA 3DV7A 3UYQA 3M1WA 5FDIA 4KNMA 3M2YA 4E3DA 4CA2A 3DVCA 4KNJA 1IF4A 5JG5B 1CNCA 2QO8A 5FLSA 3R17B 1AZMA 2NWYA 2QP6A 4CNVA 4HU1A 4X5SA 2Q38A 5BRVA 4YGJA 5BNLA 4YXUA 3M40A 1CNIA 1BN3A 4XE1A 4N16A 1I9OA 1RAZA 4Q7SA 1CANA 3L14A 1FSRA 1YDBA 4JSAA 5JDVB 5E2NA 2WEGA 3K34A 3M1QA 4QSAA 3OYSA 3M14A 1DMXA 4ZWXA 3UYNA 2EZ7A 5EH5A 3KKXA 1CAMA 1HCBA 3PYKA 3S71B 1TG9A 1MOOA 4YGFA 2GD8A 1FQMA 4Q7PA 2F14A 1H9NA 1CALA 5AMGA 5EIJA 5JGTB 4PQ7A 3F7UA 1TEUX 4K0TA 1OKMA 3S77B 4Z1KA 1LGDA 5EHVA 3MHOA 4YX4A 1CIMA 1CVBA 1TEQX 5IPZA 1AM6A 5HPJA 2NWOA 4YVYA 1TBTX 3TVOX 2Q1QA 4ZWIA 3M5SA 5A25A 5L6KA 1RZEA 1I8ZA 1HVAA 3MHIA 5FNLA 3MHCA 3RLDA 2X7UA 3M3XA 3KOKA 4TWMA 5SZ3A 3OIKA 1UGBA 3HKNA 4CNRA 5SZ2A 3RG4A 4Q0LA 4DZ9A 4Q81A 1FQRA 3RZ1B 1CZMA 4FL7A 4KNIA 2WD3A 3M98A 4CNWA 1UGFA 1V9EA 4ZWZA 1YDCA 3K2FA 4JSSA 3V2JA 4C3TA 1BN1A 4Q7VA 1IF9A 2WD2A 2VVBX 3IBNA 3M96A 4Q87A 3P5AA 1CVHA 5E2MA 1Y7WA 3IBUA 4WUQA 3B1BA 3ML2A 5FL6A 1RZCA 2AX2A 3PJJA 3SAPA 4YWPA 2EU3A 3PO6A 1IF6A 1G0EA 3M04A 1YO2A 3HS4A 1RJ5A 3P3HA 1I9NA 1CAYA 3DCCA 4Q83A 4WW6A 5BRWA 4QJXA 4BF1A 3D92A 5EZTX 3HKUA 1Z97A 1BNVA 2HOCA 4RUZA 1RZDA 4IDRX 3MNIA 12CAA 4RFDA 3NB5A 1THKA 1BNWA 4Z1NA 4ZWYA 4BCWA 4Q49A 1OQ5A 1RAYA 3V3HB 2CBEA 1J9WA 4Z0QA 3RZ7A 3KOIA 2NXSA 1RZAA 1FR4A 4Q07A 2FNMA 3DBUA 5BYIA 1DCBA 4E3GA 3MNHA 3Q31A 1CNGA 3S74B 9CA2A 3DCWA 5EHEA 5G0BA 1LG6A 3D8WA 4FPTA 1CNKA 3M2ZA 4ZAOA 1BCDA 3F8EA 5FNGA 4Z1JA 7CA2A 1HUHA 5FL5A 4Q7WA 1ZSCA 5DSLA 1BNQA 1TH9A 3HFPA 5SZ4A 5E2KA 3MMFA 5CACA 3RG3A 1ZSAA 2NNGA 5FLTA 3RYZA 1BNMA 1CNYA 1BNUA 1I9LA 4LP6A 1FSNA 5JGSB 1CAJA 4G0CA 2NWPA 1I9MA 4PYYA 4Q06A 1IF5A 1G1DA 3V3FA 1MUAA 5G03A 2NNSA 3M2XA 3KS3A 4CACA 4RFCA 4E49A 1HEBA 3MZCA 4QJOA 3BETA 2NMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4V A;  4YXI A;  3ML5 A;  2CBA A;  3MNU A;  5DSM A;  5JQ0 A;  4MDL A;  5FLO A;  5E2R A;  3JXG A;  3BL0 A;  5E2S A;  4QJM A;  3D93 A;  4Q99 A;  3CA2 A;  5JEG B;  2GEH A;  1ZE8 A;  1Z93 A;  4GL1 X;  5SZ7 A;  4Y0J A;  2FOQ A;  3BL1 A;  4Q78 A;  5FLP A;  1H4N A;  3RGE A;  3VBD A;  3OIL A;  2H4N A;  1CVA A;  1TB0 X;  3QYK A;  5EHW A;  2NN1 A;  3CYU A;  1ZFK A;  4Q90 A;  4WR7 A;  1AVN A;  1ZGE A;  4KP8 A;  4MTY A;  5FNM A;  4E9O X;  5JG3 B;  1HEA A;  4QJW A;  2WEO A;  1CNH A;  4XIW A;  2EU2 A;  1UGG A;  1Z9Y A;  2ZNC A;  1G4J A;  4WL4 A;  3M67 A;  1IF7 A;  3DC3 A;  3HKQ A;  3MNK A;  4N0X B;  4CNX A;  1G48 A;  1ZFQ A;  4KV0 A;  4R5A A;  1CNB A;  3N2P A;  1KWR A;  2CBB A;  4LU3 A;  6CA2 A;  4ITO A;  2POW A;  4HEZ A;  1JV0 A;  4RH2 A;  2ABE A;  4RUX A;  4Q8Y A;  4QTL A;  4YHA A;  1CVF A;  3MDZ A;  4JSZ A;  5SZ6 A;  1LG5 A;  1G6V A;  3N3J A;  2FOV A;  2WEH A;  4TWL A;  1TTM A;  3F4X A;  2POV A;  4RN4 A;  2HFW A;  4K13 A;  3V7X A;  1HED A;  3S8X A;  4FVN A;  1I9Q A;  5DOG A;  3KIG A;  4YXO A;  4YGL A;  4R59 A;  2HD6 A;  5DSR A;  1UGE A;  5DSO A;  5FNK A;  5EH8 A;  3U47 A;  1ZH9 A;  3M1K A;  1I90 A;  4L5W A;  3DVB A;  4K1Q A;  1CIN A;  3V3G B;  3IEO A;  3F7B A;  3JXH C;  4FIK A;  1KOP A;  3ZP9 A;  5EOI A;  3W6I A;  5SZ5 A;  3GZ0 A;  4QIY A;  1KWQ A;  1F2W A;  1A42 A;  1I91 A;  3KLD B;  4QEF A;  1TE3 X;  1YDD A;  2W2J A;  4RIU A;  5FLQ A;  5CA2 A;  1CNJ A;  1G53 A;  1UGD A;  4E5Q A;  3OYQ A;  2H15 A;  2FW4 A;  3KNE A;  3P58 A;  2FNK A;  3IBI A;  4Q8X A;  1TG3 A;  3KON A;  5JQT A;  5SZ1 A;  4FRC A;  1BIC A;  5DOH A;  5CLU A;  1HCA A;  1XQ0 A;  1XEV A;  4XIX A;  2Q1B A;  1CVE A;  3S9T A;  2OSM A;  8CA2 A;  3MNA A;  4HEY A;  2AW1 A;  1ZSB A;  4MDG A;  5DSQ A;  1H9Q A;  2FOS A;  4Q9Y A;  4E4A A;  3MYQ A;  5CJF A;  5BRU A;  3SBH A;  2OSF A;  3T85 A;  1CAI A;  4PZH A;  3P55 A;  4ILX A;  1YO1 A;  3EFT A;  1G4O A;  4M2W A;  5FNI A;  3RYV B;  1T9N A;  4QSI A;  4QK2 A;  4UOV A;  3MHL A;  3W6H A;  1YDA A;  1G46 A;  4WW8 A;  5DSJ A;  1BN4 A;  1FSQ A;  4HEW A;  3MHM A;  4HT2 A;  5DSP A;  1XPZ A;  4Q6E A;  1LZV A;  4HBA A;  3SAX A;  3OKU A;  1RJ6 A;  3CZV A;  3DD8 A;  1UGA A;  4M2U A;  1V9I C;  4CQ0 A;  4QY3 A;  3HLJ A;  1BNN A;  3V2M A;  4ZX1 A;  1JCZ A;  2NXT A;  5DSI A;  5JES B;  1OKN A;  4MDM A;  3MNJ A;  5AML A;  4M2R A;  5DVX A;  5G0C A;  4RIV A;  1CCS A;  2NWZ A;  3IAI A;  4KP5 A;  2CA2 A;  4Z1E A;  3N0N A;  1G3Z A;  1CAZ A;  2FMZ A;  3JXF A;  2NNV A;  3T83 A;  5L3O A;  1KEQ A;  3V5G A;  4MLT A;  4QK3 A;  3P44 A;  1CNW A;  4Q08 A;  1G52 A;  3NJ9 A;  3S72 B;  3FE4 A;  5A6H A;  1BZM A;  4FU5 A;  3RJ7 A;  2NXR A;  2HL4 A;  4ZX0 A;  3M2N A;  5SZ0 A;  1HUG A;  1CVD A;  4RUY A;  5EKJ A;  4Q6D A;  3T5U A;  1G0F A;  5DSN A;  3T5Z A;  3U45 X;  1ZNC A;  3FW3 A;  2X7T A;  4E3H A;  3DC9 A;  3OY0 A;  3C7P A;  2O4Z A;  4K0Z A;  3S78 B;  1JD0 A;  3N4B A;  1IF8 A;  5FDC A;  3T82 A;  4MLX A;  1I9P A;  1EOU A;  4QSJ A;  5LMD A;  4KUW A;  3DCS A;  1YO0 A;  2VVA X;  5FLR A;  3RYJ B;  3RZ8 A;  1FQL A;  4QJP A;  4PXX A;  1DCA A;  4HF3 A;  3FFP X;  4KUY A;  1G54 A;  1BV3 A;  3RZ0 B;  4HT0 A;  2CAB A;  1FQN A;  1FR7 A;  3D0N A;  3MWO A;  3ZNC A;  2IT4 A;  4L5U A;  2QOA A;  3U7C A;  5EKM A;  3DA2 A;  3M5T A;  4Q09 A;  5JEH B;  3P3J A;  3OKV A;  3IBL A;  1CCU A;  4YGK A;  1OKL A;  1URT A;  3S75 B;  2POU A;  1CAK A;  3RZ5 A;  4BF6 A;  2FMG A;  3RYY A;  1CRM A;  3CAJ A;  2FOY A;  3DD0 A;  4DZ7 A;  2X7S A;  3EFI A;  4Q8Z A;  3DAZ A;  4QJ0 A;  4R5B A;  3RYX B;  3S76 A;  4JSW A;  5FNH A;  2HKK A;  3IGP A;  4M2V A;  4XFW A;  3TMJ A;  3TVN X;  1DMY A;  4G7A A;  4JS6 A;  1CA2 A;  1HEC A;  5E28 A;  3R16 A;  1UGC A;  3S73 B;  4QK1 A;  4K0S A;  4KUV A;  4FVO A;  5G01 A;  1XEG A;  3B4F A;  4QIZ A;  4E3F A;  5AMD A;  1CCT A;  1ZGF A;  1BNT A;  4IWZ A;  5EKH A;  4XZ5 A;  4QSB A;  5FL4 A;  5JEP B;  1G45 A;  4PYX A;  5E5R A;  3KWA A;  2FNN A;  1RZB A;  4COQ A;  4YYT A;  5DRS A;  4KAP A;  4MO8 A;  3HKT A;  3D9Z A;  2WEJ A;  5J8Z A;  2NN7 A;  1CA3 A;  1CRA A;  3M1J A;  3T84 A;  3DVD A;  3U3A X;  4L5V A;  3K7K A;  3S97 A;  2ILI A;  1KOQ A;  1CIL A;  5DSK A;  2NNO A;  3P5L A;  5C8I A;  3SBI A;  1LUG A;  4YGN A;  1CAO A;  4LHI A;  1FLJ A;  2CBC A;  1CNX A;  1CVC A;  4KNN A;  3OIM A;  3LXE A;  4ETQ C;  4WUP A;  5EH7 A;  5FNJ A;  3V3J A;  2HNC A;  3NI5 A;  5E5U A;  3V3I B;  2CBD A;  1CAH A;  4ITP A;  3M5E A;  2FOU A;  3DV7 A;  3UYQ A;  3M1W A;  5FDI A;  4KNM A;  3M2Y A;  4E3D A;  4CA2 A;  3DVC A;  4KNJ A;  1IF4 A;  5JG5 B;  1CNC A;  2QO8 A;  5FLS A;  3R17 B;  1AZM A;  2NWY A;  2QP6 A;  4CNV A;  4HU1 A;  4X5S A;  2Q38 A;  5BRV A;  4YGJ A;  5BNL A;  4YXU A;  3M40 A;  1CNI A;  1BN3 A;  4XE1 A;  4N16 A;  1I9O A;  1RAZ A;  4Q7S A;  1CAN A;  3L14 A;  1FSR A;  1YDB A;  4JSA A;  5JDV B;  5E2N A;  2WEG A;  3K34 A;  3M1Q A;  4QSA A;  3OYS A;  3M14 A;  1DMX A;  4ZWX A;  3UYN A;  2EZ7 A;  5EH5 A;  3KKX A;  1CAM A;  1HCB A;  3PYK A;  3S71 B;  1TG9 A;  1MOO A;  4YGF A;  2GD8 A;  1FQM A;  4Q7P A;  2F14 A;  1H9N A;  1CAL A;  5AMG A;  5EIJ A;  5JGT B;  4PQ7 A;  3F7U A;  1TEU X;  4K0T A;  1OKM A;  3S77 B;  4Z1K A;  1LGD A;  5EHV A;  3MHO A;  4YX4 A;  1CIM A;  1CVB A;  1TEQ X;  5IPZ A;  1AM6 A;  5HPJ A;  2NWO A;  4YVY A;  1TBT X;  3TVO X;  2Q1Q A;  4ZWI A;  3M5S A;  5A25 A;  5L6K A;  1RZE A;  1I8Z A;  1HVA A;  3MHI A;  5FNL A;  3MHC A;  3RLD A;  2X7U A;  3M3X A;  3KOK A;  4TWM A;  5SZ3 A;  3OIK A;  1UGB A;  3HKN A;  4CNR A;  5SZ2 A;  3RG4 A;  4Q0L A;  4DZ9 A;  4Q81 A;  1FQR A;  3RZ1 B;  1CZM A;  4FL7 A;  4KNI A;  2WD3 A;  3M98 A;  4CNW A;  1UGF A;  1V9E A;  4ZWZ A;  1YDC A;  3K2F A;  4JSS A;  3V2J A;  4C3T A;  1BN1 A;  4Q7V A;  1IF9 A;  2WD2 A;  2VVB X;  3IBN A;  3M96 A;  4Q87 A;  3P5A A;  1CVH A;  5E2M A;  1Y7W A;  3IBU A;  4WUQ A;  3B1B A;  3ML2 A;  5FL6 A;  1RZC A;  2AX2 A;  3PJJ A;  3SAP A;  4YWP A;  2EU3 A;  3PO6 A;  1IF6 A;  1G0E A;  3M04 A;  1YO2 A;  3HS4 A;  1RJ5 A;  3P3H A;  1I9N A;  1CAY A;  3DCC A;  4Q83 A;  4WW6 A;  5BRW A;  4QJX A;  4BF1 A;  3D92 A;  5EZT X;  3HKU A;  1Z97 A;  1BNV A;  2HOC A;  4RUZ A;  1RZD A;  4IDR X;  3MNI A;  12CA A;  4RFD A;  3NB5 A;  1THK A;  1BNW A;  4Z1N A;  4ZWY A;  4BCW A;  4Q49 A;  1OQ5 A;  1RAY A;  3V3H B;  2CBE A;  1J9W A;  4Z0Q A;  3RZ7 A;  3KOI A;  2NXS A;  1RZA A;  1FR4 A;  4Q07 A;  2FNM A;  3DBU A;  5BYI A;  1DCB A;  4E3G A;  3MNH A;  3Q31 A;  1CNG A;  3S74 B;  9CA2 A;  3DCW A;  5EHE A;  5G0B A;  1LG6 A;  3D8W A;  4FPT A;  1CNK A;  3M2Z A;  4ZAO A;  1BCD A;  3F8E A;  5FNG A;  4Z1J A;  7CA2 A;  1HUH A;  5FL5 A;  4Q7W A;  1ZSC A;  5DSL A;  1BNQ A;  1TH9 A;  3HFP A;  5SZ4 A;  5E2K A;  3MMF A;  5CAC A;  3RG3 A;  1ZSA A;  2NNG A;  5FLT A;  3RYZ A;  1BNM A;  1CNY A;  1BNU A;  1I9L A;  4LP6 A;  1FSN A;  5JGS B;  1CAJ A;  4G0C A;  2NWP A;  1I9M A;  4PYY A;  4Q06 A;  1IF5 A;  1G1D A;  3V3F A;  1MUA A;  5G03 A;  2NNS A;  3M2X A;  3KS3 A;  4CAC A;  4RFC A;  4E49 A;  1HEB A;  3MZC A;  4QJO A;  3BET A;  2NMX A; 
#chains in the Genus database with same CATH topology
 3P4V A;  4YXI A;  3ML5 A;  2CBA A;  3MNU A;  5DSM A;  5JQ0 A;  4MDL A;  5FLO A;  5E2R A;  3JXG A;  3BL0 A;  5E2S A;  4QJM A;  3D93 A;  4Q99 A;  3CA2 A;  5JEG B;  2GEH A;  1ZE8 A;  1Z93 A;  4GL1 X;  5SZ7 A;  4Y0J A;  2FOQ A;  3BL1 A;  4Q78 A;  5FLP A;  1H4N A;  3RGE A;  3VBD A;  3OIL A;  2H4N A;  1CVA A;  1TB0 X;  3QYK A;  5EHW A;  2NN1 A;  3CYU A;  1ZFK A;  4Q90 A;  4WR7 A;  1AVN A;  1ZGE A;  4KP8 A;  4MTY A;  5FNM A;  4E9O X;  5JG3 B;  1HEA A;  4QJW A;  2WEO A;  1CNH A;  4XIW A;  2EU2 A;  1UGG A;  1Z9Y A;  2ZNC A;  1G4J A;  4WL4 A;  3M67 A;  1IF7 A;  3DC3 A;  3HKQ A;  3MNK A;  4N0X B;  4CNX A;  1G48 A;  1ZFQ A;  4KV0 A;  4R5A A;  1CNB A;  3N2P A;  1KWR A;  2CBB A;  4LU3 A;  6CA2 A;  4ITO A;  2POW A;  4HEZ A;  1JV0 A;  4RH2 A;  2ABE A;  4RUX A;  4Q8Y A;  4QTL A;  4YHA A;  1CVF A;  3MDZ A;  4JSZ A;  5SZ6 A;  1LG5 A;  1G6V A;  3N3J A;  2FOV A;  2WEH A;  4TWL A;  1TTM A;  3F4X A;  2POV A;  4RN4 A;  2HFW A;  4K13 A;  3V7X A;  1HED A;  3S8X A;  4FVN A;  1I9Q A;  5DOG A;  3KIG A;  4YXO A;  4YGL A;  4R59 A;  2HD6 A;  5DSR A;  1UGE A;  5DSO A;  5FNK A;  5EH8 A;  3U47 A;  1ZH9 A;  3M1K A;  1I90 A;  4L5W A;  3DVB A;  4K1Q A;  1CIN A;  3V3G B;  3IEO A;  3F7B A;  3JXH C;  4FIK A;  1KOP A;  3ZP9 A;  5EOI A;  3W6I A;  5SZ5 A;  3GZ0 A;  4QIY A;  1KWQ A;  1F2W A;  1A42 A;  1I91 A;  3KLD B;  4QEF A;  1TE3 X;  1YDD A;  2W2J A;  4RIU A;  5FLQ A;  5CA2 A;  1CNJ A;  1G53 A;  1UGD A;  4E5Q A;  3OYQ A;  2H15 A;  2FW4 A;  3KNE A;  3P58 A;  2FNK A;  3IBI A;  4Q8X A;  1TG3 A;  3KON A;  5JQT A;  5SZ1 A;  4FRC A;  1BIC A;  5DOH A;  5CLU A;  1HCA A;  1XQ0 A;  1XEV A;  4XIX A;  2Q1B A;  1CVE A;  3S9T A;  2OSM A;  8CA2 A;  3MNA A;  4HEY A;  2AW1 A;  1ZSB A;  4MDG A;  5DSQ A;  1H9Q A;  2FOS A;  4Q9Y A;  4E4A A;  3MYQ A;  5CJF A;  5BRU A;  3SBH A;  2OSF A;  3T85 A;  1CAI A;  4PZH A;  3P55 A;  4ILX A;  1YO1 A;  3EFT A;  1G4O A;  4M2W A;  5FNI A;  3RYV B;  1T9N A;  4QSI A;  4QK2 A;  4UOV A;  3MHL A;  3W6H A;  1YDA A;  1G46 A;  4WW8 A;  5DSJ A;  1BN4 A;  1FSQ A;  4HEW A;  3MHM A;  4HT2 A;  5DSP A;  1XPZ A;  4Q6E A;  1LZV A;  4HBA A;  3SAX A;  3OKU A;  1RJ6 A;  3CZV A;  3DD8 A;  1UGA A;  4M2U A;  1V9I C;  4CQ0 A;  4QY3 A;  3HLJ A;  1BNN A;  3V2M A;  4ZX1 A;  1JCZ A;  2NXT A;  5DSI A;  5JES B;  1OKN A;  4MDM A;  3MNJ A;  5AML A;  4M2R A;  5DVX A;  5G0C A;  4RIV A;  1CCS A;  2NWZ A;  3IAI A;  4KP5 A;  2CA2 A;  4Z1E A;  3N0N A;  1G3Z A;  1CAZ A;  2FMZ A;  3JXF A;  2NNV A;  3T83 A;  5L3O A;  1KEQ A;  3V5G A;  4MLT A;  4QK3 A;  3P44 A;  1CNW A;  4Q08 A;  1G52 A;  3NJ9 A;  3S72 B;  3FE4 A;  5A6H A;  1BZM A;  4FU5 A;  3RJ7 A;  2NXR A;  2HL4 A;  4ZX0 A;  3M2N A;  5SZ0 A;  1HUG A;  1CVD A;  4RUY A;  5EKJ A;  4Q6D A;  3T5U A;  1G0F A;  5DSN A;  3T5Z A;  3U45 X;  1ZNC A;  3FW3 A;  2X7T A;  4E3H A;  3DC9 A;  3OY0 A;  3C7P A;  2O4Z A;  4K0Z A;  3S78 B;  1JD0 A;  3N4B A;  1IF8 A;  5FDC A;  3T82 A;  4MLX A;  1I9P A;  1EOU A;  4QSJ A;  5LMD A;  4KUW A;  3DCS A;  1YO0 A;  2VVA X;  5FLR A;  3RYJ B;  3RZ8 A;  1FQL A;  4QJP A;  4PXX A;  1DCA A;  4HF3 A;  3FFP X;  4KUY A;  1G54 A;  1BV3 A;  3RZ0 B;  4HT0 A;  2CAB A;  1FQN A;  1FR7 A;  3D0N A;  3MWO A;  3ZNC A;  2IT4 A;  4L5U A;  2QOA A;  3U7C A;  5EKM A;  3DA2 A;  3M5T A;  4Q09 A;  5JEH B;  3P3J A;  3OKV A;  3IBL A;  1CCU A;  4YGK A;  1OKL A;  1URT A;  3S75 B;  2POU A;  1CAK A;  3RZ5 A;  4BF6 A;  2FMG A;  3RYY A;  1CRM A;  3CAJ A;  2FOY A;  3DD0 A;  4DZ7 A;  2X7S A;  3EFI A;  4Q8Z A;  3DAZ A;  4QJ0 A;  4R5B A;  3RYX B;  3S76 A;  4JSW A;  5FNH A;  2HKK A;  3IGP A;  4M2V A;  4XFW A;  3TMJ A;  3TVN X;  1DMY A;  4G7A A;  4JS6 A;  1CA2 A;  1HEC A;  5E28 A;  3R16 A;  1UGC A;  3S73 B;  4QK1 A;  4K0S A;  4KUV A;  4FVO A;  5G01 A;  1XEG A;  3B4F A;  4QIZ A;  4E3F A;  5AMD A;  1CCT A;  1ZGF A;  1BNT A;  4IWZ A;  5EKH A;  4XZ5 A;  4QSB A;  5FL4 A;  5JEP B;  1G45 A;  4PYX A;  5E5R A;  3KWA A;  2FNN A;  1RZB A;  4COQ A;  4YYT A;  5DRS A;  4KAP A;  4MO8 A;  3HKT A;  3D9Z A;  2WEJ A;  5J8Z A;  2NN7 A;  1CA3 A;  1CRA A;  3M1J A;  3T84 A;  3DVD A;  3U3A X;  4L5V A;  3K7K A;  3S97 A;  2ILI A;  1KOQ A;  1CIL A;  5DSK A;  2NNO A;  3P5L A;  5C8I A;  3SBI A;  1LUG A;  4YGN A;  1CAO A;  4LHI A;  1FLJ A;  2CBC A;  1CNX A;  1CVC A;  4KNN A;  3OIM A;  3LXE A;  4ETQ C;  4WUP A;  5EH7 A;  5FNJ A;  3V3J A;  2HNC A;  3NI5 A;  5E5U A;  3V3I B;  2CBD A;  1CAH A;  4ITP A;  3M5E A;  2FOU A;  3DV7 A;  3UYQ A;  3M1W A;  5FDI A;  4KNM A;  3M2Y A;  4E3D A;  4CA2 A;  3DVC A;  4KNJ A;  1IF4 A;  5JG5 B;  1CNC A;  2QO8 A;  5FLS A;  3R17 B;  1AZM A;  2NWY A;  2QP6 A;  4CNV A;  4HU1 A;  4X5S A;  2Q38 A;  5BRV A;  4YGJ A;  5BNL A;  4YXU A;  3M40 A;  1CNI A;  1BN3 A;  4XE1 A;  4N16 A;  1I9O A;  1RAZ A;  4Q7S A;  1CAN A;  3L14 A;  1FSR A;  1YDB A;  4JSA A;  5JDV B;  5E2N A;  2WEG A;  3K34 A;  3M1Q A;  4QSA A;  3OYS A;  3M14 A;  1DMX A;  4ZWX A;  3UYN A;  2EZ7 A;  5EH5 A;  3KKX A;  1CAM A;  1HCB A;  3PYK A;  3S71 B;  1TG9 A;  1MOO A;  4YGF A;  2GD8 A;  1FQM A;  4Q7P A;  2F14 A;  1H9N A;  1CAL A;  5AMG A;  5EIJ A;  5JGT B;  4PQ7 A;  3F7U A;  1TEU X;  4K0T A;  1OKM A;  3S77 B;  4Z1K A;  1LGD A;  5EHV A;  3MHO A;  4YX4 A;  1CIM A;  1CVB A;  1TEQ X;  5IPZ A;  1AM6 A;  5HPJ A;  2NWO A;  4YVY A;  1TBT X;  3TVO X;  2Q1Q A;  4ZWI A;  3M5S A;  5A25 A;  5L6K A;  1RZE A;  1I8Z A;  1HVA A;  3MHI A;  5FNL A;  3MHC A;  3RLD A;  2X7U A;  3M3X A;  3KOK A;  4TWM A;  5SZ3 A;  3OIK A;  1UGB A;  3HKN A;  4CNR A;  5SZ2 A;  3RG4 A;  4Q0L A;  4DZ9 A;  4Q81 A;  1FQR A;  3RZ1 B;  1CZM A;  4FL7 A;  4KNI A;  2WD3 A;  3M98 A;  4CNW A;  1UGF A;  1V9E A;  4ZWZ A;  1YDC A;  3K2F A;  4JSS A;  3V2J A;  4C3T A;  1BN1 A;  4Q7V A;  1IF9 A;  2WD2 A;  2VVB X;  3IBN A;  3M96 A;  4Q87 A;  3P5A A;  1CVH A;  5E2M A;  1Y7W A;  3IBU A;  4WUQ A;  3B1B A;  3ML2 A;  5FL6 A;  1RZC A;  2AX2 A;  3PJJ A;  3SAP A;  4YWP A;  2EU3 A;  3PO6 A;  1IF6 A;  1G0E A;  3M04 A;  1YO2 A;  3HS4 A;  1RJ5 A;  3P3H A;  1I9N A;  1CAY A;  3DCC A;  4Q83 A;  4WW6 A;  5BRW A;  4QJX A;  4BF1 A;  3D92 A;  5EZT X;  3HKU A;  1Z97 A;  1BNV A;  2HOC A;  4RUZ A;  1RZD A;  4IDR X;  3MNI A;  12CA A;  4RFD A;  3NB5 A;  1THK A;  1BNW A;  4Z1N A;  4ZWY A;  4BCW A;  4Q49 A;  1OQ5 A;  1RAY A;  3V3H B;  2CBE A;  1J9W A;  4Z0Q A;  3RZ7 A;  3KOI A;  2NXS A;  1RZA A;  1FR4 A;  4Q07 A;  2FNM A;  3DBU A;  5BYI A;  1DCB A;  4E3G A;  3MNH A;  3Q31 A;  1CNG A;  3S74 B;  9CA2 A;  3DCW A;  5EHE A;  5G0B A;  1LG6 A;  3D8W A;  4FPT A;  1CNK A;  3M2Z A;  4ZAO A;  1BCD A;  3F8E A;  5FNG A;  4Z1J A;  7CA2 A;  1HUH A;  5FL5 A;  4Q7W A;  1ZSC A;  5DSL A;  1BNQ A;  1TH9 A;  3HFP A;  5SZ4 A;  5E2K A;  3MMF A;  5CAC A;  3RG3 A;  1ZSA A;  2NNG A;  5FLT A;  3RYZ A;  1BNM A;  1CNY A;  1BNU A;  1I9L A;  4LP6 A;  1FSN A;  5JGS B;  1CAJ A;  4G0C A;  2NWP A;  1I9M A;  4PYY A;  4Q06 A;  1IF5 A;  1G1D A;  3V3F A;  1MUA A;  5G03 A;  2NNS A;  3M2X A;  3KS3 A;  4CAC A;  4RFC A;  4E49 A;  1HEB A;  3MZC A;  4QJO A;  3BET A;  2NMX A; 
#chains in the Genus database with same CATH homology
 3P4V A;  4YXI A;  3ML5 A;  2CBA A;  3MNU A;  5DSM A;  5JQ0 A;  4MDL A;  5FLO A;  5E2R A;  3JXG A;  3BL0 A;  5E2S A;  4QJM A;  3D93 A;  4Q99 A;  3CA2 A;  5JEG B;  2GEH A;  1ZE8 A;  1Z93 A;  4GL1 X;  5SZ7 A;  4Y0J A;  2FOQ A;  3BL1 A;  4Q78 A;  5FLP A;  1H4N A;  3RGE A;  3VBD A;  3OIL A;  2H4N A;  1CVA A;  1TB0 X;  3QYK A;  5EHW A;  2NN1 A;  3CYU A;  1ZFK A;  4Q90 A;  4WR7 A;  1AVN A;  1ZGE A;  4KP8 A;  4MTY A;  5FNM A;  4E9O X;  5JG3 B;  1HEA A;  4QJW A;  2WEO A;  1CNH A;  4XIW A;  2EU2 A;  1UGG A;  1Z9Y A;  2ZNC A;  1G4J A;  4WL4 A;  3M67 A;  1IF7 A;  3DC3 A;  3HKQ A;  3MNK A;  4N0X B;  4CNX A;  1G48 A;  1ZFQ A;  4KV0 A;  4R5A A;  1CNB A;  3N2P A;  1KWR A;  2CBB A;  4LU3 A;  6CA2 A;  4ITO A;  2POW A;  4HEZ A;  1JV0 A;  4RH2 A;  2ABE A;  4RUX A;  4Q8Y A;  4QTL A;  4YHA A;  1CVF A;  3MDZ A;  4JSZ A;  5SZ6 A;  1LG5 A;  1G6V A;  3N3J A;  2FOV A;  2WEH A;  4TWL A;  1TTM A;  3F4X A;  2POV A;  4RN4 A;  2HFW A;  4K13 A;  3V7X A;  1HED A;  3S8X A;  4FVN A;  1I9Q A;  5DOG A;  3KIG A;  4YXO A;  4YGL A;  4R59 A;  2HD6 A;  5DSR A;  1UGE A;  5DSO A;  5FNK A;  5EH8 A;  3U47 A;  1ZH9 A;  3M1K A;  1I90 A;  4L5W A;  3DVB A;  4K1Q A;  1CIN A;  3V3G B;  3IEO A;  3F7B A;  3JXH C;  4FIK A;  1KOP A;  3ZP9 A;  5EOI A;  3W6I A;  5SZ5 A;  3GZ0 A;  4QIY A;  1KWQ A;  1F2W A;  1A42 A;  1I91 A;  3KLD B;  4QEF A;  1TE3 X;  1YDD A;  2W2J A;  4RIU A;  5FLQ A;  5CA2 A;  1CNJ A;  1G53 A;  1UGD A;  4E5Q A;  3OYQ A;  2H15 A;  2FW4 A;  3KNE A;  3P58 A;  2FNK A;  3IBI A;  4Q8X A;  1TG3 A;  3KON A;  5JQT A;  5SZ1 A;  4FRC A;  1BIC A;  5DOH A;  5CLU A;  1HCA A;  1XQ0 A;  1XEV A;  4XIX A;  2Q1B A;  1CVE A;  3S9T A;  2OSM A;  8CA2 A;  3MNA A;  4HEY A;  2AW1 A;  1ZSB A;  4MDG A;  5DSQ A;  1H9Q A;  2FOS A;  4Q9Y A;  4E4A A;  3MYQ A;  5CJF A;  5BRU A;  3SBH A;  2OSF A;  3T85 A;  1CAI A;  4PZH A;  3P55 A;  4ILX A;  1YO1 A;  3EFT A;  1G4O A;  4M2W A;  5FNI A;  3RYV B;  1T9N A;  4QSI A;  4QK2 A;  4UOV A;  3MHL A;  3W6H A;  1YDA A;  1G46 A;  4WW8 A;  5DSJ A;  1BN4 A;  1FSQ A;  4HEW A;  3MHM A;  4HT2 A;  5DSP A;  1XPZ A;  4Q6E A;  1LZV A;  4HBA A;  3SAX A;  3OKU A;  1RJ6 A;  3CZV A;  3DD8 A;  1UGA A;  4M2U A;  1V9I C;  4CQ0 A;  4QY3 A;  3HLJ A;  1BNN A;  3V2M A;  4ZX1 A;  1JCZ A;  2NXT A;  5DSI A;  5JES B;  1OKN A;  4MDM A;  3MNJ A;  5AML A;  4M2R A;  5DVX A;  5G0C A;  4RIV A;  1CCS A;  2NWZ A;  3IAI A;  4KP5 A;  2CA2 A;  4Z1E A;  3N0N A;  1G3Z A;  1CAZ A;  2FMZ A;  3JXF A;  2NNV A;  3T83 A;  5L3O A;  1KEQ A;  3V5G A;  4MLT A;  4QK3 A;  3P44 A;  1CNW A;  4Q08 A;  1G52 A;  3NJ9 A;  3S72 B;  3FE4 A;  5A6H A;  1BZM A;  4FU5 A;  3RJ7 A;  2NXR A;  2HL4 A;  4ZX0 A;  3M2N A;  5SZ0 A;  1HUG A;  1CVD A;  4RUY A;  5EKJ A;  4Q6D A;  3T5U A;  1G0F A;  5DSN A;  3T5Z A;  3U45 X;  1ZNC A;  3FW3 A;  2X7T A;  4E3H A;  3DC9 A;  3OY0 A;  3C7P A;  2O4Z A;  4K0Z A;  3S78 B;  1JD0 A;  3N4B A;  1IF8 A;  5FDC A;  3T82 A;  4MLX A;  1I9P A;  1EOU A;  4QSJ A;  5LMD A;  4KUW A;  3DCS A;  1YO0 A;  2VVA X;  5FLR A;  3RYJ B;  3RZ8 A;  1FQL A;  4QJP A;  4PXX A;  1DCA A;  4HF3 A;  3FFP X;  4KUY A;  1G54 A;  1BV3 A;  3RZ0 B;  4HT0 A;  2CAB A;  1FQN A;  1FR7 A;  3D0N A;  3MWO A;  3ZNC A;  2IT4 A;  4L5U A;  2QOA A;  3U7C A;  5EKM A;  3DA2 A;  3M5T A;  4Q09 A;  5JEH B;  3P3J A;  3OKV A;  3IBL A;  1CCU A;  4YGK A;  1OKL A;  1URT A;  3S75 B;  2POU A;  1CAK A;  3RZ5 A;  4BF6 A;  2FMG A;  3RYY A;  1CRM A;  3CAJ A;  2FOY A;  3DD0 A;  4DZ7 A;  2X7S A;  3EFI A;  4Q8Z A;  3DAZ A;  4QJ0 A;  4R5B A;  3RYX B;  3S76 A;  4JSW A;  5FNH A;  2HKK A;  3IGP A;  4M2V A;  4XFW A;  3TMJ A;  3TVN X;  1DMY A;  4G7A A;  4JS6 A;  1CA2 A;  1HEC A;  5E28 A;  3R16 A;  1UGC A;  3S73 B;  4QK1 A;  4K0S A;  4KUV A;  4FVO A;  5G01 A;  1XEG A;  3B4F A;  4QIZ A;  4E3F A;  5AMD A;  1CCT A;  1ZGF A;  1BNT A;  4IWZ A;  5EKH A;  4XZ5 A;  4QSB A;  5FL4 A;  5JEP B;  1G45 A;  4PYX A;  5E5R A;  3KWA A;  2FNN A;  1RZB A;  4COQ A;  4YYT A;  5DRS A;  4KAP A;  4MO8 A;  3HKT A;  3D9Z A;  2WEJ A;  5J8Z A;  2NN7 A;  1CA3 A;  1CRA A;  3M1J A;  3T84 A;  3DVD A;  3U3A X;  4L5V A;  3K7K A;  3S97 A;  2ILI A;  1KOQ A;  1CIL A;  5DSK A;  2NNO A;  3P5L A;  5C8I A;  3SBI A;  1LUG A;  4YGN A;  1CAO A;  4LHI A;  1FLJ A;  2CBC A;  1CNX A;  1CVC A;  4KNN A;  3OIM A;  3LXE A;  4ETQ C;  4WUP A;  5EH7 A;  5FNJ A;  3V3J A;  2HNC A;  3NI5 A;  5E5U A;  3V3I B;  2CBD A;  1CAH A;  4ITP A;  3M5E A;  2FOU A;  3DV7 A;  3UYQ A;  3M1W A;  5FDI A;  4KNM A;  3M2Y A;  4E3D A;  4CA2 A;  3DVC A;  4KNJ A;  1IF4 A;  5JG5 B;  1CNC A;  2QO8 A;  5FLS A;  3R17 B;  1AZM A;  2NWY A;  2QP6 A;  4CNV A;  4HU1 A;  4X5S A;  2Q38 A;  5BRV A;  4YGJ A;  5BNL A;  4YXU A;  3M40 A;  1CNI A;  1BN3 A;  4XE1 A;  4N16 A;  1I9O A;  1RAZ A;  4Q7S A;  1CAN A;  3L14 A;  1FSR A;  1YDB A;  4JSA A;  5JDV B;  5E2N A;  2WEG A;  3K34 A;  3M1Q A;  4QSA A;  3OYS A;  3M14 A;  1DMX A;  4ZWX A;  3UYN A;  2EZ7 A;  5EH5 A;  3KKX A;  1CAM A;  1HCB A;  3PYK A;  3S71 B;  1TG9 A;  1MOO A;  4YGF A;  2GD8 A;  1FQM A;  4Q7P A;  2F14 A;  1H9N A;  1CAL A;  5AMG A;  5EIJ A;  5JGT B;  4PQ7 A;  3F7U A;  1TEU X;  4K0T A;  1OKM A;  3S77 B;  4Z1K A;  1LGD A;  5EHV A;  3MHO A;  4YX4 A;  1CIM A;  1CVB A;  1TEQ X;  5IPZ A;  1AM6 A;  5HPJ A;  2NWO A;  4YVY A;  1TBT X;  3TVO X;  2Q1Q A;  4ZWI A;  3M5S A;  5A25 A;  5L6K A;  1RZE A;  1I8Z A;  1HVA A;  3MHI A;  5FNL A;  3MHC A;  3RLD A;  2X7U A;  3M3X A;  3KOK A;  4TWM A;  5SZ3 A;  3OIK A;  1UGB A;  3HKN A;  4CNR A;  5SZ2 A;  3RG4 A;  4Q0L A;  4DZ9 A;  4Q81 A;  1FQR A;  3RZ1 B;  1CZM A;  4FL7 A;  4KNI A;  2WD3 A;  3M98 A;  4CNW A;  1UGF A;  1V9E A;  4ZWZ A;  1YDC A;  3K2F A;  4JSS A;  3V2J A;  4C3T A;  1BN1 A;  4Q7V A;  1IF9 A;  2WD2 A;  2VVB X;  3IBN A;  3M96 A;  4Q87 A;  3P5A A;  1CVH A;  5E2M A;  1Y7W A;  3IBU A;  4WUQ A;  3B1B A;  3ML2 A;  5FL6 A;  1RZC A;  2AX2 A;  3PJJ A;  3SAP A;  4YWP A;  2EU3 A;  3PO6 A;  1IF6 A;  1G0E A;  3M04 A;  1YO2 A;  3HS4 A;  1RJ5 A;  3P3H A;  1I9N A;  1CAY A;  3DCC A;  4Q83 A;  4WW6 A;  5BRW A;  4QJX A;  4BF1 A;  3D92 A;  5EZT X;  3HKU A;  1Z97 A;  1BNV A;  2HOC A;  4RUZ A;  1RZD A;  4IDR X;  3MNI A;  12CA A;  4RFD A;  3NB5 A;  1THK A;  1BNW A;  4Z1N A;  4ZWY A;  4BCW A;  4Q49 A;  1OQ5 A;  1RAY A;  3V3H B;  2CBE A;  1J9W A;  4Z0Q A;  3RZ7 A;  3KOI A;  2NXS A;  1RZA A;  1FR4 A;  4Q07 A;  2FNM A;  3DBU A;  5BYI A;  1DCB A;  4E3G A;  3MNH A;  3Q31 A;  1CNG A;  3S74 B;  9CA2 A;  3DCW A;  5EHE A;  5G0B A;  1LG6 A;  3D8W A;  4FPT A;  1CNK A;  3M2Z A;  4ZAO A;  1BCD A;  3F8E A;  5FNG A;  4Z1J A;  7CA2 A;  1HUH A;  5FL5 A;  4Q7W A;  1ZSC A;  5DSL A;  1BNQ A;  1TH9 A;  3HFP A;  5SZ4 A;  5E2K A;  3MMF A;  5CAC A;  3RG3 A;  1ZSA A;  2NNG A;  5FLT A;  3RYZ A;  1BNM A;  1CNY A;  1BNU A;  1I9L A;  4LP6 A;  1FSN A;  5JGS B;  1CAJ A;  4G0C A;  2NWP A;  1I9M A;  4PYY A;  4Q06 A;  1IF5 A;  1G1D A;  3V3F A;  1MUA A;  5G03 A;  2NNS A;  3M2X A;  3KS3 A;  4CAC A;  4RFC A;  4E49 A;  1HEB A;  3MZC A;  4QJO A;  3BET A;  2NMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...