3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
1ZEDA 3NKMA 3A52A 2XRGA 4UORA 4ZG6A 3UN2A 1ELYA 1ALHA 4QAXA 4CXSA 5IJQA 2W5VA 1P49A 1EJJA 3BDGB 4UPKA 4CYSA 4UOOA 3IDDA 1ELZA 5KXAA 3T02A 5L0EA 5L0KA 2W5XA 1AJCA 4KJDA 4ZGAA 3BDFA 2W8DA 5GRRA 4LR2A 4GTXA 5TJ3A 1B8JA 4CXUA 2IUCA 5K4PA 3WAWA 5L0BA 1ZEBA 4LR9A 4LRAA 3NKRA 3WAXA 3E2DA 1E1ZP 5EGEA 5DLVA 3KD8A 4LRFA 2W5RA 5GOVA 1EW8A 1ALIA 2W5SA 1KH7A 3WAVA 1EW9A 1KHLA 4UOPA 3SZYA 3M8WA 4NWXA 1AUKA 5LIAA 4LR8A 3M7VA 1ELXA 2W5QA 3BDHA 4ZG9A 4ZG7A 1EQJA 3IGYB 3MK1A 3UNYA 4GTWA 5LQQA 3CMRA 2W5TA 4GTYA 4GTZA 2W8SA 1KH9A 4TN0A 4UPHA 2GSNA 3UO0A 3LXQA 1ALJA 2ANHA 1ALKA 2X98A 3DYCA 1ED8A 1N2LA 1E2SP 4KJGA 2D1GA 3BDGA 3MK0A 5HRTA 3NKNA 5INHA 1ANIA 1O98A 4FDIA 4MIVA 3TWZA 4KAYA 3Q3QA 1KHKA 1SHQA 3B5QA 4LRBA 1FSUA 3T00A 4MY4A 1HJKA 2G9YA 1ANJA 3OT9A 4LQYA 3NVLA 2IUCB 3ED4A 3WAYA 1N2KA 3M8YA 5IJSA 1KH4A 4LR7A 2VQRA 4LRCA 4B56A 1E3CP 2GLQA 5EGHA 3UN3A 1URAA 2RH6A 2XR9A 1SHNA 4YR1A 2IFYA 1HDHA 2GSOA 3DPCA 4CXKA 5LRNA 1EI6A 4LRDA 5LRMA 4LREA 3SZZA 4KAVA 1KH5A 3NKOA 4FDJA 1Y7AA 4UPIA 3TX0A 5C66A 5DLWA 1URBA 1EW2A 2GSUA 1AJAA 2W5WA 2GA3A 3NKQA 2ZKTA 4MHXA 3WBHA 2QZUA 3TG0A 1E33P 1O99A 3M8ZA 1AJBA 4N7TA 1Y6VA 1ZEFA 4KM4A 5AJ9A 3IGZB 5DLTA 1HQAA 4UPLA 3UN5A 3T01A 1AJDA 4CYRA 1KHNA 3NKPA 1K7HA 1ED9A 1KHJA 4NWJA 3MK2A
chains in the Genus database with same CATH superfamily
2CDQA 2P6SA 3LALA 2V8PA 3HF5A 1Q8KA 1UW9A 4PWWA 3TZWA 2DY9A 2ZBRA 2MEWA 3HULA 2HG4A 3Q8VA 4ZP8A 3UQSA 1FNOA 4YB7A 4ES1A 5KG2A 3IRXB 3LANA 1PILA 4TQRA 4DLEA 1RE1B 3AJ1A 4GVBB 3TA2A 1Y3KA 3DYAB 4OYZA 4RNMA 2Y1IA 3Q8UA 2BYCA 4NA1A 1LV5A 2HFUA 2AWZA 4DFMA 3R5DA 4FYVB 2VQFJ 1C0TB 3IDDA 3MM9A 1ZH5A 1GMWD 2P9EA 4GRSA 1AJCA 1GMVA 4B3SF 2GVDA 3MECB 1C1BA 1TMJA 1RA6A 2F4FA 1TL1A 1CBKA 1S99A 5DG9A 2OP5A 3IWLA 4X66F 2HK2A 1RTHA 2OKQA 2ATCB 3TQ1A 1ZZFA 3NOCA 4RUAA 3BKTA 1ZEBA 3UCGA 1RT6A 3V4IA 5C42B 2VONA 2ZH8A 3D6MB 2LEAA 3OQ2A 4JI5F 2DGOA 1LEOA 3PO4A 2FGCA 4KQZA 2ZH5A 1YITS 1RT5B 2RRAA 3RRKA 1VK8A 4Z2XA 1G3OA 3RB3A 1TFWA 4I2QA 1RADB 4ZVRB 1CJVA 4ANDA 4OJHA 3QRPA 1EQ0A 3DM2B 3FC9A 3EMTA 3T1AA 4LBPA 2HZAA 1EJ7L 1YZ6A 3GV8B 3NS7B 1KRPA 4NWJA 3J81U 4ZCMA 1IKYA 1RHJB 3AB4B 3FUYA 3LTOA 1HBMA 4LR8A 3L95X 4WWSA 5AXLA 4U8VA 1G1XA 2UUWA 2RDIA 4NLXA 5DM6Q 5KFOA 1FKAF 1RI7A 2DCLA 3LQVA 4C4WA 3M8QA 2W7OA 1LWFA 1TL3B 3IP0A 3MMCB 1WF2A 3OR1A 3JSMB 4E98A 2W8SA 1K47A 1G6BA 2CNLB 3SV3A 5AXMA 3ILLA 3UO0A 4ALZA 4DXLA 2AEMA 1RU2A 1HI8A 3POTA 4R8UA 3ENQA 1KS2A 4ERDA 1MMDA 3QGPA 5IQ6A 1NKCA 1N2LA 1RAFB 4JI6J 4DR4J 3DOMA 5J2QA 1PJ5A 1SJ1A 1X5PA 3PTWA 2XULA 2C28A 1H73A 4DWIA 4UOCA 4JI2J 4M94A 2XYPB 1TUGB 1IXKA 2WVCA 1FDAA 5SUHA 2DEJA 1IBMJ 4USVA 2C2KB 3EGZA 2E5GA 2K1RB 3MUVP 3A4TA 4BC9A 1XMBA 1VRUA 3D0GE 3KXDA 2NSBA 1VGYA 2IPOB 1RTDB 2IMOA 5IWAF 2I0XA 5L1IA 1Z1ZA 4NZ6A 3N79A 4MK8A 5ADZA 2VOOA 4EBCA 2JLEA 1VQYA 5AT1B 3HT0A 2OEJA 7FDRA 5B09A 1RQ0A 1IKVB 3EE3A 4P7VA 3L7OA 4CLPA 2RU9A 1AW0A 3P5BP 2XZTB 1ZBTA 3EZOA 4NCGB 3WQPA 4DCOB 1T95A 1HQEB 2UVRA 1HDHA 3TVZA 1NB7A 3H90A 2Y0BB 2CVEA 3QO9A 2KG0A 1JXLA 4O4GA 4YB6A 5E3CA 1J2VA 1G4CA 4LUBA 4B3OA 3K59A 2LXUA 2WBMA 3THPA 4FS2A 5DQIA 3F56A 3ZZZA 3V4IB 5J2MB 4CTAA 4LT6A 1M5HA 1RWMB 1WF0A 2BR0A 3RBEA 1T9XA 4DPXA 2HAIA 4ENOA 5EGYA 5KFNA 3KTQA 1WDDA 2HFSA 1R8HA 3CD6S 5D4PA 4F0HA 4OX9F 1V9OA 1EQMA 2VG5A 3RB0A 3MMAB 4NLUA 2BJ3A 4D3HA 1R6VA 3KLHB 3KHLA 1L3UA 1WKJA 4AQYF 1I6JA 4N41A 2E7XA 2JOQA 4NXNJ 1SUQB 3BV8A 1ED9A 1S0VA 3IBFB 3QAEA 4O3OA 3C14B 2ZWPA 2F8EX 4RBVA 4H4MB 3T1HJ 1GTHA 2V9WA 1S1XA 1X9SA 1WI8A 1SL0A 5H9FJ 2JFDA 3SBMA 4JI4F 5E7OB 1SJ3P 1CJUB 3HSZA 1U0HA 1NDCA 5RUBA 2F4VF 4OI1A 3EDRB 4EUVA 1FX4A 2EFGA 3D2WA 2KFZA 2YTCA 5CAAA 3OTBA 1RHQB 2ERRA 2AQ4A 2R2RA 3Q8RB 3EICA 1UEVA 1WTFA 2GHVC 2XWYA 5K4PA 5F3ZA 1YGYA 1ZM4A 3W5YA 5KFKA 3KG1A 5EHHA 4JBCA 2MGZA 3BO4A 1UWBA 2YWKA 5AE2A 3CJ3A 2WHOA 4OZNA 2MMYA 4DHVA 2Y1JA 2R7VA 2VBWA 4YN3B 1EW8A 2CPYA 2WZ1A 2CPXA 2QZ8A 4CO0A 1MROA 3IMQJ 2AU0A 3FCHA 1NK9A 1PC5A 1DFDA 1S9GA 1Q8IA 3PNIA 4ITSA 3THVA 3D0HE 4YDDB 1S9GB 3EGNA 3LP0A 4NOHA 4KSEB 2F3JA 2C42A 3PYEA 1FF2A 1BQXA 2LDIA 2CJBA 3W7BA 1AA1B 2J0XA 4B17A 4UY8T 4U67Q 3B8HA 1NH8A 1RAHB 1REGX 2KHCA 4WK3A 5D3GB 1OQ3A 3TVKA 3DLBA 3CCZA 4USUA 3QSYB 4P71A 3FZ2A 5HVGA 4TVAB 3WIVA 4F50A 4DU8A 1MSWD 5ETTA 5C7PA 3W60A 2DR8A 4KIAA 4NX9A 4P73A 5E0OA 1H98A 2FJEB 2PMWA 3TYTA 2EBGA 5JMNA 3NGTA 4OYOA 4O0NA 4FVCA 5KG3A 5F8HA 2K7KA 4O4RA 5J2NA 1I51B 2XMJA 3B54A 3HD1A 1TAQA 4DUZJ 4ECWA 1T11A 4DL3A 3ZTRA 3VGSA 2OLWA 3SSRA 3IRXA 5I42A 1VQ8S 1V3ZA 1FD2A 4FF4A 1SHQA 2OUGA 1P8GA 1HBOA 2ASYA 3UR3C 3ZZPA 3ZZTA 4C11B 3GV7B 5DGAA 1K8AT 2CJYB 2R7SA 4EU0A 2OTLS 2LQ5A 3VGUA 3I5AA 2XBPA 4HL9A 2FDNA 2D41A 5J1EB 4DQIA 1TFYA 3E2EA 2CKWA 1YVFA 4QU7A 3W66A 4NZ7A 3ED4A 1LFWA 4CLUA 4D3GA 1IKXB 1MN9A 2HGMA 2GVDB 1S9EB 2LU1A 1BQNB 2VH7A 4M63A 1Y3JA 4ZVGA 2XCPA 2JH3A 4W98A 4DPUA 2HPUA 2QLBB 4JI2F 4CH1A 1VQLS 2HAFA 2AHOB 2YWHA 3D28A 3MGJA 3R6GB 4DUZF 2C2EA 5KAKA 1N8RT 2VQRA 1UJ5A 4FKXA 4KH1B 1NEEA 2O5DA 3JTNA 2VF3A 3H25A 3L9ZA 4QCLA 2XMKA 1VQPS 2DIUA 3QBCA 2YKNA 1HKAA 3FRYA 3PXGa 3K17A 5L1KA 1SV5B 1CSJA 1XBWA 3MM6A 4KH0B 5M2UA 2LQ8A 2VG7B 3BBCA 1Y5IB 2CXEA 4O44B 3UCZP 2NXEA 5F8MA 4PAAA 4OZJA 3OSPA 1X31C 2M9KA 1TL4A 4PZVA 1UEKA 4UOGA 4JI0J 1CJTB 3MTJA 1CC7A 4FDFA 4TY8A 1UFLA 4QW8A 1KC8T 4K59A 4DU7A 3PHTA 5LMUF 4EZ6A 4YMEA 4ANEA 2VODA 1U1NA 4UY85 3WDOA 4LIRA 1CULB 2HQ3A 4AYBD 1KOOA 1DQ8A 3EVOA 5F3TA 3S7RA 4URQU 4ZITA 5K8NA 3B78A 3MD1A 3MPVA 2E1CA 4PUOB 2XS7A 2V4JB 2FJDB 1RT2B 1MMLA 3N28A 3VV2B 4DR5J 1SH2A 1NZAA 1XMOF 1UPMB 4DZ6A 5LJ3Y 1RUSA 4DN0A 1A0OB 4X66J 2OEMA 1R8PA 2J8AA 1FESA 5D77A 3BSCA 4CRJA 5AXNA 5KFQA 3NKRA 1B99A 5GADU 2WK4A 1NLKL 2RHSB 4QZVB 1YSJA 5DETA 2DO4A 2EK1A 3V6DB 3MM7A 1Q8LA 1CVJA 1SB6A 4ZGAA 3E01B 3MAQA 4AL6A 4BHQA 2WSEC 4J9OA 2JC1A 2JLGA 4JI1J 4X4RA 4M5MA 4A8KA 4C9DA 1OJ4A 3TI0A 3I31A 3UDCA 4Z37A 3AB2B 3FQKA 3VAKA 1N0UA 4NXNF 2CJ9A 1Y11A 2RS2A 2UUBJ 4FBTA 2AJQA 4A4JA 2HVHA 2FHJA 3QGGA 3QT5A 4AL5A 3PRDA 4NEZA 3QLHB 1S1TB 2ZNYA 2F9DA 1FTCA 1S1TA 4OYAA 1MWZA 2XCAA 2VU5A 3BGLA 5IQQA 5U47A 4PYDA 4J5OA 2HQIA 4BCAA 3CJSA 3FNNA 1VDHA 2DH7A 3GJQB 1RWOB 4LVNP 4UQTA 2ZJRQ 3QNWB 3M30A 2I38A 5KG7A 2VB6A 3NP5A 3POTB 2CQ3A 2GIQA 4F2SA 4ZKAA 4GTYA 2Y8YA 2ZH1A 2V4RA 2ZZMA 5F8JA 3HLUA 2RNEA 2UXCF 2ACMA 4NYOA 2O1PA 5EN1A 2MKYA 1KVIA 1ALKA 1HQ2A 1QJHA 3DYCA 2QA1A 2V2KA 5A2QU 3SEOA 1R27B 2FVRA 1E2SP 1SQEA 2G0JA 3TANA 1Y4ZB 4ICLA 5GADI 2YXLA 3W64A 5DDPC 1U0HB 2V8VA 2MPUA 2NZCA 2L41A 3Q3QA 2PSZA 3QQCD 3HK2A 2N3LA 2KKHA 1RWWB 2RILA 4C0BA 1U1LA 1U6BA 3BR9A 2GIRA 5DGBA 3HZGA 2IUCB 4OI6A 2E5IA 1ZS6A 2U2FA 4DLGA 2OMLA 4RW8A 1FK9B 2AKWB 4MKYA 3MM5B 3P49B 2KYZA 2ZOGA 3C6UA 1HMVB 5CZVA 2PT0A 4CLKA 3G8SA 1JWWA 2VFUA 1QD1A 2W01A 3VGVA 2OIHA 4OZ1A 3DM2A 1U1MA 1FRIA 4OLOA 3MM7B 1TVRB 3G4SS 1PBUA 3HZEA 4U9RA 2R8GA 3HHNB 1KKHA 1TELA 2MZTA 1WKKA 2ZHOA 3RZAA 1NK8A 1M5KC 1AUDA 1YJNS 4ZVEA 2VJUA 1JLBA 2R2TA 4DV1J 2F8MA 3G87A 2IRXA 4NYZA 3DCAA 3MUTP 1QUPA 5C24B 2JWNA 1Q5YA 1SXLA 4C0OC 2J8SA 2XMMA 4J37A 4BC7A 3KHRA 1WG1A 5KFSA 5CZXA 5CYQB 3Q83A 4QOTA 4I6YA 3TA1A 2HS4A 3T19A 1PIEA 3M8ZA 2R7WA 4M5JA 1SIWB 1WEYA 3KG4A 4QIEA 2MHEA 2MB0B 5A6PA 2DNPA 4KM4A 4ZN3A 3RRGA 2F8HA 2CPZA 4RW8B 1R0AB 1NNDA 2GHPA 2J9CA 3FBCA 3MEGA 2RQCA 5HQMA 1J5EF 4G6VB 5MAOA 1D9FA 1R8CA 3QPIA 3ZZUA 1VR6A 4DV2J 3OW2R 1Z2ZA 3DOLA 4KO0A 3S1TA 4EO8A 5DM7Q 2XSJB 1SH3A 2DH8A 3TOQA 4NLGA 4QWAA 4UORA 1YJRA 3L7UA 4ZPDA 4LFAJ 1TVRA 5C2GA 3H40A 3NAHA 2RDJA 4HYKA 5CQGA 3CCJS 1PGZA 4F26A 4C8MA 2CQCA 3BGUA 1AB8A 2FZKB 3BDEA 3L09A 1FERA 1YBUA 2Z56B 4ZVTB 3EPGA 4I67A 4CM2A 2HFZA 1FDDA 2ILZA 2X3DA 4QWDA 3DLHA 4JV5J 3T41A 3VTIA 3P8BB 2IM0A 3I0SA 4R8UB 2N4DA 2IUCA 4C0HA 2M52A 3R5GA 5HK4A 5AJ3F 1L5UA 1D8YA 2J6TA 3LO3A 2YX7A 4PG5A 4OHWA 3JXOA 3ITHB 1QM9A 3ZZRA 1P27B 3C16A 3KLFB 2RE1A 3TNVA 5B0BA 3KK1A 4CO4A 1YIJS 4GKKJ 4KKOB 4NMLA 3RAXA 4DUYF 1N36F 2R3VA 5AE1A 1SH0A 5K8PA 1L3SA 4YR0A 1LW2B 4J91A 4MK7A 1HYSB 1X9MA 4BWJA 1ROFA 1FFGB 2GMHA 2XG8A 1WOPA 5KFRA 2PGCA 2R8HA 1LWXA 1VHFA 3GP9A 3NCPA 2XSJA 4DF8A 2H65B 3UE2A 4C6AA 1UWBB 2GA7A 3U7JA 3EGVA 4U6PA 5EDWA 4YY3J 2H9ZA 2X7IA 4OZ5A 1D09B 2CPJA 4JB8B 3NMRA 1WC4A 3DRXA 1JLQA 1RT7B 4AUKA 3MR6A 4DV3J 2ASLA 4GTZA 3MMAA 3KLHA 4NLTA 4WPAA 3TX8A 2D3OR 1NSPA 2R7UA 4TN0A 1HBMB 2BANB 2JSXA 4PXDA 2ZBQA 4USHA 3ISND 3TUJC 2CVIA 4QW9A 2JEJA 1RKIA 3GIRA 4OX8A 1HL6A 1HQUA 3QIDA 1CJUA 4L73A 4P2MA 2C22A 2QSFA 1LOUA 3E3XA 3NY0A 3P6YC 4ZN1A 2ZWOA 4TU8A 4JI3J 3A3NB 3LAKA 5J2MA 4LF8F 2G2OA 4FDIA 2KFNA 4YDXA 2MQQA 1C4CA 2GQQA 3EWGA 3UDEA 1OSDA 2R4FA 3D1HA 1JKHB 2RUSA 4M1KA 1URRA 4USTA 1O0PA 4DR1F 1IBKF 4ED0A 4OYIA 1KEKA 3BO2A 4LQYA 4U95A 2ZBIA 4PQAA 4P2XA 3SFUA 4B08A 3B4DA 2FJVA 1VQOS 2NS1B 3EVWA 5IFMA 4IOCQ 1XNRJ 1FA0A 4W90B 2X1FA 5A6WA 2UXBJ 4CDIA 1N2KA 2VPWB 3QGHA 2RQMA 5C5JA 3JYTB 2FYXA 4NPOA 2IA0A 4P72A 2KVIA 2MKIA 1GXTA 4MT1A 9ATCB 3HHDA 2R7XA 1HHQA 2G2ZA 1VRUB 3LP0B 1RTDA 1T7PA 1XNQF 3QJLA 1JLBB 2BJ9A 2Q66A 3GYXB 2PEHA 2ZDPA 5I3PA 3RGIA 5HJYA 2R2SA 1H74A 1X0PA 5E5NA 1CJTA 5HMXA 4XPCA 1Q7YT 2IFXA 2C2RA 1E6VB 2KZZA 2V4JA 5J1NA 1P9YA 3GONA 4DV6J 1LFPA 4NCGA 4RX6A 4K4UA 4F4ZA 1TKTA 4J7CA 1JLFA 1S6QB 1RWNB 2CAJA 2V9KA 7FD1A 5HN0A 4FBUA 4IH7A 2P9CA 3K57A 3OV7A 3W8GA 3EGWB 1TZ0A 3T1YF 4OV6A 3UVJB 5A0YB 1RAGB 4NCBA 5L39A 2Q43A 3NKYA 4IOBA 1PG5B 2HNYA 1SIZA 1U8SA 2YQ3A 3D0IE 2XMAA 2GNKA 2BOAA 5F9LA 2DNMA 2AEFA 1Q78A 1RYSA 1YJUA 3R5JB 3IN5A 1JLEA 3CCMS 2ZE2A 1T9WA 5HROA 3GYNA 4H4OA 2IDEA 3MK2A 1SKRA 4MYUA 2HIYA 3A52A 4EBEA 3RYLA 4EI2A 2ZZTA 2VFRA 1ALHA 5HQ8A 2XQCA 2AIRB 1VIXA 2X1GA 4OZLA 1DHMA 4LMZA 1JMTA 3DLKB 3C15A 2VQEJ 1VQ7S 1S0NA 2Q1LA 5ETQA 3BDFA 1S9EA 2W8DA 2EVZA 2CPHA 4GTXA 3P45B 2V50A 3PCOB 2UUCJ 2XWXA 1L3KA 2JL9A 3T9ZA 3A8EA 3TVYA 4OL8A 1HMVA 2PO4A 3L3CA 5BJRA 3ONQA 4QIFA 3HXMA 3MMBB 1KWMA 1NK5A 4IH5A 2AV5A 4Y00A 4NI2A 3OXGA 2QA4S 2O67A 3BYPA 4QJVA 3W61A 3OTOJ 2RKIB 2FZCB 2VPZB 2XEXA 1H0HB 1S6UA 3D5MA 3CJ5A 4KY3A 4WP3A 3V6JA 3ETMA 3BQ0A 2ZFHA 3S01A 1NPKA 3IXQA 4OJGA 5KFBA 1S97A 2VFSA 4MAKA 4ZLNA 5CCMA 5A8RA 4OYXA 4JUZA 2RQKA 3CULA 1EP4A 3SZYA 4DR3J 3BYRA 3OL8A 2RRBA 3HHLA 3MAAB 2BDPA 3R5AA 4WU3A 4F3MA 1JLQB 1RT7A 1S4FA 4TYAA 2KVQE 1BC6A 3ITHA 2GHWA 1BWVA 4ZVOB 4F7VA 3KNAA 1JLGA 4BWMA 4ETZA 1KH9A 4RW4A 2FHKA 1JLGB 3BQ2A 3D54A 2J9EA 2LVWA 2PEBA 1RYRA 4DR6J 2GS8A 3JSRA 2E5HA 2PE8A 1F9FA 2G4BA 1T9UA 3CD0A 1Y5NB 4F2RA 2Q6CA 3W9JA 3BH6B 1OS5A 2VL1A 1HWIA 5CABA 3BO3A 3BDGA 3J7YI 2BOPA 5INHA 4GVLA 5LSRA 2BKNA 5HROB 3T6BA 4F3OA 1KHKA 2FHOB 2EG1A 3ILJA 4NLWA 2HBQB 5F8LA 5KT2A 6AT1B 1FD8A 4B9VA 1C4AA 3CDAA 2QLJB 1QAXA 3SMZA 3W2WA 3VAJA 2GVZA 2QV6A 2DXEA 2L9DA 2OO4A 4RNFA 1R7IA 3QT6A 1SUQA 3I0SB 1HBUA 3HVTB 3J7ZT 1VQKS 3A1YG 3AT1B 3R3TA 4EMDA 4K4TA 1NK6A 3GCWP 2MJUA 4I7FA 5BR8F 1PAEX 5B0CA 4RW6B 1FJEB 1URNA 1E3CP 2K2PA 2QG9B 4OQJA 2LFVA 4QR0A 4DSJA 2XHWA 4QYZK 4YR1A 3OPKA 1RWPB 2RF2A 3C15B 1TMMA 2ROGA 2ROEA 1DAXA 4URGA 4RBTA 1RT1B 2E7VA 3I5CA 4CTAB 3DLLQ 3NKOA 1NAQA 1O6XA 3UCUP 2FTRA 2ZDOA 2DGWA 1Q81T 1E6YA 2HBYB 3GLJA 1IQZA 1IKWB 4ANCA 4RUHA 4WF9Q 3CDBA 4RLEA 4IG0B 2DO0A 1XC9A 2VG5B 3JYTA 1CQMA 3H2VE 3KJNB 3O5TB 4CM0A 1ZPWX 3B4MA 3G6XA 4C8YA 2MQPA 2ZC3A 3OL7A 1FO1A 1CULA 2EEYA 5HI7A 1NSKL 4DBQA 5C2CA 1Y6VA 4OHXA 1GFWB 2A6MA 4LF7F 3W3SA 3TRGA 1KBRA 3M2VA 3PO5A 4G1QA 4USKA 2YKPA 3A3OB 4ER8A 5H9EK 5CXTA 3T01A 1X4CA 3O2IA 2UUBF 1FJGJ 2Z2ZA 2ZOFA 1HBOB 2ZNZA 4N77A 1NBEB 4C11A 5SZTA 2YKOA 2B3TB 2B9EA 4WP9A 4ZIVA 4JI1F 2YWFA 4H54A 2C3YA 4F4AA 1HWJA 2ZVIA 3M6XA 2ZHAA 4ZVQB 4ZLLA 1ULRA 3U1MA 3ENVA 2HQDA 5L0EA 2BA9A 3RAQA 4ELVA 2CUYA 3A8JA 3DXBA 2FVSA 1PAUB 3ZZOA 4KJDA 1WG4A 2CJAA 1FK9A 1H3DA 4I56A 4LSLA 2W7PA 2AD9A 3MM5A 4AL7A 4NXMF 1R6YA 3BR8A 3AFGA 3GE9A 2E1AA 1U49A 1B8JA 1S1WA 3HVTA 4FYWB 4MKAA 2MKKA 4LRAA 2JEGA 4K0KJ 1NJYA 1DY3A 1S4EA 1IJFB 3PACA 4UZBA 2F9JA 1SJFA 1YX2A 2C2ZB 2HVZA 2JRSA 2RDDA 3A12A 1GNKA 3CJTA 3DNCA 2WTFA 3ETOA 4LRFA 4WFBQ 3JB9k 2VA2A 5A8KA 2ALZA 4HHUA 2FJBB 1VRTB 1I94J 3AOAA 1H2VZ 4JI8F 2MHNA 4HHJA 2C2MB 4CNYA 1U24A 4LVOP 1X4FA 1N4LA 2RUGA 5EUHA 3CCLS 1JLAB 1U2RA 4ZHRB 2FZGB 1QSSA 4Q43A 2IVFB 2CPEA 3DLEA 3CO0P 1KN6A 4FYYB 4IOAQ 4OLPA 3KLFA 4OI2A 4DSIA 3QLHA 2FC9A 3LP2A 4RW4B 2FVCA 1AUSL 3O6QA 5F9NA 4LF2A 4X64J 2K3IA 2YQ0A 1HHSA 4KV8B 4MH8A 5LQQA 3KDNA 1ICEB 2YWWA 4PXCA 4QWBA 1FHTA 1KLMA 1VC6A 1YRTA 5GVQA 5IT4A 1ZAXA 1P6TA 2A0FB 1HI1A 1AZSB 3DFEA 2EW9A 1NDKA 1CG2A 5GMDA 2V69A 2FLPA 1X4DA 1UETA 3G8QA 4IG0A 3GR1A 3AOCA 4JV2A 4O3RA 1F2GA 1CQNA 4A8YA 4WE1B 3AY0A 2I9SA 3CT9A 5B08A 3MFHA 4G1IA 1FE4A 4Q7AA 5FLXY 2NR0A 3KHGA 1VCTA 2IRUA 2Y8WA 4ED5A 3T00A 1KTVA 3R9LA 2HGLA 1FRMA 3O8WA 1S76D 1RTHB 3MCOA 4CH0S 1OQ6A 2ZJPQ 1IQTA 3OXFA 3NLCA 3KK1B 3MZIA 4WFNQ 1F9EB 2YVSA 1X7VA 2E1MC 3AA8A 1YRXA 3FGVA 1WUUA 1Q16B 3LP2B 4KGMA 3IWNC 3N6MA 5KFCA 3PR5B 2BM1A 2AYGA 3G6ES 2HFVA 3NG8A 3UVJA 1EETA 5EWEA 3FSXA 1U25A 2FB0A 3KUHA 3CDWA 3TJ9A 7AT1B 3FSIA 2W9AA 2Z58B 4DR6F 5K5MA 2VPXB 3BKFA 1U09A 1K0VA 1W26A 2VC1A 3SZZA 1VOMA 3WX4A 1MG7A 3I5BA 1GAOA 2PD1A 2QN6B 1Y7PA 2KTQA 4OJ3A 5FJ4A 1P1LA 6FD1A 1JLEB 1QTMA 2FLNA 1H38A 2OPSA 4OHYA 3N4WA 4PG8A 2HKEA 4B3RJ 2C2DA 4QYZJ 3LGHA 4XPEA 2LLZA 2V68A 3G6YA 2AGQA 4FP9A 4ZPTR 3U1LA 1FDNA 5GAGU 2DD8S 1YRUA 1AJBA 1LWCA 2PMZD 2GJ2A 2QYGA 4PEOA 2LMIA 4HTJA 4K5RA 4ZP6A 5GAEU 1FWLA 5IT9Y 2H1YA 3CDEA 5CYQA 3OSNA 1VQ6S 3PW0A 1Q5VA 1XN9A 2KT3A 4QPXA 4GC6A 2IVMA 3H5UA 3MR2A 3M30B 2NUUG 1NHKL 2APOA 3FKBA 3N6NA 5F41A 3ZC4A 2VBYA 3DLJA 4QWEA 4NLPA 2AJ0A 2F65A 2BABA 4FKYA 1R43A 4ID5B 4OYBA 2GQ2A 1JKHA 5K14B 1S48A 3UN2A 4F4KA 2BE9B 4NXMJ 2HQGA 4MFBB 1R0AA 4QAXA 5IJQA 2DNKA 3M2RB 2JDJA 5HO4A 2EWHA 4ZK7M 2CADA 2IAJA 4CYSA 1U1OA 1ELZA 1T9TA 3F0NA 2VQFF 1TKDA 3CO9A 3R2CJ 3TJ8A 1WC5A 2BX6A 2LP4A 2G2YA 3LH2S 4P6QA 4ZVUB 4DCPB 4LR2A 4ZPBA 1U45A 3CIZA 1RWXB 4NLVA 2CRLA 4HH1A 1Z2LA 2M5YA 2E66A 2UV8A 3H98A 4I7FB 4LR9A 4PWUA 4CLYA 1BMQB 2AX1A 1Q1KA 4F36A 1S10A 2V63A 4DZDA 4CCHA 1ACMB 4KJIA 3OFHA 5IC6B 3KNGA 4L6V3 3KD8A 1K44A 1FNMA 3HT3A 4LF4F 1TQLA 1S59A 4KPCA 2MSSA 3CCVS 1SC4B 2N7YA 3RU0A 1DTTB 4WYWA 1WELA 2AGPA 5DDOC 2M88A 4ZHRA 3KUGA 2IJNA 1KHLA 4RWWA 4HKQA 1M5OC 5D4OA 4CI0B 1BHNA 3FCWA 5M2PA 2XLIA 1FKOB 4NI2B 4DV7F 3MR3A 1KLMB 4N76A 1FRKA 1XWLA 3IG1A 1DQAA 1HARA 5FDLB 3OHAA 2OSRA 1IR1A 3PX6A 4KC5A 1GXUA 3GJRB 2CFXA 2CQIA 2UXDJ 2XM3A 5DZ6A 1B0VA 1F3FA 1R89A 3DN9A 1N33J 3CCTA 2MZ1A 2VIHA 3KUEA 1KQSR 1BWEA 3LXQA 1S1VA 1IN0A 2CWKA 2H4WB 4O3QA 4RJVA 1ED8A 2K06A 4K4WA 2BJEA 2BM0A 4GVBA 3HHLB 3MAAA 5B7WA 1Y9OA 3H42A 5E2QA 4BDPA 1V3SA 4C98A 4DX7A 3PW7A 3DRPB 4QQBA 5HMZA 5IWAJ 3KK2B 1TK5A 1GH8A 4MIBA 1N5TA 1EHWA 1JNRB 2XY6A 3B5QA 2Z0GA 2AX0A 4K2JA 1AXQA 4C97A 1TP7A 4AXJA 2LEBA 4KAIA 1DURA 4LSNB 4WCEQ 4RNNA 4ED8A 1YJ7A 4C8ZA 2XC9A 2CG8A 4WFAQ 1IBMF 3CJ8A 1KONA 4WKYA 4WFZA 3FBBA 1EETB 3KOAA 4I6WA 3J81j 4YB1P 4B9SA 5HL7Q 1SL1A 3JAMU 4JI3F 1Q8BA 4I64A 2U1AA 3AHPA 3I56S 3DGVA 4LR7A 4CLZA 4B56A 1IJEB 4A8XA 2DVIA 1RAOA 4JYAF 5LL6d 1SHNA 3VAHA 1PJ6A 4Y6IA 4KGXB 5THWA 1SQGA 5A8RB 1B70B 5E33A 2OD4A 5ITHA 3R7NB 3DKDA 1N5YA 3LA0A 2KXNB 2DHXA 2V4QA 5C24A 4N8OA 1DTTA 4U7UK 5HANA 3TZYA 1WWHA 1Y7AA 4LF5F 4UPIA 1KD1T 2DR5A 4DSLA 2HEKA 4RW9B 4A8FA 1RZMA 3IC1A 5BYQA 4K4YA 3M9NB 1F5CA 1WC3A 5KG4A 3WX8A 3M32A 5HSPA 4O0IA 3Q8QB 1LQ9A 4WP8A 3G9CA 2H5JB 3RR7A 3EXYA 3Q24A 4IO1A 2M7SA 4S0MA 1RGVA 4NA2A 3PKYA 2NXJA 4DR3F 1U1QA 1VYAA 1VJQA 2RVJA 2CZVC 1MU2B 1XERA 2HNYB 4XIUA 4ED6A 4DG1A 3WIUA 1N52B 4NMXA 3K5MA 1M1KT 2LEPA 3HI9A 1UKUA 2BV3A 5AE3A 3C8YA 4J9PA 2X1AA 3ZZYA 4M5GA 1YJWS 4JI5J 1GTEA 1NSQA 1C0UB 3OTOF 3HFZB 5ETVA 4ID5A 4CT9A 3O3LA 2C2NA 2K1RA 4M5NA 3W8PA 4C3LA 4E8UA 2BQRA 2YKQA 1HNIA 2LKZA 3SFGA 1UJ4A 4ZJLA 4H4KA 2DHHA 1VS3A 4DFJA 2HRTA 4YUDA 3DRPA 4ZVHA 1U02A 8AT1B 1QUVA 4N5SA 2YKMA 1WSRA 1WDTA 2L48A 2V5HG 4DOZA 5HLFB 3BN7A 1UP1A 8RUCA 1RT4B 3QRRA 3K8VA 4MKBA 4URSA 4LFCF 1FTRA 3VAMA 1OY8A 2KL8A 2LDYA 2V67A 1S72S 1TK8A 3HVWA 3WAWA 4KFBB 2MXYA 2ABYA 2B0GA 2EKNA 2QLWA 3F44A 3MTKA 3DRRA 3UDLA 1RHRB 5KT4A 2N7CA 1IKXA 3SV4A 1YHQS 3MPUB 2HHUA 5HP1A 1QE1A 3CC4S 4J9NA 2HMIB 1KOHA 1FX2A 1U6FA 2CZ4A 4Z7CA 3G71S 1F3VA 5BXIA 2OELA 5ETKA 4DF4A 4PG4A 2VICA 3G6VA 3KLVA 1DJ0A 4OYPA 2V94A 4ZA1A 3CXCR 4CLFA 1U1KA 2J9DA 3VQSA 3PRVA 3U1NA 3RTVA 3T1YJ 2MQLA 3T5KA 3LP1B 3T5HA 1NCLA 4KGVB 3LF0A 4NWXA 1K1SA 2E5LJ 3CJKA 3CMES 4V19X 1S77D 1S79A 1RB0A 5DJBA 3GJTB 4X64F 2P6TA 3QGIA 4ECYA 2DR6A 3MK1A 1NK0A 4DX8H 4LBIA 1RBOB 3N5FA 2HYIB 3LWLA 2BW7A 3VQTA 3PIPQ 1AYEA 3FBEA 3MCNA 1BXNA 1EAYC 1WEZA 4UOHA 1JIHA 4C3MA 3ENWA 2MLYA 4ZPAA 1JJCB 3DI6B 3M6VA 5DLGA 4DG1B 4ILLA 5KT6A 4DFPA 1LXNA 2D9OA 5J1PA 1XR7A 2DNQA 4JYAJ 3VWSA 5I42B 1XMQF 2AF6A 1H6KX 1Y0HA 2DTJA 3CJ2A 3HO1A 3CJQA 3DLKA 3D3CJ 3MXHP 2YH0A 3T5LA 3E51A 4N8NA 3MHYA 2HRYA 2I6WA 2NQPA 1KTQA 1CEZA 3ET6B 1M5VC 2JNJA 3AQPA 2KO1A 5DQHA 2EG2A 5DDRC 1HJKA 2D3ZA 3GG1A 3KHHA 3OT9A 2VG6A 2ADBA 4R25A 4DR1J 3PJXA 2C3OA 4YS2A 3DDKA 4DL5A 2DBBA 2A3JA 2HVIA 2Z2LA 4LF8J 2D9PA 4RW6A 2RB7A 2ZH4A 1RK8A 2HK3A 4MJKA 2HFNA 2LQJA 1REVA 2VA3A 4E2FB 5KFFA 2CA9A 3EJMA 1NJXA 4QYRA 2ATLA 1HBUB 4USIA 1LK5A 1RLCL 3G86A 2DNRA 5LM7E 3SIPB 3ZTOA 3KLEB 3RR8A 2UXDF 1QY7A 2NUHA 2OFGX 2F1FA 4ZCKA 3MEEA 2J0WA 4OHVA 5DG8A 3C66A 2HVEA 2RF2B 4FF2A 1XMOJ 3HKWA 1XIQA 3R8YA 4AE5A 4DV7J 4BBYA 4M5KA 1TV6B 4DL7A 2VFTA 5CA5A 2J7UA 2C1EB 4NCAA 2ZC4A 4DL4A 3D6FB 2W1BA 2V6AA 1T05B 4GKJF 1RWVB 1KFSA 1T05A 2A6OA 1N56A 1HPZB 1ZAWA 5DQGA 5LMNF 2OPRA 1UL3A 3AODA 1NDPA 1D1UA 3BGFA 3IGZB 2DIVA 2RS8A 2GJIA 2OPSB 2V2QA 1L3VA 4LF4J 1GXLA 1CC8A 1N5VA 3IO1A 3FRZA 1JLCA 3MM8A 4C3KA 3TUPA 1U8WA 4CYUB 1UW4A 2YPZA 2OHDA 1IVZA 2FQQB 2VDHA 2YNFB 2G0IA 4KYZA 2E1RA 4LIWA 2XRGA 3DMJB 4HT5A 4ED3A 3QFHA 3KG0A 2B9YA 5KFXA 2ASDA 3BBBA 3NNAA 1XJWB 1DARA 4UPKA 4YFUA 3LGMA 2BE2B 3IR6B 4PXEA 1N48A 1FXRA 1QAJA 4HVZA 4IKAA 3ZNUA 2VV5A 3LGNA 4LFAF 1AZSA 3TEGA 2XGPA 4A8WA 3IG1B 1IR0A 5HBMA 4ZLPA 1E1ZP 2VHGA 2GIFA 2Y0SD 4DV2F 5GAEI 2DRDA 2W5RA 5GMKa 3QWPA 4A48A 4Q45A 3GU0A 1DLOB 2DY1A 4FPIA 2H54B 5KT5A 3IRWP 2L3MA 1DLOA 3K5OA 4KR0B 1KH7A 3ISNC 1EW9A 3QSIA 5G0RA 4GO7X 3UDVA 3AA9A 2PMHA 2RT3A 4LQ9A 3M8RA 3V81B 2XS5A 1QLNA 1BD6A 4ZIWA 2HHHJ 1VQ5S 1TTHB 2BANA 2QGFB 3ZO7A 1OMSA 2Q79A 3CCES 1BGXT 3IM8A 4QWCA 2MLXA 5L1JA 1QE1B 1LW0A 3R5CA 4I69A 1X5SA 3IAM9 2PIIA 3P4UB 5KG5A 4TKTA 3BSOA 3NGRA 3TUIC 1VQ9S 1HPZA 2LQ9A 1AUKA 3TAMB 3UD5A 5E3AA 4ZS6A 1WORA 2PFDA 4LBHA 2WVEA 2ZJQQ 3QYYA 2XY5A 1SKWA 4MK9A 4MFBA 3GSIA 3NWGA 3HM9A 1TV6A 1TL7B 2HWHA 2Z57B 5HRTA 2M2BA 4ID8A 3QIPA 4IDKB 1O98A 5CD4H 4FYXB 4X62F 1HNIB 4QPTA 4KHMA 4RO0A 1TUWA 3CEDA 3MF5A 3X3UA 4L3NA 5C25B 1CPZA 2DHSA 1NHVA 3BB5A 3C14A 2M70A 2KHDA 1JX4A 3SCLE 4ECQA 4F3QA 4GC7A 3EUNA 5IV3A 2FUG9 2OJ3A 3RBXA 2JZ5A 2HQFA 4X4PA 1HIYA 5B0DA 2MKSA 2RH3A 1REVB 3D66A 1M1GA 3BGOP 1IR2A 2MTLA 3OR2B 4USMA 3I0RB 1TL1B 3DGPA 3I96A 2UVVA 2H3EB 1BQNA 4HI2A 4P9SA 3LWMA 3M1VA 2HFOA 4KGZB 4Q8EA 1ZEDA 2YQ1A 3HKZD 2HNZB 3F73A 2DH9A 1ZZNA 5EX3A 4LRDA 2M3DA 3MAHA 2GFFA 1G7CB 3D9BA 4DS4A 2M0GB 1RCXB 4WK1A 1IKWA 5BYRA 4CT8A 4MKVA 3WBZA 1E6YB 3GFHA 3HFKA 2JFKA 1PYTA 1SPBP 1HWKA 1N88A 2B4UA 2BKOA 3IM9A 4NLYA 4OI4A 1WJ9A 5A8WA 2XZWA 3K0JA 2GA3A 4W92B 1V6HA 2YKAA 2FHJD 3NGUA 2DNOA 1W2BR 1EIYB 4Y2KA 1J27A 5IM0B 2OPRB 1O99A 3NKQA 3IS9A 5LXRA 5F0WA 5HMWA 1GMWA 2B8PA 3KLIA 3J7AN 1UWAA 4JI8J 1T0TV 1Q4RA 2CQGA 3H20A 3UD3P 1UVIA 2FPHX 2X51A 3U27A 4DR7J 1N32F 2QL7B 2WVFA 3DMJA 2W9CA 3I9V9 4NRTA 1OY9A 1AFJA 1IBLJ 1XQIA 1B4SA 4XDDA 1N5YB 1FRXA 3BM7A 4C8OA 4GMKA 4OI0A 1RSCA 4TU7A 3GV5B 1HW9A 3US5A 2DPIA 1ELYA 4IDKA 4RW7B 2WVDA 1P49A 3VVTA 1B0PA 3T02A 1GX6A 3SQOP 3D68A 2HLTA 1S6OA 1UJ6A 3DOKB 4NZ0A 4TXSA 3DU6A 4WIIA 2F4VJ 2DKOB 1Q86T 1HWLA 4YQWA 2DJWA 1EB0A 1S1VB 4UOFA 1F60B 3W63A 2ILYA 4DQSA 4C7QA 2LECA 3T1HF 3QFWA 2W24A 1GK8A 2Q3PA 2GVZB 1IM6A 2HNDA 4B3TF 3A8KA 1VFJA 1YJVA 1MNEA 1QAYA 2G0CA 3AH6A 4HHHA 4WTYA 3VVUA 5C25A 5J2PB 4XO0A 3OL6A 4AQYJ 2HQCA 3AD8C 5HAOA 1JLAA 1DRZA 1RT4A 4V19J 1TL5A 2MQNA 2MZRA 2NCKL 4F25A 1BUXA 1IKYB 5D0RA 4F67A 4LFCJ 3X1LB 3UD4P 3SCKE 1WHVA 2VUGA 1IUJA 3R5BA 5JUMA 2H5IB 3DLGB 5LMUJ 4F04B 4KKOA 2E9RX 5DS7A 2WSFC 2BACA 3Q23A 1WNEA 5HP1B 2UU9F 4JV1A 1UVLA 2HHSA 1ELXA 1EQJA 4USJC 2QMUB 4USWA 2J76E 2G1HA 3D7SB 3SYZA 2GAHC 4LFBF 2BQ3A 3MEGB 3SZ2A 3DDIA 2GAGC 1VBKA 1S5ZA 3CMRA 5E3QA 4CLTA 2CZ9A 4QIVA 3HDSA 3PKMA 5JVHQ 1FKOA 3OD2A 1TUVA 2DHGA 2FD2A 1FJGF 3ICLA 2XLJA 2HZVA 4EEYA 2UVWA 2R7QA 1ZTWA 3UW1A 3OHBA 1M5PC 3CGIA 3GZ7A 3A3PB 3BKUA 4K4ZA 1UA0A 2YWEA 3RBZA 4PWDB 2IAJB 3Q8PB 4Q0BA 2IC3A 1WSVA 1JJHA 3OXLA 4DL0C 3PYFA 2CPDA 1RHMB 4ECRA 1D0EA 2QYCA 4IQMA 3ELHA 2FJXA 2UV8G 1RAIB 2QL9B 4WXOA 5CYMB 5HJXA 5ETNA 2E9TA 5EGEA 1T9YA 1I1GA 4R0EA 2EFVA 3SSQA 3PEJA 4JI4J 1RHKB 1O51A 1EI6A 2FC8A 2C3PA 3C16B 4YP3A 1S9FA 3M1VB 1MWYA 4EGLA 3DRRB 1IKVA 3DGPB 1HD1A 1C0TA 2ZVSA 3IR7B 2RU3A 4FPRA 3V6DA 5IJSA 3H7HB 2IM3A 2MZJA 2ZUAA 4FNIA 2NREA 2DISA 3EM1A 3M2RA 4WXWA 3K8WA 4ECVA 1FFWB 1WF1A 1NK7A 1U47A 5LRNA 4OFZA 1PSDA 3TAQA 4B3OB 2ASJA 3H5YA 4KAVA 2Y3YA 2H51B 1ZAVA 2D7SA 3IFEA 3H8YA 3BSAA 2B56A 3MM8B 2B43A 3G96A 3RAMA 1RLDA 1ZM3A 1UZDA 5F8IA 4DPTA 4DUTA 5KFPA 4F4WA 2O3DA 3OUYA 1PO6A 2HHTA 1BQMB 4I2PB 1URBA 2HHHF 1A9NB 4F0MA 1NO8A 2JC0A 4KFBA 3W9HA 3QJJA 5T7LA 1OYEA 2QZUA 1RTJA 2YWGA 2XO6A 2OGUA 1RTJB 1ZM2A 2IA6A 3JTOA 2DGTA 3T9NA 2OD6A 3PDNA 2J7KA 1UFKA 4WZMA 4DL6A 2C2OB 5L46A 3M4XA 3SXLA 3NXZA 2IMWP 1V5IB 5G4DA 2ZOMA 5FIIA 1OWXA 2RAQA 3JQJA 2LA6A 3UFCX 4DN9A 2QSWA 3RBDA 2KRRA 3JAMY 4B3TJ 4TN2A 2XNRA 1AFIA 3GIKA 2KDOA 4WZQA 3FVYA 1NKBA 4ZOSA 1EZZB 2CJXB 1W25A 4M5LA 2X3GA 2A1BA 2EI5A 3AOBA 2LQBA 4PYAA 4AXIA 4UOOA 2ZH7A 1YJ9S 3N0VA 3RG6A 4ED2A 3NNCA 4PCQA 4OZ2A 2CNKB 5GRRA 2W4PA 1UVNA 3W1YC 3GQCA 2H4YB 2YX1A 1O8BA 1YWXA 2W2NP 3OTCA 3CD5A 4HDGA 3WAXA 4ED7A 2XYHB 1I5OB 4AD6A 4X4QA 3QZ8A 3I4HX 3PZPA 5CCLA 2CNNB 4ES3A 1FE0A 5CYMA 3Q2TC 2E7WA 3I55S 3AD9C 1N32J 4JI7F 3ET6A 4DR7F 1F0XA 3GILA 4OX9J 1ITPA 4TU9A 3TO8A 1TKZB 3JQMA 3CB4A 1JXEA 3QT7A 3PM9A 3ZZ0A 1NJZA 1HW8A 2GJFA 4YB5A 2M4MA 4DV5F 2LU2A 1FRHA 1TL7A 1KDNA 2DITA 2V2VA 3AQOA 3AJDA 1K73T 3M7VA 4FXDA 1HA1A 4J9SA 2DXFA 4JV5F 3GIMA 3GFXA 1SJQA 1U26A 2E1PA 4NASA 1NU4A 1HNWJ 3CUNA 3J7A1 4I6AA 2HNDB 3PV8A 4I68A 2DK2A 4FVMA 5DRKA 2IDLA 5KFEA 2HS3A 2J7WA 5ETPA 1ZPVA 5CH7B 4X65F 4QR1A 3D3BJ 2XS2A 2AYEA 5EWGA 3JSMA 1ALJA 1EX8A 2MJNA 5K20B 5H1SV 3KJVB 4ED4A 3BPDA 1GX5A 4DQQA 3KK2A 3WHIA 1RT3B 4ELTA 2AJ2A 2Q6BA 3KWMA 5KFUA 4DCJB 4I4BA 1W7WA 3MFIA 2D1GA 4IG3A 2NZ4A 1X4AA 1HNXF 1FRLA 1NUEA 2AJ4A 3PW5A 2ZZNA 4MIVA 3PFEA 3TZXA 1S6PB 3C6TA 3M2UA 2DGSA 1UEUA 2V8DA 3BH7B 1UA1A 2J6SA 3FQLA 4KO0B 1PYSB 1UAWA 3V4MA 1C0UA 3R2DJ 2B5JA 4ETXA 1FWKA 3P3DA 3S6EA 5JVGQ 1RT6B 4J9UE 2WOMB 4CO1A 2MKHA 4P10A 3O1LA 2QMXA 4OV1A 1U2FA 3ZTQA 5HBMB 1CLFA 4LSLB 2V0NA 3I87A 1Q53A 1YTYA 1JJ2R 4OIXA 2J0SD 2MKCA 2B51A 3NS5A 5D4LA 3DU5A 3PHEA 4JI6F 4EK2A 2N82B 2XB2D 4DS5A 2QEXS 1T3NA 2BKPA 1DQ9A 2DT9A 4PXBA 2R7TA 3HHEA 2XO7A 3BGRA 3NBPB 1NDLA 2KI2A 4LREA 2OAUA 3FEYB 3FK4A 4DDFA 3JTPA 4AFFA 4CP5A 3J80Y 2ZH9A 4DV4J 4DR2J 3Q8YA 2KFYA 4RW9A 3OLBA 1RKJA 3UPFA 3PW4A 1AT1B 2DNGA 2L9WA 2RMLA 3ZNJ1 2PA8D 4B02A 3M8PA 3MR5A 1UFWA 9RUBA 3R1HA 3Q86A 2Z8QA 5KFTA 1X4BA 4HT7A 3HVRA 1N6QA 3CC7S 4C8KA 3PYDA 3KLIB 2Y1LB 4TYBA 8ATCB 4FYDA 3QAUA 2FLLA 4KT0C 1U2CA 4OZ3A 1T8EA 2QA2A 4OYMA 3EPIA 1F5BA 2IJFA 4X2BA 1O5JA 4N7TA 2B6AB 4ZJOA 4M5DA 1B64A 5DG7A 4KHRA 1WKLA 3HSGA 2PI4A 2A10A 1FJCA 2RD5C 2O66A 1AJDA 2CQ0A 2WOMA 4R5PB 3MEDB 2G9OA 2V8HA 4DUYJ 3VAIA 5GAHI 2W2MP 1XTZA 2HHPA 5T41A 4M5HA 3J7YU 2DR7A 1ELOA 3IWXA 5D0HA 4ES2A 1X0FA 1VQ4S 2I2YA 3CE8A 3W2WB 3KKFA 1OPZA 1SJ4P 2DGVA 2CQ1A 3SQGB 1FKPA 3ADAC 1SC6A 5KFWA 4IQXA 4X4VA 3CJ4A 3ULHA 2HHXA 3GPAA 1MN7A 3I32A 1IWGA 1XMQJ 2XMTA 4CQ1A 4A8SA 1EJJA 2VQEF 5KXAA 4IUFA 5L0KA 2W5XA 2VBXA 2HRUA 3OR2A 1RT3A 5KT3A 2ZEJA 3HCXA 3LPYA 5H9EJ 4K2XA 4CXUA 2B5JB 3CJ0A 3E2DA 1R31A 1NPPA 4TY9A 2P5VA 5DLVA 4RKUC 3CCSS 4ZCLA 3RW7A 3TR5A 1J5EJ 3BREA 3PR4A 3SSSA 3M6WA 5GOVA 3M8QB 1E6VA 3JSYA 2MY7A 3NL0A 3OVAA 3BDPA 4MTPA 5GAHU 1HFEL 3OJSA 5IT9U 1VJWA 3NAIA 5LMNJ 3H5XA 4IYQA 1T03B 4FF3A 2QRRA 4XAKA 1FCAA 1SJRA 3CCRS 1U1PA 3NMAA 5CHCB 3MOJB 3MPWA 4C8NA 4B9LA 2PFFB 1UVKA 4Q2LA 5KFVA 1YK9A 3M8WA 5KOXA 2IC3B 1FEEA 4FXWA 2XI2A 1S7IA 3ZFVA 1F5AA 3E8OA 3W9IA 3D1OA 2DNZA 2QFJA 4B9TA 4CXSA 3HP6A 2JEIA 2VOPA 4K5SA 2BUNA 5KOWA 2YNIB 1R0BG 2LYVA 4DV6F 3VCDA 1S49A 3AJ2A 2N3OA 4GTWA 4LF5J 3R7BB 2LXIA 3P96A 4ZPVR 3W2VA 3H4BA 4DV4F 3JS9A 2COLA 1MW7A 2L9NA 4HTIA 2GSNA 2KXFA 3NCQA 2VKZG 4WYLA 4Y2AA 1KR4A 3CTRA 1RAAB 2DGQA 3WC0A 2ZUGA 2YY3A 4ECUA 3FCVA 1H7XA 3IR5B 4O23A 4R0JA 3CWJA 1WTBA 4DPOA 3MM9B 3MK0A 4J90A 5KFGA 1D8ZA 1RP5A 4YR2A 4QIWD 2GV1A 4P2SA 2UXBF 5JXSA 1NZ8A 3DDNA 3DRSA 1KQKA 4CLSA 1SKUB 4EYIB 1RAJA 2F63A 3G82A 5K14A 1L3TA 4ELUA 2W8LA 3CC2S 5D4NA 2CQBA 2XSFA 3CJRA 4NEYA 5C42A 1VQMS 3BN4A 2YNHB 2B9WA 3PX0A 5K9FA 4X4NA 3ILOA 3H2LA 4DX6A 1IBKJ 4P7TA 4DX5A 4XDCA 5D0GA 3CD7A 5IV4A 2MGZB 3V6KA 1H2TZ 1H72C 2QTWA 2XMVA 2IM1A 4ZP7A 4ZVPB 4IRCA 1HLWA 4K4XA 1X5TA 1BY9A 3TQEA 2KG1A 1Q82T 2VJVA 3EX7B 2GLQA 1VI7A 2AMCB 3IA0A 3GIJA 1FJ7A 2BJ7A 2D74B 4ED1A 2IFYA 2RH6A 1APSA 2E5JA 2JEFA 1N33F 4F4YA 3PRBA 3NRBA 4UQGA 2HBRB 3OUYB 3H4DA 2DPJA 3K89A 2O01C 1SKSA 4X65J 2UXCJ 1KH5A 2YBVA 4P2FA 4EZ9A 2QIFA 1VRQC 2WW8A 3TX0A 5I3QA 5HATA 5T14A 2ZH2A 3G8TA 1HQEA 2HMIA 2G13A 1SV5A 5L9XA 2HNZA 1FWPA 3GJSB 3MM6B 2Z4PA 1AJAA 5B0EA 2WRMA 1FNXH 1ZYQA 1FDBA 2V34A 3WBHA 1LXJA 1ZTTA 2E5LF 3FDSA 5GMEA 1LWCB 1PC4A 2LCWA 1HNZJ 2HIQA 1IWAA 1B0TA 1NSAA 2B7BB 2J6UA 4TY8B 2QT7A 2R42A 3SI8A 1XEZA 2EXUA 2F7VA 1YBAA 3BZQA 4ZMMA 3OFEA 1N5QA 1N36J 1T94A 1NRKA 2C3MA 2MZSA 3GMGA 3JQKA 3SQGA 1K7HA 3LPEA 4F8RA 2NPIA 2RIJA 3A13A 1GQEA 3L4BC 5FLXU 4NYPA 3W62A 2POKA 2M8HA 4G65A 4EBDA 3T3FA 1C1CB 3CNQP 3H59A 4IFVB 3J7Z5 2NSCA 1TKZA 3K5NA 3TAMA 4DMZA 1KHWA 1GMUA 4JOUA 1A6LA 4RL1A 5B0FA 4NWBA 4WU2A 3IAS9 4G1PA 3HPOA 2DNHA 2UVUA 2PDAA 4ZCIA 1SCJB 2GMJA 5E3PA 3VHQA 5J1EA 2XMWA 3LOUA 3EYZA 3AD7C 4HACB 4GO5X 1XR6A 2EFQA 2VG6B 2VDIA 3GYGA 1H7WA 3KDOA 1KP6A 1Z4UA 1U4BA 3G82B 4EO6A 4AT1B 3RJMB 1F9HA 4LJMA 1VQSA 2N4CA 2W2QP 1WG5A 3GG0A 4KRWA 4PABA 3CJKB 3OVSA 3BGRB 3NBPA 1JK9B 3FMBA 2W5SA 2BJ8A 5CYJA 3DLGA 1U7LA 4UW2A 4QIGA 1VIOA 4CLWA 3K5LA 3EZUA 4KTQA 2WONA 1SVDA 1Y5LB 3GCXP 3PG9A 4RR5A 4HDHA 1QVFR 1YG0A 3IBWA 4CLLA 3KMQA 4B3RF 4LF9J 2W5QA 4JI0F 4A8QA 4ZG9A 3FBFA 3DI6A 1QSYA 3OBIA 1KQFB 2GW8A 3NEKA 4ZVSB 4DV1F 1KLNA 3KJVA 5KFHA 1M0SA 1D3WA 2JHEA 1ZA2B 3DC2A 4LF6J 1CJKB 1KQGB 1T3OA 2WVBA 4OI3A 4WFYA 1X8DA 2BJ1A 3MCMA 1CJKA 2NPFA 5IXUA 4DR2F 1DZ5A 5D3GA 3DXSX 1TL3A 2NLWA 3MMCA 3OR1B 3LP1A 1W2IA 4ZPCA 4DEZA 3NGDA 3HHLC 2ZHBA 2YNGB 1KNZA 3D1QA 4F02A 2X98A 1YLXA 4RUBA 4C2MA 3QIPB 4IR9A 1RXOB 1KFDA 1T9VA 2YKMB 3S8SA 2HLUA 2R2UA 4F4XA 1N54B 4QBUA 2D3O1 3WC2A 4KAYA 1IBCB 2DNYA 2ZE2B 3SDEB 2QC3A 4ZJQA 2CQPA 3BQ1A 2RJZA 3RW6A 1JJ4A 5H9FK 2A2DA 1GEHA 3DOLB 4MY4A 2E44A 4CNZA 3EDQB 1ANJA 2YKNB 1PBAA 1S1WB 4KB7A 1XR5A 2CQHA 4X4SA 1B7YB 3HSJA 1RA7A 2CPFA 3C2PA 3H5SA 1NK4A 1R0CB 2MDAA 4HR2A 4O3NA 5I4MA 1KVKA 3M9MB 3M8YA 4JV0A 1HNXJ 2HHWA 2HHQA 4LRCA 3T5JA 4RU9A 3MECA 2DB1A 1EP4B 5F0UA 5E41A 1Q95G 5DO2A 4DV0J 4FS1A 4M95A 2AZ1A 4CXKA 2EBEA 3TJAA 4UT4A 2CPIA 4LSZB 5LRMA 2RHQB 2BVZA 1OPIA 3MR7A 1N34J 4WJBA 5DLFA 1N6QB 3P5TL 4LQ3A 4ZPWR 1RAEB 5ETLA 3NGSA 5DLWA 4LFBJ 3Q0AA 2MSTA 3PX4A 1HNWF 1EW2A 2QA4G 2GSUA 4NA3A 1YDLA 1RT2A 2ZKTA 2IYIA 2ZITA 1FFSB 3PY8A 3OLAA 2PA3A 4KE5A 1FRJA 5IOLA 3NWRA 5IM0A 4DV5J 3IS9B 4U8YA 2GGPA 2CJQA 2GX8A 3D67A 3W5ZA 4Z7YA 4BS2A 2D1CA 2GGPB 2FJWA 3V2UC 1ZEFA 4QR2A 4J9RA 2R7OA 4PRFA 3W2VB 1HQAA 1OO0B 3M32B 2K3KA 2W9BB 3MDFA 1I94F 2CJKA 3GSDA 4OX7A 5T7LB 2JJ4D 2QO3A 2EKYA 3GWCA 1N0VC 2VPYB 3QJPA 2ZM6F 1WC6A 1Y00A 3FEZA 3GIIA 4K0KF 2F40A 1QVGR 2DNNA 3OTEA 4LF1A 4I1TA 3BPSP 3NKMA 4OHZA 1NH7A 4JP8A 4B3MJ 1WHWA 2B9XA 3FFIB 2ZBCA 4ICLB 4HH0A 1T03A 1RWKB 1X4GA 1OIAA 3MEKA 3PJ9A 1WHYA 3PVXA 1JB0C 5MLCV 4YHHJ 5KFIA 2DCUB 2YNGA 4J9LA 1Q79A 3F41A 3RUBL 1YJTA 2CWXA 2ACYA 1RABB 3HHLD 3MPDA 2NXUA 2YNIA 1PCAA 2QL5B 1LKZA 4XTTA 3M05A 4DR5F 3FJ2A 2UUAJ 4X84A 3RRHA 3TUZC 2HSEB 3KMSA 1X9WA 2FY1A 3UNGC 3L7PA 3MEEB 5LSOA 1V3RA 2XYGB 1VBYA 3C6TB 3M2UB 2QX0A 3CCWA 2HGNA 3Q2SC 3QT8A 5HMYA 1MWQA 4ECZA 3V81A 1WOSA 2RQ4A 1ALIA 3R27A 2CIMA 2YPYA 4WKRA 4M8LA 2JX2A 2MY8A 2OH2A 2WONB 3WAVA 1PYOB 4PKDB 1CJVB 1UMJA 3IGVA 2M8DB 2CDRB 1PKUA 3CCUS 1UVJA 1KSPA 3RB4A 5LIAA 4J9MA 1NHUA 5ETMA 4PQUB 3CW2C 4CO3A 2E29A 4O3SA 1LNQA 3AAWB 1K9MT 2B4VA 1NJIT 3TG0A 2WCXA 1MMNA 4R5PA 3N01A 2QLXA 2BZ2A 5KFJA 2IYGA 4UF4A 4MHXA 1HBNA 2GZOA 2YNHA 3LAMA 3LW5C 4TNOA 5FDLA 5LJ5Y 4DL2A 1V5VA 1N34F 2R8KA 2GCFA 3I6PA 1QDUB 1S57A 2MQMA 2XI3A 5E3RA 1WOOA 1IM4A 2OMOA 1FXLA 2X1BA 2B7CB 3DRSB 4O3PA 3J81Y 2LXFA 1Q0NA 4RWXA 2D3UA 3N5BA 4PPDA 3V6HA 4DPYA 1NMEB 2I5JB 2NYIA 3ZXWA 5BR8J 4KHPF 2WW4A 5LOQA 3CIMA 2RSQA 2I5JA 3N6LA 1ZM9A 3GB0A 3NOGA 3J80U 3Q8SB 3NKNA 1HQUB 3EVMA 1ANIA 4NLQA 1C1CA 2QLFB 3TWZA 3B82A 2XY7A 1QTNB 2XMUA 4J9VA 2QJ3A 3NGKA 2W9CB 2YNFA 1WACA 2DEIA 4H4OB 2W9BA 2G9YA 4CWBA 3TAPA 2VZ9A 4ECXA 4DI6A 1WHXA 4WBFA 2GQCA 2H48B 1M1HA 4CO2A 3A8IA 2K8GA 4NL5A 2KM8C 5KFMA 4X62J 3HJFA 4XK8C 4A8OA 2BXJA 1TAUA 1RISA 2FHMA 3BS9A 2YH1A 1C1BB 4K7QA 2W4CA 1RBAA 1KH4A 4KHPJ 1M5SA 4IRDA 1RU1A 3UN3A 2WB1D 2IBOA 4IFYA 2Z30B 1U6ZA 2FJAB 4M5IA 2W8KA 2KN4A 4CO5A 4RU2A 2P8IA 3Q89A 2GSOA 5HQLA 3QZ7A 3HX9A 2FVPA 1RCOB 1TKTB 2KJVA 3FMWA 3ISZA 3CMAS 1HYSA 1JLFB 1S6QA 4FNHA 3MD3A 3QMQA 4IH6A 5ETRA 2Y9HA 1BQMA 4I2PA 2IM2A 2DR9A 4FDJA 1VRTA 2VBZA 4Y34A 4W4MA 4LF6F 2MZQA 2VD3A 4ILMA 4OZ0A 1FT8A 4Y3CA 4Y0FA 2R9LA 4FZVA 4YR3A 2KB2A 2VG7A 4O44A 3OVBA 3KK3B 2FIUA 4DFKA 3KLEA 4LF9F 2P9GA 4ZP9A 3SCIE 4A47A 2UU9J 4FF1A 3MWBA 4NLRA 1T02A 2BRKA 1S1UA 4NLOA 2JVOA 4L75A 3TARA 3HD2A 1S1UB 4EYHB 4DSFA 1K0TA 1NM2A 2GMLA 1NXIA 2Z2MA 4RBUA 5AJ9A 4IRKA 3GFYA 3UN5A 1LW0B 4CYRA 3MOZA 2KJWA 1BLUA 2IJRA 5B0GA 3ZTSA 2ZH3A 2UUAF 1C2PA 3NKPA 1DBDA 1I3OB 2HS0A 5ETOA 5DLTA 3TA0A 4E0DA 3NS6A 5I3UB 2BQUA 2DGUA 2B4PA 4FXVA 3H2UB 5D15A 2UUCF 3MEDA 3OL9A 1S12A 1P1TA 4B3SJ 4WE1A 4YHHF 3ILIA 1RBLA 3MCSA 4Y2IA 1UVMA 4Q0BB 2AYBA 1LK7A 1SL2A 3VAFA 2JVRA 1YZ7A 3R97A 3PJWA 4MIWA 2DRAA 5TJ3A 4B3MF 2ZBPA 3Q22A 3DRYA 2I1RA 2WAQD 2XNQA 4OX6A 3UWTA 4RPFA 2J9DE 2ROPA 2ZM6J 2EK6A 1IBLF 5LT5A 2DHAA 2CYYA 3OTDA 4K8RA 2ZKUA 2J5AA 2XGQA 4ECTA 5G0RB 2ZH6A 1HR0F 2QFIA 5L9NA 4OJ1A 3KLGB 3VAGA 4LF7J 2EPIA 1XK8A 4PQUA 3DLEB 2XR9A 2QE5A 2VC0A 1R3NA 1X4HA 3BEGB 3M6UA 2PI5A 1VC0A 2Y1RI 2NYHA 2GO9A 3W65A 5D6GA 4GKJJ 1NB2A 3HVAA 2KZMA 3CF5Q 3DHXA 2FGOA 3H0PA 1LW2A 1SI9A 3IGNA 3VGTA 3HMJG 4QU6A 4EFAC 1H2UX 1VBZA 3IGYB 5J2PA 1TU0B 5D8HB 4IR1A 1OY6A 5GAGI 1HBNB 1F1BB 2IVYA 3CPWR 2HWTA 1HNVB 2HZCA 4EWTA 2W5TA 1LWEA 4ATNA 1PJ7A 3I82A 1S0OA 1J5OA 5K8OA 2CQ4A 1JNZB 2GC8A 1BE4A 3KYLA 2BE7D 2GO8A 4H4KC 1LWFB 3OJUA 1XNQJ 5A0YA 4Q44A 5F8NA 4HI1A 5IZHA 3SDEA 4DV0F 1S6PA 2HWIA 4RNHA 2D69A 5KT7A 1RDRA 4MMOA 4KBIA 5IC4B 2R8IA 2IRYA 4J9KA 2OFHX 3CMQA 2LA4A 1RTIA 5BYSA 4B9UA 4U7UD 3M8SA 1XNRF 3I9ZA 4CH7A 4DQPA 3GR0A 4DJBA 3HJVA 3KLGA 1FSUA 1S1XB 4K4SA 4MIAA 3DHWC 3JSBA 1B7FA 2KM8B 2W2PP 3NVLA 4TQSA 3IBCB 3D6TB 2W7AA 4IFYB 1DTQB 1WC1A 1EKRA 5KG6A 3DOKA 3K58A 1VLYA 1SBRA 4ZG6A 1EKSA 2W25A 2AJFE 4HLBA 2AYMA 4Y2CA 5HLFA 2DRBA 5KFZA 5EGHA 2OPPB 3OFGA 1HI0P 1SC3B 4P52A 3DPCA 1TK0A 1UCNA 2UZAA 4L3KA 4A46A 2KU7A 4KPYA 3SCJE 1X4EA 2HVDA 3M8PB 2B4OA 1RT5A 3KJQB 3UI3A 4N56A 2WSCC 1MLAA 5D0EA 5A8WB 4U7CA 1QSLA 4DV3F 2RKIA 1SQFA 2XZDB 5KFLA 5C66A 4P74A 4X4OA 3HFVA 1RTZA 1RT1A 3BF4A 4TLRA 2L08A 3TEHB 4YY3F 4CIOA 3QO9B 1FEHA 1S7HA 2KH9A 3RB6A 4PPZA 1D9AA 2AEJA 1TR0A 3M2VB 2B6AA 1HHTP 4HEA9 3C19A 2BMBA 3QWUA 1VMBA 4M5DB 3M9OB 2DNLA 3VZHA 5M2RA 4KJGA 2FY8A 4KGKA 1U0SA 4OYWA 4ECSA 5L1LA 1FXDA 1QAIA 2C3UA 1OYDA 4DR4F 3K5PA 1GT8A 3TZZA 1NKEA 4UPLA 2NXCA 1TKXB 2OPQB 1DTQA 1U1RA 3R7SB 3FZBA 3O44A 2NXNA 2CQDA 5KG0A 2E9ZA 2UP1A 5I3UA 3I4PA 4F0KA 3GTYX 4L76A 3D4JA 4LSNA 4NLDA 4UUXA 4MYTA 3MPYA 1WI6A 2ADCA 4L74A 3MURP 2YX4A 5AJ3J 2OI2A 4Q5VA 4K4VA 1YKWA 3C46A 2UUTA 4Y28C 2HBZB 2EC0A 4PWDA 2W2OP 2DXDA 5J2NB 5EX0A 2WB4A 2W5VA 1RTIB 4PG6A 3BDGB 3TW0A 2OEKA 4NE9C 4TLQA 4PR6A 3PFOA 4Y2MA 5LXYA 4IG3B 5B0AA 1HD0A 1MROB 1RWUA 2VFVA 3I0RA 4NRUA 4V1Ak 4ZVFA 3VALA 5KFAA 2PN6A 5L8RC 3PW2A 2EFPA 1FI4A 3BBFA 1G2EA 3K2YA 5L0BA 2QMWA 5JJBA 2R8JA 1F2HA 3CDUA 1P9QC 4YEAA 4OMFG 2K7JA 2MLZA 3G2XA 1YQHA 4WTOB 3ENAA 5L38A 2MYFA 2AW0A 4ILRA 5KFDA 4DQRA 2MKJA 3AXMA 2R7RA 4NLSA 1UTAA 2ZD1A 4CZCA 4DSEA 3N9UC 2VKRA 2ZD1B 2Z2YB 2CNOB 4UOPA 3PIOQ 3DOMB 5KFYA 4RUCA 5J2QB 3THTA 2AJ1A 2XTJP 1HNZF 2J0QD 2F5GA 3D6HB 4I2QB 3BDHA 4B9NA 1FVQA 4ZG7A 1J5OB 5CD4A 2KT2A 4WIQA 3PEHA 1B3TA 1HNVA 2KXHA 5D78A 4UTGA 2MQOA 4Q8FA 1LWEB 3U02A 2IBKA 3UNYA 5AXKA 4UPHA 1R8BA 4G1QB 5IT0A 1UPPA 3CSKA 1R8AA 3FSYA 3GFZA 4ZLJA 1S0MA 3WZ0A 4KV8A 3QRQA 3E01A 1VLOA 1M90T 1MU2A 5DDQC 2CG4A 4RNOA 2ANHA 4IO9Q 1KVJA 2IHR1 2BJDA 1VBXA 2AT1B 4DPWA 4RW7A 3FFIA 3VF0B 2HURA 4BLGA 1ZA1B 2VASA 4X4UA 1RJJA 1VISA 2V8GA 1EARA 1FVSA 5A76A 3BSNA 4H4MA 1VQNS 3EXCX 3DYAA 2AZ3A 2FLOA 1N5SA 3LUYA 1WEXA 2I8EA 1ZETA 2H5EA 4UZCA 4LRBA 1Q7LB 5ETSA 4J9QA 1HWUA 3R6LB 1RHUB 4O4GB 3VZIA 3MMBA 1AROP 1JLCB 1NPRA 1VK3A 4P75A 2IIHA 4CYUA 3C3LA 4U96A 3ZTPA 4HACA 2ALYB 1K1QA 5EWFA 5HVHA 2EFOA 4A8MP 2MQ8A 6FDRA 5LSLA 3V5RA 4X4TA 4C8LA 1NJWA 2XLKA 2OPPA 3WAYA 1A7GE 2RRNA 3OFFA 2BBEA 2OSQA 5KTQA 3BJYA 2IY5B 2BEFA 2BW2A 3T6JA 4C48A 3C6UB 2HHVA 5DZ7A 4FN5A 1X60A 2A18A 2BE2A 2EFNA 5K8MA 4IFVA 1URAA 4G3IA 5A2QY 1VC5A 3B6BA 1WC0A 2CQ2A 1Y10A 2SXLA 4Q2MA 4L72B 3TP2A 1YI2S 3K7RA 1CS4B 1X5OA 2W4DA 2OTJS 5HVFA 5A8KB 2HW3A 1OSCA 1CS4A 2AP6A 1YBTA 2EC2A 2V2ZA 1JQGA 3UR0A 2BRLA 3NCRA 4PUOA 1RACB 3R1LA 1VHIA 4I0WA 4B9MA 2PC6A 4K50A 2W5WA 2JLFA 1ZOTA 4PG7A 3VR1A 4WFXA 3EZ5A 2DYAA 2DGXA 2KYXA 4RZRA 2B8QA 3KFWX 3CVKA 4N47A 1KHVA 5KG1A 3FEXB 1TKXA 2G1DA 2OPQA 3HHKA 2P2CB 1SC1B 3MMJA 4ZDNA 3CCQS 2AGOA 1WD6A 1E33P 1U48A 4DSKA 3MI7X 2KRBA 4Y65A 1UZHA 3MUMP 3NNHA 3PYGA 2FVQA 1HR0J 1F6TA 2WBRA 4YOEA 4JI7J 3W5XA 1JXVA 3QATA 2A2CA 2KT5A 3HSDA 1KHNA 3KK3A 1FKPB 2XHCA 5FD1A 5IS2A 3AXKA 3KJFB 5F8GA 1D9DA 4GKKF 1KHJA 4UUWA
chains in the Genus database with same CATH topology
1ZEDA 3NKMA 3A52A 2XRGA 4UORA 4ZG6A 3UN2A 1ELYA 1ALHA 4QAXA 4CXSA 5IJQA 2W5VA 1P49A 1EJJA 3BDGB 4UPKA 4CYSA 4UOOA 3IDDA 1ELZA 5KXAA 3T02A 5L0EA 5L0KA 2W5XA 1AJCA 4KJDA 4ZGAA 3BDFA 2W8DA 5GRRA 4LR2A 4GTXA 5TJ3A 1B8JA 4CXUA 2IUCA 5K4PA 3WAWA 5L0BA 1ZEBA 4LR9A 4LRAA 3NKRA 3WAXA 3E2DA 1E1ZP 5EGEA 5DLVA 3KD8A 4LRFA 2W5RA 5GOVA 1EW8A 1ALIA 2W5SA 1KH7A 3WAVA 1EW9A 1KHLA 4UOPA 3SZYA 3M8WA 4NWXA 1AUKA 5LIAA 4LR8A 3M7VA 1ELXA 2W5QA 3BDHA 4ZG9A 4ZG7A 1EQJA 3IGYB 3MK1A 3UNYA 4GTWA 5LQQA 3CMRA 2W5TA 4GTYA 4GTZA 2W8SA 1KH9A 4TN0A 4UPHA 2GSNA 3UO0A 3LXQA 1ALJA 2ANHA 1ALKA 2X98A 3DYCA 1ED8A 1N2LA 1E2SP 4KJGA 2D1GA 3BDGA 3MK0A 5HRTA 3NKNA 5INHA 1ANIA 1O98A 4FDIA 4MIVA 3TWZA 4KAYA 3Q3QA 1KHKA 1SHQA 3B5QA 4LRBA 1FSUA 3T00A 4MY4A 1HJKA 2G9YA 1ANJA 3OT9A 4LQYA 3NVLA 2IUCB 3ED4A 3WAYA 1N2KA 3M8YA 5IJSA 1KH4A 4LR7A 2VQRA 4LRCA 4B56A 1E3CP 2GLQA 5EGHA 3UN3A 1URAA 2RH6A 2XR9A 1SHNA 4YR1A 2IFYA 1HDHA 2GSOA 3DPCA 4CXKA 5LRNA 1EI6A 4LRDA 5LRMA 4LREA 3SZZA 4KAVA 1KH5A 3NKOA 4FDJA 1Y7AA 4UPIA 3TX0A 5C66A 5DLWA 1URBA 1EW2A 2GSUA 1AJAA 2W5WA 2GA3A 3NKQA 2ZKTA 4MHXA 3WBHA 2QZUA 3TG0A 1E33P 1O99A 3M8ZA 1AJBA 4N7TA 1Y6VA 1ZEFA 4KM4A 5AJ9A 3IGZB 5DLTA 1HQAA 4UPLA 3UN5A 3T01A 1AJDA 4CYRA 1KHNA 3NKPA 1K7HA 1ED9A 1KHJA 4NWJA 3MK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZED A;  3NKM A;  3A52 A;  2XRG A;  4UOR A;  4ZG6 A;  3UN2 A;  1ELY A;  1ALH A;  4QAX A;  4CXS A;  5IJQ A;  2W5V A;  1P49 A;  1EJJ A;  3BDG B;  4UPK A;  4CYS A;  4UOO A;  3IDD A;  1ELZ A;  5KXA A;  3T02 A;  5L0E A;  5L0K A;  2W5X A;  1AJC A;  4KJD A;  4ZGA A;  3BDF A;  2W8D A;  5GRR A;  4LR2 A;  4GTX A;  5TJ3 A;  1B8J A;  4CXU A;  2IUC A;  5K4P A;  3WAW A;  5L0B A;  1ZEB A;  4LR9 A;  4LRA A;  3NKR A;  3WAX A;  3E2D A;  1E1Z P;  5EGE A;  5DLV A;  3KD8 A;  4LRF A;  2W5R A;  5GOV A;  1EW8 A;  1ALI A;  2W5S A;  1KH7 A;  3WAV A;  1EW9 A;  1KHL A;  4UOP A;  3SZY A;  3M8W A;  4NWX A;  1AUK A;  5LIA A;  4LR8 A;  3M7V A;  1ELX A;  2W5Q A;  3BDH A;  4ZG9 A;  4ZG7 A;  1EQJ A;  3IGY B;  3MK1 A;  3UNY A;  4GTW A;  5LQQ A;  3CMR A;  2W5T A;  4GTY A;  4GTZ A;  2W8S A;  1KH9 A;  4TN0 A;  4UPH A;  2GSN A;  3UO0 A;  3LXQ A;  1ALJ A;  2ANH A;  1ALK A;  2X98 A;  3DYC A;  1ED8 A;  1N2L A;  1E2S P;  4KJG A;  2D1G A;  3BDG A;  3MK0 A;  5HRT A;  3NKN A;  5INH A;  1ANI A;  1O98 A;  4FDI A;  4MIV A;  3TWZ A;  4KAY A;  3Q3Q A;  1KHK A;  1SHQ A;  3B5Q A;  4LRB A;  1FSU A;  3T00 A;  4MY4 A;  1HJK A;  2G9Y A;  1ANJ A;  3OT9 A;  4LQY A;  3NVL A;  2IUC B;  3ED4 A;  3WAY A;  1N2K A;  3M8Y A;  5IJS A;  1KH4 A;  4LR7 A;  2VQR A;  4LRC A;  4B56 A;  1E3C P;  2GLQ A;  5EGH A;  3UN3 A;  1URA A;  2RH6 A;  2XR9 A;  1SHN A;  4YR1 A;  2IFY A;  1HDH A;  2GSO A;  3DPC A;  4CXK A;  5LRN A;  1EI6 A;  4LRD A;  5LRM A;  4LRE A;  3SZZ A;  4KAV A;  1KH5 A;  3NKO A;  4FDJ A;  1Y7A A;  4UPI A;  3TX0 A;  5C66 A;  5DLW A;  1URB A;  1EW2 A;  2GSU A;  1AJA A;  2W5W A;  2GA3 A;  3NKQ A;  2ZKT A;  4MHX A;  3WBH A;  2QZU A;  3TG0 A;  1E33 P;  1O99 A;  3M8Z A;  1AJB A;  4N7T A;  1Y6V A;  1ZEF A;  4KM4 A;  5AJ9 A;  3IGZ B;  5DLT A;  1HQA A;  4UPL A;  3UN5 A;  3T01 A;  1AJD A;  4CYR A;  1KHN A;  3NKP A;  1K7H A;  1ED9 A;  1KHJ A;  4NWJ A;  3MK2 A; 
#chains in the Genus database with same CATH topology
 2CDQ A;  2P6S A;  3LAL A;  2V8P A;  3HF5 A;  1Q8K A;  1UW9 A;  4PWW A;  3TZW A;  2DY9 A;  2ZBR A;  2MEW A;  3HUL A;  2HG4 A;  3Q8V A;  4ZP8 A;  3UQS A;  1FNO A;  4YB7 A;  4ES1 A;  5KG2 A;  3IRX B;  3LAN A;  1PIL A;  4TQR A;  4DLE A;  1RE1 B;  3AJ1 A;  4GVB B;  3TA2 A;  1Y3K A;  3DYA B;  4OYZ A;  4RNM A;  2Y1I A;  3Q8U A;  2BYC A;  4NA1 A;  1LV5 A;  2HFU A;  2AWZ A;  4DFM A;  3R5D A;  4FYV B;  2VQF J;  1C0T B;  3IDD A;  3MM9 A;  1ZH5 A;  1GMW D;  2P9E A;  4GRS A;  1AJC A;  1GMV A;  4B3S F;  2GVD A;  3MEC B;  1C1B A;  1TMJ A;  1RA6 A;  2F4F A;  1TL1 A;  1CBK A;  1S99 A;  5DG9 A;  2OP5 A;  3IWL A;  4X66 F;  2HK2 A;  1RTH A;  2OKQ A;  2ATC B;  3TQ1 A;  1ZZF A;  3NOC A;  4RUA A;  3BKT A;  1ZEB A;  3UCG A;  1RT6 A;  3V4I A;  5C42 B;  2VON A;  2ZH8 A;  3D6M B;  2LEA A;  3OQ2 A;  4JI5 F;  2DGO A;  1LEO A;  3PO4 A;  2FGC A;  4KQZ A;  2ZH5 A;  1YIT S;  1RT5 B;  2RRA A;  3RRK A;  1VK8 A;  4Z2X A;  1G3O A;  3RB3 A;  1TFW A;  4I2Q A;  1RAD B;  4ZVR B;  1CJV A;  4AND A;  4OJH A;  3QRP A;  1EQ0 A;  3DM2 B;  3FC9 A;  3EMT A;  3T1A A;  4LBP A;  2HZA A;  1EJ7 L;  1YZ6 A;  3GV8 B;  3NS7 B;  1KRP A;  4NWJ A;  3J81 U;  4ZCM A;  1IKY A;  1RHJ B;  3AB4 B;  3FUY A;  3LTO A;  1HBM A;  4LR8 A;  3L95 X;  4WWS A;  5AXL A;  4U8V A;  1G1X A;  2UUW A;  2RDI A;  4NLX A;  5DM6 Q;  5KFO A;  1FKA F;  1RI7 A;  2DCL A;  3LQV A;  4C4W A;  3M8Q A;  2W7O A;  1LWF A;  1TL3 B;  3IP0 A;  3MMC B;  1WF2 A;  3OR1 A;  3JSM B;  4E98 A;  2W8S A;  1K47 A;  1G6B A;  2CNL B;  3SV3 A;  5AXM A;  3ILL A;  3UO0 A;  4ALZ A;  4DXL A;  2AEM A;  1RU2 A;  1HI8 A;  3POT A;  4R8U A;  3ENQ A;  1KS2 A;  4ERD A;  1MMD A;  3QGP A;  5IQ6 A;  1NKC A;  1N2L A;  1RAF B;  4JI6 J;  4DR4 J;  3DOM A;  5J2Q A;  1PJ5 A;  1SJ1 A;  1X5P A;  3PTW A;  2XUL A;  2C28 A;  1H73 A;  4DWI A;  4UOC A;  4JI2 J;  4M94 A;  2XYP B;  1TUG B;  1IXK A;  2WVC A;  1FDA A;  5SUH A;  2DEJ A;  1IBM J;  4USV A;  2C2K B;  3EGZ A;  2E5G A;  2K1R B;  3MUV P;  3A4T A;  4BC9 A;  1XMB A;  1VRU A;  3D0G E;  3KXD A;  2NSB A;  1VGY A;  2IPO B;  1RTD B;  2IMO A;  5IWA F;  2I0X A;  5L1I A;  1Z1Z A;  4NZ6 A;  3N79 A;  4MK8 A;  5ADZ A;  2VOO A;  4EBC A;  2JLE A;  1VQY A;  5AT1 B;  3HT0 A;  2OEJ A;  7FDR A;  5B09 A;  1RQ0 A;  1IKV B;  3EE3 A;  4P7V A;  3L7O A;  4CLP A;  2RU9 A;  1AW0 A;  3P5B P;  2XZT B;  1ZBT A;  3EZO A;  4NCG B;  3WQP A;  4DCO B;  1T95 A;  1HQE B;  2UVR A;  1HDH A;  3TVZ A;  1NB7 A;  3H90 A;  2Y0B B;  2CVE A;  3QO9 A;  2KG0 A;  1JXL A;  4O4G A;  4YB6 A;  5E3C A;  1J2V A;  1G4C A;  4LUB A;  4B3O A;  3K59 A;  2LXU A;  2WBM A;  3THP A;  4FS2 A;  5DQI A;  3F56 A;  3ZZZ A;  3V4I B;  5J2M B;  4CTA A;  4LT6 A;  1M5H A;  1RWM B;  1WF0 A;  2BR0 A;  3RBE A;  1T9X A;  4DPX A;  2HAI A;  4ENO A;  5EGY A;  5KFN A;  3KTQ A;  1WDD A;  2HFS A;  1R8H A;  3CD6 S;  5D4P A;  4F0H A;  4OX9 F;  1V9O A;  1EQM A;  2VG5 A;  3RB0 A;  3MMA B;  4NLU A;  2BJ3 A;  4D3H A;  1R6V A;  3KLH B;  3KHL A;  1L3U A;  1WKJ A;  4AQY F;  1I6J A;  4N41 A;  2E7X A;  2JOQ A;  4NXN J;  1SUQ B;  3BV8 A;  1ED9 A;  1S0V A;  3IBF B;  3QAE A;  4O3O A;  3C14 B;  2ZWP A;  2F8E X;  4RBV A;  4H4M B;  3T1H J;  1GTH A;  2V9W A;  1S1X A;  1X9S A;  1WI8 A;  1SL0 A;  5H9F J;  2JFD A;  3SBM A;  4JI4 F;  5E7O B;  1SJ3 P;  1CJU B;  3HSZ A;  1U0H A;  1NDC A;  5RUB A;  2F4V F;  4OI1 A;  3EDR B;  4EUV A;  1FX4 A;  2EFG A;  3D2W A;  2KFZ A;  2YTC A;  5CAA A;  3OTB A;  1RHQ B;  2ERR A;  2AQ4 A;  2R2R A;  3Q8R B;  3EIC A;  1UEV A;  1WTF A;  2GHV C;  2XWY A;  5K4P A;  5F3Z A;  1YGY A;  1ZM4 A;  3W5Y A;  5KFK A;  3KG1 A;  5EHH A;  4JBC A;  2MGZ A;  3BO4 A;  1UWB A;  2YWK A;  5AE2 A;  3CJ3 A;  2WHO A;  4OZN A;  2MMY A;  4DHV A;  2Y1J A;  2R7V A;  2VBW A;  4YN3 B;  1EW8 A;  2CPY A;  2WZ1 A;  2CPX A;  2QZ8 A;  4CO0 A;  1MRO A;  3IMQ J;  2AU0 A;  3FCH A;  1NK9 A;  1PC5 A;  1DFD A;  1S9G A;  1Q8I A;  3PNI A;  4ITS A;  3THV A;  3D0H E;  4YDD B;  1S9G B;  3EGN A;  3LP0 A;  4NOH A;  4KSE B;  2F3J A;  2C42 A;  3PYE A;  1FF2 A;  1BQX A;  2LDI A;  2CJB A;  3W7B A;  1AA1 B;  2J0X A;  4B17 A;  4UY8 T;  4U67 Q;  3B8H A;  1NH8 A;  1RAH B;  1REG X;  2KHC A;  4WK3 A;  5D3G B;  1OQ3 A;  3TVK A;  3DLB A;  3CCZ A;  4USU A;  3QSY B;  4P71 A;  3FZ2 A;  5HVG A;  4TVA B;  3WIV A;  4F50 A;  4DU8 A;  1MSW D;  5ETT A;  5C7P A;  3W60 A;  2DR8 A;  4KIA A;  4NX9 A;  4P73 A;  5E0O A;  1H98 A;  2FJE B;  2PMW A;  3TYT A;  2EBG A;  5JMN A;  3NGT A;  4OYO A;  4O0N A;  4FVC A;  5KG3 A;  5F8H A;  2K7K A;  4O4R A;  5J2N A;  1I51 B;  2XMJ A;  3B54 A;  3HD1 A;  1TAQ A;  4DUZ J;  4ECW A;  1T11 A;  4DL3 A;  3ZTR A;  3VGS A;  2OLW A;  3SSR A;  3IRX A;  5I42 A;  1VQ8 S;  1V3Z A;  1FD2 A;  4FF4 A;  1SHQ A;  2OUG A;  1P8G A;  1HBO A;  2ASY A;  3UR3 C;  3ZZP A;  3ZZT A;  4C11 B;  3GV7 B;  5DGA A;  1K8A T;  2CJY B;  2R7S A;  4EU0 A;  2OTL S;  2LQ5 A;  3VGU A;  3I5A A;  2XBP A;  4HL9 A;  2FDN A;  2D41 A;  5J1E B;  4DQI A;  1TFY A;  3E2E A;  2CKW A;  1YVF A;  4QU7 A;  3W66 A;  4NZ7 A;  3ED4 A;  1LFW A;  4CLU A;  4D3G A;  1IKX B;  1MN9 A;  2HGM A;  2GVD B;  1S9E B;  2LU1 A;  1BQN B;  2VH7 A;  4M63 A;  1Y3J A;  4ZVG A;  2XCP A;  2JH3 A;  4W98 A;  4DPU A;  2HPU A;  2QLB B;  4JI2 F;  4CH1 A;  1VQL S;  2HAF A;  2AHO B;  2YWH A;  3D28 A;  3MGJ A;  3R6G B;  4DUZ F;  2C2E A;  5KAK A;  1N8R T;  2VQR A;  1UJ5 A;  4FKX A;  4KH1 B;  1NEE A;  2O5D A;  3JTN A;  2VF3 A;  3H25 A;  3L9Z A;  4QCL A;  2XMK A;  1VQP S;  2DIU A;  3QBC A;  2YKN A;  1HKA A;  3FRY A;  3PXG a;  3K17 A;  5L1K A;  1SV5 B;  1CSJ A;  1XBW A;  3MM6 A;  4KH0 B;  5M2U A;  2LQ8 A;  2VG7 B;  3BBC A;  1Y5I B;  2CXE A;  4O44 B;  3UCZ P;  2NXE A;  5F8M A;  4PAA A;  4OZJ A;  3OSP A;  1X31 C;  2M9K A;  1TL4 A;  4PZV A;  1UEK A;  4UOG A;  4JI0 J;  1CJT B;  3MTJ A;  1CC7 A;  4FDF A;  4TY8 A;  1UFL A;  4QW8 A;  1KC8 T;  4K59 A;  4DU7 A;  3PHT A;  5LMU F;  4EZ6 A;  4YME A;  4ANE A;  2VOD A;  1U1N A;  4UY8 5;  3WDO A;  4LIR A;  1CUL B;  2HQ3 A;  4AYB D;  1KOO A;  1DQ8 A;  3EVO A;  5F3T A;  3S7R A;  4URQ U;  4ZIT A;  5K8N A;  3B78 A;  3MD1 A;  3MPV A;  2E1C A;  4PUO B;  2XS7 A;  2V4J B;  2FJD B;  1RT2 B;  1MML A;  3N28 A;  3VV2 B;  4DR5 J;  1SH2 A;  1NZA A;  1XMO F;  1UPM B;  4DZ6 A;  5LJ3 Y;  1RUS A;  4DN0 A;  1A0O B;  4X66 J;  2OEM A;  1R8P A;  2J8A A;  1FES A;  5D77 A;  3BSC A;  4CRJ A;  5AXN A;  5KFQ A;  3NKR A;  1B99 A;  5GAD U;  2WK4 A;  1NLK L;  2RHS B;  4QZV B;  1YSJ A;  5DET A;  2DO4 A;  2EK1 A;  3V6D B;  3MM7 A;  1Q8L A;  1CVJ A;  1SB6 A;  4ZGA A;  3E01 B;  3MAQ A;  4AL6 A;  4BHQ A;  2WSE C;  4J9O A;  2JC1 A;  2JLG A;  4JI1 J;  4X4R A;  4M5M A;  4A8K A;  4C9D A;  1OJ4 A;  3TI0 A;  3I31 A;  3UDC A;  4Z37 A;  3AB2 B;  3FQK A;  3VAK A;  1N0U A;  4NXN F;  2CJ9 A;  1Y11 A;  2RS2 A;  2UUB J;  4FBT A;  2AJQ A;  4A4J A;  2HVH A;  2FHJ A;  3QGG A;  3QT5 A;  4AL5 A;  3PRD A;  4NEZ A;  3QLH B;  1S1T B;  2ZNY A;  2F9D A;  1FTC A;  1S1T A;  4OYA A;  1MWZ A;  2XCA A;  2VU5 A;  3BGL A;  5IQQ A;  5U47 A;  4PYD A;  4J5O A;  2HQI A;  4BCA A;  3CJS A;  3FNN A;  1VDH A;  2DH7 A;  3GJQ B;  1RWO B;  4LVN P;  4UQT A;  2ZJR Q;  3QNW B;  3M30 A;  2I38 A;  5KG7 A;  2VB6 A;  3NP5 A;  3POT B;  2CQ3 A;  2GIQ A;  4F2S A;  4ZKA A;  4GTY A;  2Y8Y A;  2ZH1 A;  2V4R A;  2ZZM A;  5F8J A;  3HLU A;  2RNE A;  2UXC F;  2ACM A;  4NYO A;  2O1P A;  5EN1 A;  2MKY A;  1KVI A;  1ALK A;  1HQ2 A;  1QJH A;  3DYC A;  2QA1 A;  2V2K A;  5A2Q U;  3SEO A;  1R27 B;  2FVR A;  1E2S P;  1SQE A;  2G0J A;  3TAN A;  1Y4Z B;  4ICL A;  5GAD I;  2YXL A;  3W64 A;  5DDP C;  1U0H B;  2V8V A;  2MPU A;  2NZC A;  2L41 A;  3Q3Q A;  2PSZ A;  3QQC D;  3HK2 A;  2N3L A;  2KKH A;  1RWW B;  2RIL A;  4C0B A;  1U1L A;  1U6B A;  3BR9 A;  2GIR A;  5DGB A;  3HZG A;  2IUC B;  4OI6 A;  2E5I A;  1ZS6 A;  2U2F A;  4DLG A;  2OML A;  4RW8 A;  1FK9 B;  2AKW B;  4MKY A;  3MM5 B;  3P49 B;  2KYZ A;  2ZOG A;  3C6U A;  1HMV B;  5CZV A;  2PT0 A;  4CLK A;  3G8S A;  1JWW A;  2VFU A;  1QD1 A;  2W01 A;  3VGV A;  2OIH A;  4OZ1 A;  3DM2 A;  1U1M A;  1FRI A;  4OLO A;  3MM7 B;  1TVR B;  3G4S S;  1PBU A;  3HZE A;  4U9R A;  2R8G A;  3HHN B;  1KKH A;  1TEL A;  2MZT A;  1WKK A;  2ZHO A;  3RZA A;  1NK8 A;  1M5K C;  1AUD A;  1YJN S;  4ZVE A;  2VJU A;  1JLB A;  2R2T A;  4DV1 J;  2F8M A;  3G87 A;  2IRX A;  4NYZ A;  3DCA A;  3MUT P;  1QUP A;  5C24 B;  2JWN A;  1Q5Y A;  1SXL A;  4C0O C;  2J8S A;  2XMM A;  4J37 A;  4BC7 A;  3KHR A;  1WG1 A;  5KFS A;  5CZX A;  5CYQ B;  3Q83 A;  4QOT A;  4I6Y A;  3TA1 A;  2HS4 A;  3T19 A;  1PIE A;  3M8Z A;  2R7W A;  4M5J A;  1SIW B;  1WEY A;  3KG4 A;  4QIE A;  2MHE A;  2MB0 B;  5A6P A;  2DNP A;  4KM4 A;  4ZN3 A;  3RRG A;  2F8H A;  2CPZ A;  4RW8 B;  1R0A B;  1NND A;  2GHP A;  2J9C A;  3FBC A;  3MEG A;  2RQC A;  5HQM A;  1J5E F;  4G6V B;  5MAO A;  1D9F A;  1R8C A;  3QPI A;  3ZZU A;  1VR6 A;  4DV2 J;  3OW2 R;  1Z2Z A;  3DOL A;  4KO0 A;  3S1T A;  4EO8 A;  5DM7 Q;  2XSJ B;  1SH3 A;  2DH8 A;  3TOQ A;  4NLG A;  4QWA A;  4UOR A;  1YJR A;  3L7U A;  4ZPD A;  4LFA J;  1TVR A;  5C2G A;  3H40 A;  3NAH A;  2RDJ A;  4HYK A;  5CQG A;  3CCJ S;  1PGZ A;  4F26 A;  4C8M A;  2CQC A;  3BGU A;  1AB8 A;  2FZK B;  3BDE A;  3L09 A;  1FER A;  1YBU A;  2Z56 B;  4ZVT B;  3EPG A;  4I67 A;  4CM2 A;  2HFZ A;  1FDD A;  2ILZ A;  2X3D A;  4QWD A;  3DLH A;  4JV5 J;  3T41 A;  3VTI A;  3P8B B;  2IM0 A;  3I0S A;  4R8U B;  2N4D A;  2IUC A;  4C0H A;  2M52 A;  3R5G A;  5HK4 A;  5AJ3 F;  1L5U A;  1D8Y A;  2J6T A;  3LO3 A;  2YX7 A;  4PG5 A;  4OHW A;  3JXO A;  3ITH B;  1QM9 A;  3ZZR A;  1P27 B;  3C16 A;  3KLF B;  2RE1 A;  3TNV A;  5B0B A;  3KK1 A;  4CO4 A;  1YIJ S;  4GKK J;  4KKO B;  4NML A;  3RAX A;  4DUY F;  1N36 F;  2R3V A;  5AE1 A;  1SH0 A;  5K8P A;  1L3S A;  4YR0 A;  1LW2 B;  4J91 A;  4MK7 A;  1HYS B;  1X9M A;  4BWJ A;  1ROF A;  1FFG B;  2GMH A;  2XG8 A;  1WOP A;  5KFR A;  2PGC A;  2R8H A;  1LWX A;  1VHF A;  3GP9 A;  3NCP A;  2XSJ A;  4DF8 A;  2H65 B;  3UE2 A;  4C6A A;  1UWB B;  2GA7 A;  3U7J A;  3EGV A;  4U6P A;  5EDW A;  4YY3 J;  2H9Z A;  2X7I A;  4OZ5 A;  1D09 B;  2CPJ A;  4JB8 B;  3NMR A;  1WC4 A;  3DRX A;  1JLQ A;  1RT7 B;  4AUK A;  3MR6 A;  4DV3 J;  2ASL A;  4GTZ A;  3MMA A;  3KLH A;  4NLT A;  4WPA A;  3TX8 A;  2D3O R;  1NSP A;  2R7U A;  4TN0 A;  1HBM B;  2BAN B;  2JSX A;  4PXD A;  2ZBQ A;  4USH A;  3ISN D;  3TUJ C;  2CVI A;  4QW9 A;  2JEJ A;  1RKI A;  3GIR A;  4OX8 A;  1HL6 A;  1HQU A;  3QID A;  1CJU A;  4L73 A;  4P2M A;  2C22 A;  2QSF A;  1LOU A;  3E3X A;  3NY0 A;  3P6Y C;  4ZN1 A;  2ZWO A;  4TU8 A;  4JI3 J;  3A3N B;  3LAK A;  5J2M A;  4LF8 F;  2G2O A;  4FDI A;  2KFN A;  4YDX A;  2MQQ A;  1C4C A;  2GQQ A;  3EWG A;  3UDE A;  1OSD A;  2R4F A;  3D1H A;  1JKH B;  2RUS A;  4M1K A;  1URR A;  4UST A;  1O0P A;  4DR1 F;  1IBK F;  4ED0 A;  4OYI A;  1KEK A;  3BO2 A;  4LQY A;  4U95 A;  2ZBI A;  4PQA A;  4P2X A;  3SFU A;  4B08 A;  3B4D A;  2FJV A;  1VQO S;  2NS1 B;  3EVW A;  5IFM A;  4IOC Q;  1XNR J;  1FA0 A;  4W90 B;  2X1F A;  5A6W A;  2UXB J;  4CDI A;  1N2K A;  2VPW B;  3QGH A;  2RQM A;  5C5J A;  3JYT B;  2FYX A;  4NPO A;  2IA0 A;  4P72 A;  2KVI A;  2MKI A;  1GXT A;  4MT1 A;  9ATC B;  3HHD A;  2R7X A;  1HHQ A;  2G2Z A;  1VRU B;  3LP0 B;  1RTD A;  1T7P A;  1XNQ F;  3QJL A;  1JLB B;  2BJ9 A;  2Q66 A;  3GYX B;  2PEH A;  2ZDP A;  5I3P A;  3RGI A;  5HJY A;  2R2S A;  1H74 A;  1X0P A;  5E5N A;  1CJT A;  5HMX A;  4XPC A;  1Q7Y T;  2IFX A;  2C2R A;  1E6V B;  2KZZ A;  2V4J A;  5J1N A;  1P9Y A;  3GON A;  4DV6 J;  1LFP A;  4NCG A;  4RX6 A;  4K4U A;  4F4Z A;  1TKT A;  4J7C A;  1JLF A;  1S6Q B;  1RWN B;  2CAJ A;  2V9K A;  7FD1 A;  5HN0 A;  4FBU A;  4IH7 A;  2P9C A;  3K57 A;  3OV7 A;  3W8G A;  3EGW B;  1TZ0 A;  3T1Y F;  4OV6 A;  3UVJ B;  5A0Y B;  1RAG B;  4NCB A;  5L39 A;  2Q43 A;  3NKY A;  4IOB A;  1PG5 B;  2HNY A;  1SIZ A;  1U8S A;  2YQ3 A;  3D0I E;  2XMA A;  2GNK A;  2BOA A;  5F9L A;  2DNM A;  2AEF A;  1Q78 A;  1RYS A;  1YJU A;  3R5J B;  3IN5 A;  1JLE A;  3CCM S;  2ZE2 A;  1T9W A;  5HRO A;  3GYN A;  4H4O A;  2IDE A;  3MK2 A;  1SKR A;  4MYU A;  2HIY A;  3A52 A;  4EBE A;  3RYL A;  4EI2 A;  2ZZT A;  2VFR A;  1ALH A;  5HQ8 A;  2XQC A;  2AIR B;  1VIX A;  2X1G A;  4OZL A;  1DHM A;  4LMZ A;  1JMT A;  3DLK B;  3C15 A;  2VQE J;  1VQ7 S;  1S0N A;  2Q1L A;  5ETQ A;  3BDF A;  1S9E A;  2W8D A;  2EVZ A;  2CPH A;  4GTX A;  3P45 B;  2V50 A;  3PCO B;  2UUC J;  2XWX A;  1L3K A;  2JL9 A;  3T9Z A;  3A8E A;  3TVY A;  4OL8 A;  1HMV A;  2PO4 A;  3L3C A;  5BJR A;  3ONQ A;  4QIF A;  3HXM A;  3MMB B;  1KWM A;  1NK5 A;  4IH5 A;  2AV5 A;  4Y00 A;  4NI2 A;  3OXG A;  2QA4 S;  2O67 A;  3BYP A;  4QJV A;  3W61 A;  3OTO J;  2RKI B;  2FZC B;  2VPZ B;  2XEX A;  1H0H B;  1S6U A;  3D5M A;  3CJ5 A;  4KY3 A;  4WP3 A;  3V6J A;  3ETM A;  3BQ0 A;  2ZFH A;  3S01 A;  1NPK A;  3IXQ A;  4OJG A;  5KFB A;  1S97 A;  2VFS A;  4MAK A;  4ZLN A;  5CCM A;  5A8R A;  4OYX A;  4JUZ A;  2RQK A;  3CUL A;  1EP4 A;  3SZY A;  4DR3 J;  3BYR A;  3OL8 A;  2RRB A;  3HHL A;  3MAA B;  2BDP A;  3R5A A;  4WU3 A;  4F3M A;  1JLQ B;  1RT7 A;  1S4F A;  4TYA A;  2KVQ E;  1BC6 A;  3ITH A;  2GHW A;  1BWV A;  4ZVO B;  4F7V A;  3KNA A;  1JLG A;  4BWM A;  4ETZ A;  1KH9 A;  4RW4 A;  2FHK A;  1JLG B;  3BQ2 A;  3D54 A;  2J9E A;  2LVW A;  2PEB A;  1RYR A;  4DR6 J;  2GS8 A;  3JSR A;  2E5H A;  2PE8 A;  1F9F A;  2G4B A;  1T9U A;  3CD0 A;  1Y5N B;  4F2R A;  2Q6C A;  3W9J A;  3BH6 B;  1OS5 A;  2VL1 A;  1HWI A;  5CAB A;  3BO3 A;  3BDG A;  3J7Y I;  2BOP A;  5INH A;  4GVL A;  5LSR A;  2BKN A;  5HRO B;  3T6B A;  4F3O A;  1KHK A;  2FHO B;  2EG1 A;  3ILJ A;  4NLW A;  2HBQ B;  5F8L A;  5KT2 A;  6AT1 B;  1FD8 A;  4B9V A;  1C4A A;  3CDA A;  2QLJ B;  1QAX A;  3SMZ A;  3W2W A;  3VAJ A;  2GVZ A;  2QV6 A;  2DXE A;  2L9D A;  2OO4 A;  4RNF A;  1R7I A;  3QT6 A;  1SUQ A;  3I0S B;  1HBU A;  3HVT B;  3J7Z T;  1VQK S;  3A1Y G;  3AT1 B;  3R3T A;  4EMD A;  4K4T A;  1NK6 A;  3GCW P;  2MJU A;  4I7F A;  5BR8 F;  1PAE X;  5B0C A;  4RW6 B;  1FJE B;  1URN A;  1E3C P;  2K2P A;  2QG9 B;  4OQJ A;  2LFV A;  4QR0 A;  4DSJ A;  2XHW A;  4QYZ K;  4YR1 A;  3OPK A;  1RWP B;  2RF2 A;  3C15 B;  1TMM A;  2ROG A;  2ROE A;  1DAX A;  4URG A;  4RBT A;  1RT1 B;  2E7V A;  3I5C A;  4CTA B;  3DLL Q;  3NKO A;  1NAQ A;  1O6X A;  3UCU P;  2FTR A;  2ZDO A;  2DGW A;  1Q81 T;  1E6Y A;  2HBY B;  3GLJ A;  1IQZ A;  1IKW B;  4ANC A;  4RUH A;  4WF9 Q;  3CDB A;  4RLE A;  4IG0 B;  2DO0 A;  1XC9 A;  2VG5 B;  3JYT A;  1CQM A;  3H2V E;  3KJN B;  3O5T B;  4CM0 A;  1ZPW X;  3B4M A;  3G6X A;  4C8Y A;  2MQP A;  2ZC3 A;  3OL7 A;  1FO1 A;  1CUL A;  2EEY A;  5HI7 A;  1NSK L;  4DBQ A;  5C2C A;  1Y6V A;  4OHX A;  1GFW B;  2A6M A;  4LF7 F;  3W3S A;  3TRG A;  1KBR A;  3M2V A;  3PO5 A;  4G1Q A;  4USK A;  2YKP A;  3A3O B;  4ER8 A;  5H9E K;  5CXT A;  3T01 A;  1X4C A;  3O2I A;  2UUB F;  1FJG J;  2Z2Z A;  2ZOF A;  1HBO B;  2ZNZ A;  4N77 A;  1NBE B;  4C11 A;  5SZT A;  2YKO A;  2B3T B;  2B9E A;  4WP9 A;  4ZIV A;  4JI1 F;  2YWF A;  4H54 A;  2C3Y A;  4F4A A;  1HWJ A;  2ZVI A;  3M6X A;  2ZHA A;  4ZVQ B;  4ZLL A;  1ULR A;  3U1M A;  3ENV A;  2HQD A;  5L0E A;  2BA9 A;  3RAQ A;  4ELV A;  2CUY A;  3A8J A;  3DXB A;  2FVS A;  1PAU B;  3ZZO A;  4KJD A;  1WG4 A;  2CJA A;  1FK9 A;  1H3D A;  4I56 A;  4LSL A;  2W7P A;  2AD9 A;  3MM5 A;  4AL7 A;  4NXM F;  1R6Y A;  3BR8 A;  3AFG A;  3GE9 A;  2E1A A;  1U49 A;  1B8J A;  1S1W A;  3HVT A;  4FYW B;  4MKA A;  2MKK A;  4LRA A;  2JEG A;  4K0K J;  1NJY A;  1DY3 A;  1S4E A;  1IJF B;  3PAC A;  4UZB A;  2F9J A;  1SJF A;  1YX2 A;  2C2Z B;  2HVZ A;  2JRS A;  2RDD A;  3A12 A;  1GNK A;  3CJT A;  3DNC A;  2WTF A;  3ETO A;  4LRF A;  4WFB Q;  3JB9 k;  2VA2 A;  5A8K A;  2ALZ A;  4HHU A;  2FJB B;  1VRT B;  1I94 J;  3AOA A;  1H2V Z;  4JI8 F;  2MHN A;  4HHJ A;  2C2M B;  4CNY A;  1U24 A;  4LVO P;  1X4F A;  1N4L A;  2RUG A;  5EUH A;  3CCL S;  1JLA B;  1U2R A;  4ZHR B;  2FZG B;  1QSS A;  4Q43 A;  2IVF B;  2CPE A;  3DLE A;  3CO0 P;  1KN6 A;  4FYY B;  4IOA Q;  4OLP A;  3KLF A;  4OI2 A;  4DSI A;  3QLH A;  2FC9 A;  3LP2 A;  4RW4 B;  2FVC A;  1AUS L;  3O6Q A;  5F9N A;  4LF2 A;  4X64 J;  2K3I A;  2YQ0 A;  1HHS A;  4KV8 B;  4MH8 A;  5LQQ A;  3KDN A;  1ICE B;  2YWW A;  4PXC A;  4QWB A;  1FHT A;  1KLM A;  1VC6 A;  1YRT A;  5GVQ A;  5IT4 A;  1ZAX A;  1P6T A;  2A0F B;  1HI1 A;  1AZS B;  3DFE A;  2EW9 A;  1NDK A;  1CG2 A;  5GMD A;  2V69 A;  2FLP A;  1X4D A;  1UET A;  3G8Q A;  4IG0 A;  3GR1 A;  3AOC A;  4JV2 A;  4O3R A;  1F2G A;  1CQN A;  4A8Y A;  4WE1 B;  3AY0 A;  2I9S A;  3CT9 A;  5B08 A;  3MFH A;  4G1I A;  1FE4 A;  4Q7A A;  5FLX Y;  2NR0 A;  3KHG A;  1VCT A;  2IRU A;  2Y8W A;  4ED5 A;  3T00 A;  1KTV A;  3R9L A;  2HGL A;  1FRM A;  3O8W A;  1S76 D;  1RTH B;  3MCO A;  4CH0 S;  1OQ6 A;  2ZJP Q;  1IQT A;  3OXF A;  3NLC A;  3KK1 B;  3MZI A;  4WFN Q;  1F9E B;  2YVS A;  1X7V A;  2E1M C;  3AA8 A;  1YRX A;  3FGV A;  1WUU A;  1Q16 B;  3LP2 B;  4KGM A;  3IWN C;  3N6M A;  5KFC A;  3PR5 B;  2BM1 A;  2AYG A;  3G6E S;  2HFV A;  3NG8 A;  3UVJ A;  1EET A;  5EWE A;  3FSX A;  1U25 A;  2FB0 A;  3KUH A;  3CDW A;  3TJ9 A;  7AT1 B;  3FSI A;  2W9A A;  2Z58 B;  4DR6 F;  5K5M A;  2VPX B;  3BKF A;  1U09 A;  1K0V A;  1W26 A;  2VC1 A;  3SZZ A;  1VOM A;  3WX4 A;  1MG7 A;  3I5B A;  1GAO A;  2PD1 A;  2QN6 B;  1Y7P A;  2KTQ A;  4OJ3 A;  5FJ4 A;  1P1L A;  6FD1 A;  1JLE B;  1QTM A;  2FLN A;  1H38 A;  2OPS A;  4OHY A;  3N4W A;  4PG8 A;  2HKE A;  4B3R J;  2C2D A;  4QYZ J;  3LGH A;  4XPE A;  2LLZ A;  2V68 A;  3G6Y A;  2AGQ A;  4FP9 A;  4ZPT R;  3U1L A;  1FDN A;  5GAG U;  2DD8 S;  1YRU A;  1AJB A;  1LWC A;  2PMZ D;  2GJ2 A;  2QYG A;  4PEO A;  2LMI A;  4HTJ A;  4K5R A;  4ZP6 A;  5GAE U;  1FWL A;  5IT9 Y;  2H1Y A;  3CDE A;  5CYQ A;  3OSN A;  1VQ6 S;  3PW0 A;  1Q5V A;  1XN9 A;  2KT3 A;  4QPX A;  4GC6 A;  2IVM A;  3H5U A;  3MR2 A;  3M30 B;  2NUU G;  1NHK L;  2APO A;  3FKB A;  3N6N A;  5F41 A;  3ZC4 A;  2VBY A;  3DLJ A;  4QWE A;  4NLP A;  2AJ0 A;  2F65 A;  2BAB A;  4FKY A;  1R43 A;  4ID5 B;  4OYB A;  2GQ2 A;  1JKH A;  5K14 B;  1S48 A;  3UN2 A;  4F4K A;  2BE9 B;  4NXM J;  2HQG A;  4MFB B;  1R0A A;  4QAX A;  5IJQ A;  2DNK A;  3M2R B;  2JDJ A;  5HO4 A;  2EWH A;  4ZK7 M;  2CAD A;  2IAJ A;  4CYS A;  1U1O A;  1ELZ A;  1T9T A;  3F0N A;  2VQF F;  1TKD A;  3CO9 A;  3R2C J;  3TJ8 A;  1WC5 A;  2BX6 A;  2LP4 A;  2G2Y A;  3LH2 S;  4P6Q A;  4ZVU B;  4DCP B;  4LR2 A;  4ZPB A;  1U45 A;  3CIZ A;  1RWX B;  4NLV A;  2CRL A;  4HH1 A;  1Z2L A;  2M5Y A;  2E66 A;  2UV8 A;  3H98 A;  4I7F B;  4LR9 A;  4PWU A;  4CLY A;  1BMQ B;  2AX1 A;  1Q1K A;  4F36 A;  1S10 A;  2V63 A;  4DZD A;  4CCH A;  1ACM B;  4KJI A;  3OFH A;  5IC6 B;  3KNG A;  4L6V 3;  3KD8 A;  1K44 A;  1FNM A;  3HT3 A;  4LF4 F;  1TQL A;  1S59 A;  4KPC A;  2MSS A;  3CCV S;  1SC4 B;  2N7Y A;  3RU0 A;  1DTT B;  4WYW A;  1WEL A;  2AGP A;  5DDO C;  2M88 A;  4ZHR A;  3KUG A;  2IJN A;  1KHL A;  4RWW A;  4HKQ A;  1M5O C;  5D4O A;  4CI0 B;  1BHN A;  3FCW A;  5M2P A;  2XLI A;  1FKO B;  4NI2 B;  4DV7 F;  3MR3 A;  1KLM B;  4N76 A;  1FRK A;  1XWL A;  3IG1 A;  1DQA A;  1HAR A;  5FDL B;  3OHA A;  2OSR A;  1IR1 A;  3PX6 A;  4KC5 A;  1GXU A;  3GJR B;  2CFX A;  2CQI A;  2UXD J;  2XM3 A;  5DZ6 A;  1B0V A;  1F3F A;  1R89 A;  3DN9 A;  1N33 J;  3CCT A;  2MZ1 A;  2VIH A;  3KUE A;  1KQS R;  1BWE A;  3LXQ A;  1S1V A;  1IN0 A;  2CWK A;  2H4W B;  4O3Q A;  4RJV A;  1ED8 A;  2K06 A;  4K4W A;  2BJE A;  2BM0 A;  4GVB A;  3HHL B;  3MAA A;  5B7W A;  1Y9O A;  3H42 A;  5E2Q A;  4BDP A;  1V3S A;  4C98 A;  4DX7 A;  3PW7 A;  3DRP B;  4QQB A;  5HMZ A;  5IWA J;  3KK2 B;  1TK5 A;  1GH8 A;  4MIB A;  1N5T A;  1EHW A;  1JNR B;  2XY6 A;  3B5Q A;  2Z0G A;  2AX0 A;  4K2J A;  1AXQ A;  4C97 A;  1TP7 A;  4AXJ A;  2LEB A;  4KAI A;  1DUR A;  4LSN B;  4WCE Q;  4RNN A;  4ED8 A;  1YJ7 A;  4C8Z A;  2XC9 A;  2CG8 A;  4WFA Q;  1IBM F;  3CJ8 A;  1KON A;  4WKY A;  4WFZ A;  3FBB A;  1EET B;  3KOA A;  4I6W A;  3J81 j;  4YB1 P;  4B9S A;  5HL7 Q;  1SL1 A;  3JAM U;  4JI3 F;  1Q8B A;  4I64 A;  2U1A A;  3AHP A;  3I56 S;  3DGV A;  4LR7 A;  4CLZ A;  4B56 A;  1IJE B;  4A8X A;  2DVI A;  1RAO A;  4JYA F;  5LL6 d;  1SHN A;  3VAH A;  1PJ6 A;  4Y6I A;  4KGX B;  5THW A;  1SQG A;  5A8R B;  1B70 B;  5E33 A;  2OD4 A;  5ITH A;  3R7N B;  3DKD A;  1N5Y A;  3LA0 A;  2KXN B;  2DHX A;  2V4Q A;  5C24 A;  4N8O A;  1DTT A;  4U7U K;  5HAN A;  3TZY A;  1WWH A;  1Y7A A;  4LF5 F;  4UPI A;  1KD1 T;  2DR5 A;  4DSL A;  2HEK A;  4RW9 B;  4A8F A;  1RZM A;  3IC1 A;  5BYQ A;  4K4Y A;  3M9N B;  1F5C A;  1WC3 A;  5KG4 A;  3WX8 A;  3M32 A;  5HSP A;  4O0I A;  3Q8Q B;  1LQ9 A;  4WP8 A;  3G9C A;  2H5J B;  3RR7 A;  3EXY A;  3Q24 A;  4IO1 A;  2M7S A;  4S0M A;  1RGV A;  4NA2 A;  3PKY A;  2NXJ A;  4DR3 F;  1U1Q A;  1VYA A;  1VJQ A;  2RVJ A;  2CZV C;  1MU2 B;  1XER A;  2HNY B;  4XIU A;  4ED6 A;  4DG1 A;  3WIU A;  1N52 B;  4NMX A;  3K5M A;  1M1K T;  2LEP A;  3HI9 A;  1UKU A;  2BV3 A;  5AE3 A;  3C8Y A;  4J9P A;  2X1A A;  3ZZY A;  4M5G A;  1YJW S;  4JI5 J;  1GTE A;  1NSQ A;  1C0U B;  3OTO F;  3HFZ B;  5ETV A;  4ID5 A;  4CT9 A;  3O3L A;  2C2N A;  2K1R A;  4M5N A;  3W8P A;  4C3L A;  4E8U A;  2BQR A;  2YKQ A;  1HNI A;  2LKZ A;  3SFG A;  1UJ4 A;  4ZJL A;  4H4K A;  2DHH A;  1VS3 A;  4DFJ A;  2HRT A;  4YUD A;  3DRP A;  4ZVH A;  1U02 A;  8AT1 B;  1QUV A;  4N5S A;  2YKM A;  1WSR A;  1WDT A;  2L48 A;  2V5H G;  4DOZ A;  5HLF B;  3BN7 A;  1UP1 A;  8RUC A;  1RT4 B;  3QRR A;  3K8V A;  4MKB A;  4URS A;  4LFC F;  1FTR A;  3VAM A;  1OY8 A;  2KL8 A;  2LDY A;  2V67 A;  1S72 S;  1TK8 A;  3HVW A;  3WAW A;  4KFB B;  2MXY A;  2ABY A;  2B0G A;  2EKN A;  2QLW A;  3F44 A;  3MTK A;  3DRR A;  3UDL A;  1RHR B;  5KT4 A;  2N7C A;  1IKX A;  3SV4 A;  1YHQ S;  3MPU B;  2HHU A;  5HP1 A;  1QE1 A;  3CC4 S;  4J9N A;  2HMI B;  1KOH A;  1FX2 A;  1U6F A;  2CZ4 A;  4Z7C A;  3G71 S;  1F3V A;  5BXI A;  2OEL A;  5ETK A;  4DF4 A;  4PG4 A;  2VIC A;  3G6V A;  3KLV A;  1DJ0 A;  4OYP A;  2V94 A;  4ZA1 A;  3CXC R;  4CLF A;  1U1K A;  2J9D A;  3VQS A;  3PRV A;  3U1N A;  3RTV A;  3T1Y J;  2MQL A;  3T5K A;  3LP1 B;  3T5H A;  1NCL A;  4KGV B;  3LF0 A;  4NWX A;  1K1S A;  2E5L J;  3CJK A;  3CME S;  4V19 X;  1S77 D;  1S79 A;  1RB0 A;  5DJB A;  3GJT B;  4X64 F;  2P6T A;  3QGI A;  4ECY A;  2DR6 A;  3MK1 A;  1NK0 A;  4DX8 H;  4LBI A;  1RBO B;  3N5F A;  2HYI B;  3LWL A;  2BW7 A;  3VQT A;  3PIP Q;  1AYE A;  3FBE A;  3MCN A;  1BXN A;  1EAY C;  1WEZ A;  4UOH A;  1JIH A;  4C3M A;  3ENW A;  2MLY A;  4ZPA A;  1JJC B;  3DI6 B;  3M6V A;  5DLG A;  4DG1 B;  4ILL A;  5KT6 A;  4DFP A;  1LXN A;  2D9O A;  5J1P A;  1XR7 A;  2DNQ A;  4JYA J;  3VWS A;  5I42 B;  1XMQ F;  2AF6 A;  1H6K X;  1Y0H A;  2DTJ A;  3CJ2 A;  3HO1 A;  3CJQ A;  3DLK A;  3D3C J;  3MXH P;  2YH0 A;  3T5L A;  3E51 A;  4N8N A;  3MHY A;  2HRY A;  2I6W A;  2NQP A;  1KTQ A;  1CEZ A;  3ET6 B;  1M5V C;  2JNJ A;  3AQP A;  2KO1 A;  5DQH A;  2EG2 A;  5DDR C;  1HJK A;  2D3Z A;  3GG1 A;  3KHH A;  3OT9 A;  2VG6 A;  2ADB A;  4R25 A;  4DR1 J;  3PJX A;  2C3O A;  4YS2 A;  3DDK A;  4DL5 A;  2DBB A;  2A3J A;  2HVI A;  2Z2L A;  4LF8 J;  2D9P A;  4RW6 A;  2RB7 A;  2ZH4 A;  1RK8 A;  2HK3 A;  4MJK A;  2HFN A;  2LQJ A;  1REV A;  2VA3 A;  4E2F B;  5KFF A;  2CA9 A;  3EJM A;  1NJX A;  4QYR A;  2ATL A;  1HBU B;  4USI A;  1LK5 A;  1RLC L;  3G86 A;  2DNR A;  5LM7 E;  3SIP B;  3ZTO A;  3KLE B;  3RR8 A;  2UXD F;  1QY7 A;  2NUH A;  2OFG X;  2F1F A;  4ZCK A;  3MEE A;  2J0W A;  4OHV A;  5DG8 A;  3C66 A;  2HVE A;  2RF2 B;  4FF2 A;  1XMO J;  3HKW A;  1XIQ A;  3R8Y A;  4AE5 A;  4DV7 J;  4BBY A;  4M5K A;  1TV6 B;  4DL7 A;  2VFT A;  5CA5 A;  2J7U A;  2C1E B;  4NCA A;  2ZC4 A;  4DL4 A;  3D6F B;  2W1B A;  2V6A A;  1T05 B;  4GKJ F;  1RWV B;  1KFS A;  1T05 A;  2A6O A;  1N56 A;  1HPZ B;  1ZAW A;  5DQG A;  5LMN F;  2OPR A;  1UL3 A;  3AOD A;  1NDP A;  1D1U A;  3BGF A;  3IGZ B;  2DIV A;  2RS8 A;  2GJI A;  2OPS B;  2V2Q A;  1L3V A;  4LF4 J;  1GXL A;  1CC8 A;  1N5V A;  3IO1 A;  3FRZ A;  1JLC A;  3MM8 A;  4C3K A;  3TUP A;  1U8W A;  4CYU B;  1UW4 A;  2YPZ A;  2OHD A;  1IVZ A;  2FQQ B;  2VDH A;  2YNF B;  2G0I A;  4KYZ A;  2E1R A;  4LIW A;  2XRG A;  3DMJ B;  4HT5 A;  4ED3 A;  3QFH A;  3KG0 A;  2B9Y A;  5KFX A;  2ASD A;  3BBB A;  3NNA A;  1XJW B;  1DAR A;  4UPK A;  4YFU A;  3LGM A;  2BE2 B;  3IR6 B;  4PXE A;  1N48 A;  1FXR A;  1QAJ A;  4HVZ A;  4IKA A;  3ZNU A;  2VV5 A;  3LGN A;  4LFA F;  1AZS A;  3TEG A;  2XGP A;  4A8W A;  3IG1 B;  1IR0 A;  5HBM A;  4ZLP A;  1E1Z P;  2VHG A;  2GIF A;  2Y0S D;  4DV2 F;  5GAE I;  2DRD A;  2W5R A;  5GMK a;  3QWP A;  4A48 A;  4Q45 A;  3GU0 A;  1DLO B;  2DY1 A;  4FPI A;  2H54 B;  5KT5 A;  3IRW P;  2L3M A;  1DLO A;  3K5O A;  4KR0 B;  1KH7 A;  3ISN C;  1EW9 A;  3QSI A;  5G0R A;  4GO7 X;  3UDV A;  3AA9 A;  2PMH A;  2RT3 A;  4LQ9 A;  3M8R A;  3V81 B;  2XS5 A;  1QLN A;  1BD6 A;  4ZIW A;  2HHH J;  1VQ5 S;  1TTH B;  2BAN A;  2QGF B;  3ZO7 A;  1OMS A;  2Q79 A;  3CCE S;  1BGX T;  3IM8 A;  4QWC A;  2MLX A;  5L1J A;  1QE1 B;  1LW0 A;  3R5C A;  4I69 A;  1X5S A;  3IAM 9;  2PII A;  3P4U B;  5KG5 A;  4TKT A;  3BSO A;  3NGR A;  3TUI C;  1VQ9 S;  1HPZ A;  2LQ9 A;  1AUK A;  3TAM B;  3UD5 A;  5E3A A;  4ZS6 A;  1WOR A;  2PFD A;  4LBH A;  2WVE A;  2ZJQ Q;  3QYY A;  2XY5 A;  1SKW A;  4MK9 A;  4MFB A;  3GSI A;  3NWG A;  3HM9 A;  1TV6 A;  1TL7 B;  2HWH A;  2Z57 B;  5HRT A;  2M2B A;  4ID8 A;  3QIP A;  4IDK B;  1O98 A;  5CD4 H;  4FYX B;  4X62 F;  1HNI B;  4QPT A;  4KHM A;  4RO0 A;  1TUW A;  3CED A;  3MF5 A;  3X3U A;  4L3N A;  5C25 B;  1CPZ A;  2DHS A;  1NHV A;  3BB5 A;  3C14 A;  2M70 A;  2KHD A;  1JX4 A;  3SCL E;  4ECQ A;  4F3Q A;  4GC7 A;  3EUN A;  5IV3 A;  2FUG 9;  2OJ3 A;  3RBX A;  2JZ5 A;  2HQF A;  4X4P A;  1HIY A;  5B0D A;  2MKS A;  2RH3 A;  1REV B;  3D66 A;  1M1G A;  3BGO P;  1IR2 A;  2MTL A;  3OR2 B;  4USM A;  3I0R B;  1TL1 B;  3DGP A;  3I96 A;  2UVV A;  2H3E B;  1BQN A;  4HI2 A;  4P9S A;  3LWM A;  3M1V A;  2HFO A;  4KGZ B;  4Q8E A;  1ZED A;  2YQ1 A;  3HKZ D;  2HNZ B;  3F73 A;  2DH9 A;  1ZZN A;  5EX3 A;  4LRD A;  2M3D A;  3MAH A;  2GFF A;  1G7C B;  3D9B A;  4DS4 A;  2M0G B;  1RCX B;  4WK1 A;  1IKW A;  5BYR A;  4CT8 A;  4MKV A;  3WBZ A;  1E6Y B;  3GFH A;  3HFK A;  2JFK A;  1PYT A;  1SPB P;  1HWK A;  1N88 A;  2B4U A;  2BKO A;  3IM9 A;  4NLY A;  4OI4 A;  1WJ9 A;  5A8W A;  2XZW A;  3K0J A;  2GA3 A;  4W92 B;  1V6H A;  2YKA A;  2FHJ D;  3NGU A;  2DNO A;  1W2B R;  1EIY B;  4Y2K A;  1J27 A;  5IM0 B;  2OPR B;  1O99 A;  3NKQ A;  3IS9 A;  5LXR A;  5F0W A;  5HMW A;  1GMW A;  2B8P A;  3KLI A;  3J7A N;  1UWA A;  4JI8 J;  1T0T V;  1Q4R A;  2CQG A;  3H20 A;  3UD3 P;  1UVI A;  2FPH X;  2X51 A;  3U27 A;  4DR7 J;  1N32 F;  2QL7 B;  2WVF A;  3DMJ A;  2W9C A;  3I9V 9;  4NRT A;  1OY9 A;  1AFJ A;  1IBL J;  1XQI A;  1B4S A;  4XDD A;  1N5Y B;  1FRX A;  3BM7 A;  4C8O A;  4GMK A;  4OI0 A;  1RSC A;  4TU7 A;  3GV5 B;  1HW9 A;  3US5 A;  2DPI A;  1ELY A;  4IDK A;  4RW7 B;  2WVD A;  1P49 A;  3VVT A;  1B0P A;  3T02 A;  1GX6 A;  3SQO P;  3D68 A;  2HLT A;  1S6O A;  1UJ6 A;  3DOK B;  4NZ0 A;  4TXS A;  3DU6 A;  4WII A;  2F4V J;  2DKO B;  1Q86 T;  1HWL A;  4YQW A;  2DJW A;  1EB0 A;  1S1V B;  4UOF A;  1F60 B;  3W63 A;  2ILY A;  4DQS A;  4C7Q A;  2LEC A;  3T1H F;  3QFW A;  2W24 A;  1GK8 A;  2Q3P A;  2GVZ B;  1IM6 A;  2HND A;  4B3T F;  3A8K A;  1VFJ A;  1YJV A;  1MNE A;  1QAY A;  2G0C A;  3AH6 A;  4HHH A;  4WTY A;  3VVU A;  5C25 A;  5J2P B;  4XO0 A;  3OL6 A;  4AQY J;  2HQC A;  3AD8 C;  5HAO A;  1JLA A;  1DRZ A;  1RT4 A;  4V19 J;  1TL5 A;  2MQN A;  2MZR A;  2NCK L;  4F25 A;  1BUX A;  1IKY B;  5D0R A;  4F67 A;  4LFC J;  3X1L B;  3UD4 P;  3SCK E;  1WHV A;  2VUG A;  1IUJ A;  3R5B A;  5JUM A;  2H5I B;  3DLG B;  5LMU J;  4F04 B;  4KKO A;  2E9R X;  5DS7 A;  2WSF C;  2BAC A;  3Q23 A;  1WNE A;  5HP1 B;  2UU9 F;  4JV1 A;  1UVL A;  2HHS A;  1ELX A;  1EQJ A;  4USJ C;  2QMU B;  4USW A;  2J76 E;  2G1H A;  3D7S B;  3SYZ A;  2GAH C;  4LFB F;  2BQ3 A;  3MEG B;  3SZ2 A;  3DDI A;  2GAG C;  1VBK A;  1S5Z A;  3CMR A;  5E3Q A;  4CLT A;  2CZ9 A;  4QIV A;  3HDS A;  3PKM A;  5JVH Q;  1FKO A;  3OD2 A;  1TUV A;  2DHG A;  2FD2 A;  1FJG F;  3ICL A;  2XLJ A;  2HZV A;  4EEY A;  2UVW A;  2R7Q A;  1ZTW A;  3UW1 A;  3OHB A;  1M5P C;  3CGI A;  3GZ7 A;  3A3P B;  3BKU A;  4K4Z A;  1UA0 A;  2YWE A;  3RBZ A;  4PWD B;  2IAJ B;  3Q8P B;  4Q0B A;  2IC3 A;  1WSV A;  1JJH A;  3OXL A;  4DL0 C;  3PYF A;  2CPD A;  1RHM B;  4ECR A;  1D0E A;  2QYC A;  4IQM A;  3ELH A;  2FJX A;  2UV8 G;  1RAI B;  2QL9 B;  4WXO A;  5CYM B;  5HJX A;  5ETN A;  2E9T A;  5EGE A;  1T9Y A;  1I1G A;  4R0E A;  2EFV A;  3SSQ A;  3PEJ A;  4JI4 J;  1RHK B;  1O51 A;  1EI6 A;  2FC8 A;  2C3P A;  3C16 B;  4YP3 A;  1S9F A;  3M1V B;  1MWY A;  4EGL A;  3DRR B;  1IKV A;  3DGP B;  1HD1 A;  1C0T A;  2ZVS A;  3IR7 B;  2RU3 A;  4FPR A;  3V6D A;  5IJS A;  3H7H B;  2IM3 A;  2MZJ A;  2ZUA A;  4FNI A;  2NRE A;  2DIS A;  3EM1 A;  3M2R A;  4WXW A;  3K8W A;  4ECV A;  1FFW B;  1WF1 A;  1NK7 A;  1U47 A;  5LRN A;  4OFZ A;  1PSD A;  3TAQ A;  4B3O B;  2ASJ A;  3H5Y A;  4KAV A;  2Y3Y A;  2H51 B;  1ZAV A;  2D7S A;  3IFE A;  3H8Y A;  3BSA A;  2B56 A;  3MM8 B;  2B43 A;  3G96 A;  3RAM A;  1RLD A;  1ZM3 A;  1UZD A;  5F8I A;  4DPT A;  4DUT A;  5KFP A;  4F4W A;  2O3D A;  3OUY A;  1PO6 A;  2HHT A;  1BQM B;  4I2P B;  1URB A;  2HHH F;  1A9N B;  4F0M A;  1NO8 A;  2JC0 A;  4KFB A;  3W9H A;  3QJJ A;  5T7L A;  1OYE A;  2QZU A;  1RTJ A;  2YWG A;  2XO6 A;  2OGU A;  1RTJ B;  1ZM2 A;  2IA6 A;  3JTO A;  2DGT A;  3T9N A;  2OD6 A;  3PDN A;  2J7K A;  1UFK A;  4WZM A;  4DL6 A;  2C2O B;  5L46 A;  3M4X A;  3SXL A;  3NXZ A;  2IMW P;  1V5I B;  5G4D A;  2ZOM A;  5FII A;  1OWX A;  2RAQ A;  3JQJ A;  2LA6 A;  3UFC X;  4DN9 A;  2QSW A;  3RBD A;  2KRR A;  3JAM Y;  4B3T J;  4TN2 A;  2XNR A;  1AFI A;  3GIK A;  2KDO A;  4WZQ A;  3FVY A;  1NKB A;  4ZOS A;  1EZZ B;  2CJX B;  1W25 A;  4M5L A;  2X3G A;  2A1B A;  2EI5 A;  3AOB A;  2LQB A;  4PYA A;  4AXI A;  4UOO A;  2ZH7 A;  1YJ9 S;  3N0V A;  3RG6 A;  4ED2 A;  3NNC A;  4PCQ A;  4OZ2 A;  2CNK B;  5GRR A;  2W4P A;  1UVN A;  3W1Y C;  3GQC A;  2H4Y B;  2YX1 A;  1O8B A;  1YWX A;  2W2N P;  3OTC A;  3CD5 A;  4HDG A;  3WAX A;  4ED7 A;  2XYH B;  1I5O B;  4AD6 A;  4X4Q A;  3QZ8 A;  3I4H X;  3PZP A;  5CCL A;  2CNN B;  4ES3 A;  1FE0 A;  5CYM A;  3Q2T C;  2E7W A;  3I55 S;  3AD9 C;  1N32 J;  4JI7 F;  3ET6 A;  4DR7 F;  1F0X A;  3GIL A;  4OX9 J;  1ITP A;  4TU9 A;  3TO8 A;  1TKZ B;  3JQM A;  3CB4 A;  1JXE A;  3QT7 A;  3PM9 A;  3ZZ0 A;  1NJZ A;  1HW8 A;  2GJF A;  4YB5 A;  2M4M A;  4DV5 F;  2LU2 A;  1FRH A;  1TL7 A;  1KDN A;  2DIT A;  2V2V A;  3AQO A;  3AJD A;  1K73 T;  3M7V A;  4FXD A;  1HA1 A;  4J9S A;  2DXF A;  4JV5 F;  3GIM A;  3GFX A;  1SJQ A;  1U26 A;  2E1P A;  4NAS A;  1NU4 A;  1HNW J;  3CUN A;  3J7A 1;  4I6A A;  2HND B;  3PV8 A;  4I68 A;  2DK2 A;  4FVM A;  5DRK A;  2IDL A;  5KFE A;  2HS3 A;  2J7W A;  5ETP A;  1ZPV A;  5CH7 B;  4X65 F;  4QR1 A;  3D3B J;  2XS2 A;  2AYE A;  5EWG A;  3JSM A;  1ALJ A;  1EX8 A;  2MJN A;  5K20 B;  5H1S V;  3KJV B;  4ED4 A;  3BPD A;  1GX5 A;  4DQQ A;  3KK2 A;  3WHI A;  1RT3 B;  4ELT A;  2AJ2 A;  2Q6B A;  3KWM A;  5KFU A;  4DCJ B;  4I4B A;  1W7W A;  3MFI A;  2D1G A;  4IG3 A;  2NZ4 A;  1X4A A;  1HNX F;  1FRL A;  1NUE A;  2AJ4 A;  3PW5 A;  2ZZN A;  4MIV A;  3PFE A;  3TZX A;  1S6P B;  3C6T A;  3M2U A;  2DGS A;  1UEU A;  2V8D A;  3BH7 B;  1UA1 A;  2J6S A;  3FQL A;  4KO0 B;  1PYS B;  1UAW A;  3V4M A;  1C0U A;  3R2D J;  2B5J A;  4ETX A;  1FWK A;  3P3D A;  3S6E A;  5JVG Q;  1RT6 B;  4J9U E;  2WOM B;  4CO1 A;  2MKH A;  4P10 A;  3O1L A;  2QMX A;  4OV1 A;  1U2F A;  3ZTQ A;  5HBM B;  1CLF A;  4LSL B;  2V0N A;  3I87 A;  1Q53 A;  1YTY A;  1JJ2 R;  4OIX A;  2J0S D;  2MKC A;  2B51 A;  3NS5 A;  5D4L A;  3DU5 A;  3PHE A;  4JI6 F;  4EK2 A;  2N82 B;  2XB2 D;  4DS5 A;  2QEX S;  1T3N A;  2BKP A;  1DQ9 A;  2DT9 A;  4PXB A;  2R7T A;  3HHE A;  2XO7 A;  3BGR A;  3NBP B;  1NDL A;  2KI2 A;  4LRE A;  2OAU A;  3FEY B;  3FK4 A;  4DDF A;  3JTP A;  4AFF A;  4CP5 A;  3J80 Y;  2ZH9 A;  4DV4 J;  4DR2 J;  3Q8Y A;  2KFY A;  4RW9 A;  3OLB A;  1RKJ A;  3UPF A;  3PW4 A;  1AT1 B;  2DNG A;  2L9W A;  2RML A;  3ZNJ 1;  2PA8 D;  4B02 A;  3M8P A;  3MR5 A;  1UFW A;  9RUB A;  3R1H A;  3Q86 A;  2Z8Q A;  5KFT A;  1X4B A;  4HT7 A;  3HVR A;  1N6Q A;  3CC7 S;  4C8K A;  3PYD A;  3KLI B;  2Y1L B;  4TYB A;  8ATC B;  4FYD A;  3QAU A;  2FLL A;  4KT0 C;  1U2C A;  4OZ3 A;  1T8E A;  2QA2 A;  4OYM A;  3EPI A;  1F5B A;  2IJF A;  4X2B A;  1O5J A;  4N7T A;  2B6A B;  4ZJO A;  4M5D A;  1B64 A;  5DG7 A;  4KHR A;  1WKL A;  3HSG A;  2PI4 A;  2A10 A;  1FJC A;  2RD5 C;  2O66 A;  1AJD A;  2CQ0 A;  2WOM A;  4R5P B;  3MED B;  2G9O A;  2V8H A;  4DUY J;  3VAI A;  5GAH I;  2W2M P;  1XTZ A;  2HHP A;  5T41 A;  4M5H A;  3J7Y U;  2DR7 A;  1ELO A;  3IWX A;  5D0H A;  4ES2 A;  1X0F A;  1VQ4 S;  2I2Y A;  3CE8 A;  3W2W B;  3KKF A;  1OPZ A;  1SJ4 P;  2DGV A;  2CQ1 A;  3SQG B;  1FKP A;  3ADA C;  1SC6 A;  5KFW A;  4IQX A;  4X4V A;  3CJ4 A;  3ULH A;  2HHX A;  3GPA A;  1MN7 A;  3I32 A;  1IWG A;  1XMQ J;  2XMT A;  4CQ1 A;  4A8S A;  1EJJ A;  2VQE F;  5KXA A;  4IUF A;  5L0K A;  2W5X A;  2VBX A;  2HRU A;  3OR2 A;  1RT3 A;  5KT3 A;  2ZEJ A;  3HCX A;  3LPY A;  5H9E J;  4K2X A;  4CXU A;  2B5J B;  3CJ0 A;  3E2D A;  1R31 A;  1NPP A;  4TY9 A;  2P5V A;  5DLV A;  4RKU C;  3CCS S;  4ZCL A;  3RW7 A;  3TR5 A;  1J5E J;  3BRE A;  3PR4 A;  3SSS A;  3M6W A;  5GOV A;  3M8Q B;  1E6V A;  3JSY A;  2MY7 A;  3NL0 A;  3OVA A;  3BDP A;  4MTP A;  5GAH U;  1HFE L;  3OJS A;  5IT9 U;  1VJW A;  3NAI A;  5LMN J;  3H5X A;  4IYQ A;  1T03 B;  4FF3 A;  2QRR A;  4XAK A;  1FCA A;  1SJR A;  3CCR S;  1U1P A;  3NMA A;  5CHC B;  3MOJ B;  3MPW A;  4C8N A;  4B9L A;  2PFF B;  1UVK A;  4Q2L A;  5KFV A;  1YK9 A;  3M8W A;  5KOX A;  2IC3 B;  1FEE A;  4FXW A;  2XI2 A;  1S7I A;  3ZFV A;  1F5A A;  3E8O A;  3W9I A;  3D1O A;  2DNZ A;  2QFJ A;  4B9T A;  4CXS A;  3HP6 A;  2JEI A;  2VOP A;  4K5S A;  2BUN A;  5KOW A;  2YNI B;  1R0B G;  2LYV A;  4DV6 F;  3VCD A;  1S49 A;  3AJ2 A;  2N3O A;  4GTW A;  4LF5 J;  3R7B B;  2LXI A;  3P96 A;  4ZPV R;  3W2V A;  3H4B A;  4DV4 F;  3JS9 A;  2COL A;  1MW7 A;  2L9N A;  4HTI A;  2GSN A;  2KXF A;  3NCQ A;  2VKZ G;  4WYL A;  4Y2A A;  1KR4 A;  3CTR A;  1RAA B;  2DGQ A;  3WC0 A;  2ZUG A;  2YY3 A;  4ECU A;  3FCV A;  1H7X A;  3IR5 B;  4O23 A;  4R0J A;  3CWJ A;  1WTB A;  4DPO A;  3MM9 B;  3MK0 A;  4J90 A;  5KFG A;  1D8Z A;  1RP5 A;  4YR2 A;  4QIW D;  2GV1 A;  4P2S A;  2UXB F;  5JXS A;  1NZ8 A;  3DDN A;  3DRS A;  1KQK A;  4CLS A;  1SKU B;  4EYI B;  1RAJ A;  2F63 A;  3G82 A;  5K14 A;  1L3T A;  4ELU A;  2W8L A;  3CC2 S;  5D4N A;  2CQB A;  2XSF A;  3CJR A;  4NEY A;  5C42 A;  1VQM S;  3BN4 A;  2YNH B;  2B9W A;  3PX0 A;  5K9F A;  4X4N A;  3ILO A;  3H2L A;  4DX6 A;  1IBK J;  4P7T A;  4DX5 A;  4XDC A;  5D0G A;  3CD7 A;  5IV4 A;  2MGZ B;  3V6K A;  1H2T Z;  1H72 C;  2QTW A;  2XMV A;  2IM1 A;  4ZP7 A;  4ZVP B;  4IRC A;  1HLW A;  4K4X A;  1X5T A;  1BY9 A;  3TQE A;  2KG1 A;  1Q82 T;  2VJV A;  3EX7 B;  2GLQ A;  1VI7 A;  2AMC B;  3IA0 A;  3GIJ A;  1FJ7 A;  2BJ7 A;  2D74 B;  4ED1 A;  2IFY A;  2RH6 A;  1APS A;  2E5J A;  2JEF A;  1N33 F;  4F4Y A;  3PRB A;  3NRB A;  4UQG A;  2HBR B;  3OUY B;  3H4D A;  2DPJ A;  3K89 A;  2O01 C;  1SKS A;  4X65 J;  2UXC J;  1KH5 A;  2YBV A;  4P2F A;  4EZ9 A;  2QIF A;  1VRQ C;  2WW8 A;  3TX0 A;  5I3Q A;  5HAT A;  5T14 A;  2ZH2 A;  3G8T A;  1HQE A;  2HMI A;  2G13 A;  1SV5 A;  5L9X A;  2HNZ A;  1FWP A;  3GJS B;  3MM6 B;  2Z4P A;  1AJA A;  5B0E A;  2WRM A;  1FNX H;  1ZYQ A;  1FDB A;  2V34 A;  3WBH A;  1LXJ A;  1ZTT A;  2E5L F;  3FDS A;  5GME A;  1LWC B;  1PC4 A;  2LCW A;  1HNZ J;  2HIQ A;  1IWA A;  1B0T A;  1NSA A;  2B7B B;  2J6U A;  4TY8 B;  2QT7 A;  2R42 A;  3SI8 A;  1XEZ A;  2EXU A;  2F7V A;  1YBA A;  3BZQ A;  4ZMM A;  3OFE A;  1N5Q A;  1N36 J;  1T94 A;  1NRK A;  2C3M A;  2MZS A;  3GMG A;  3JQK A;  3SQG A;  1K7H A;  3LPE A;  4F8R A;  2NPI A;  2RIJ A;  3A13 A;  1GQE A;  3L4B C;  5FLX U;  4NYP A;  3W62 A;  2POK A;  2M8H A;  4G65 A;  4EBD A;  3T3F A;  1C1C B;  3CNQ P;  3H59 A;  4IFV B;  3J7Z 5;  2NSC A;  1TKZ A;  3K5N A;  3TAM A;  4DMZ A;  1KHW A;  1GMU A;  4JOU A;  1A6L A;  4RL1 A;  5B0F A;  4NWB A;  4WU2 A;  3IAS 9;  4G1P A;  3HPO A;  2DNH A;  2UVU A;  2PDA A;  4ZCI A;  1SCJ B;  2GMJ A;  5E3P A;  3VHQ A;  5J1E A;  2XMW A;  3LOU A;  3EYZ A;  3AD7 C;  4HAC B;  4GO5 X;  1XR6 A;  2EFQ A;  2VG6 B;  2VDI A;  3GYG A;  1H7W A;  3KDO A;  1KP6 A;  1Z4U A;  1U4B A;  3G82 B;  4EO6 A;  4AT1 B;  3RJM B;  1F9H A;  4LJM A;  1VQS A;  2N4C A;  2W2Q P;  1WG5 A;  3GG0 A;  4KRW A;  4PAB A;  3CJK B;  3OVS A;  3BGR B;  3NBP A;  1JK9 B;  3FMB A;  2W5S A;  2BJ8 A;  5CYJ A;  3DLG A;  1U7L A;  4UW2 A;  4QIG A;  1VIO A;  4CLW A;  3K5L A;  3EZU A;  4KTQ A;  2WON A;  1SVD A;  1Y5L B;  3GCX P;  3PG9 A;  4RR5 A;  4HDH A;  1QVF R;  1YG0 A;  3IBW A;  4CLL A;  3KMQ A;  4B3R F;  4LF9 J;  2W5Q A;  4JI0 F;  4A8Q A;  4ZG9 A;  3FBF A;  3DI6 A;  1QSY A;  3OBI A;  1KQF B;  2GW8 A;  3NEK A;  4ZVS B;  4DV1 F;  1KLN A;  3KJV A;  5KFH A;  1M0S A;  1D3W A;  2JHE A;  1ZA2 B;  3DC2 A;  4LF6 J;  1CJK B;  1KQG B;  1T3O A;  2WVB A;  4OI3 A;  4WFY A;  1X8D A;  2BJ1 A;  3MCM A;  1CJK A;  2NPF A;  5IXU A;  4DR2 F;  1DZ5 A;  5D3G A;  3DXS X;  1TL3 A;  2NLW A;  3MMC A;  3OR1 B;  3LP1 A;  1W2I A;  4ZPC A;  4DEZ A;  3NGD A;  3HHL C;  2ZHB A;  2YNG B;  1KNZ A;  3D1Q A;  4F02 A;  2X98 A;  1YLX A;  4RUB A;  4C2M A;  3QIP B;  4IR9 A;  1RXO B;  1KFD A;  1T9V A;  2YKM B;  3S8S A;  2HLU A;  2R2U A;  4F4X A;  1N54 B;  4QBU A;  2D3O 1;  3WC2 A;  4KAY A;  1IBC B;  2DNY A;  2ZE2 B;  3SDE B;  2QC3 A;  4ZJQ A;  2CQP A;  3BQ1 A;  2RJZ A;  3RW6 A;  1JJ4 A;  5H9F K;  2A2D A;  1GEH A;  3DOL B;  4MY4 A;  2E44 A;  4CNZ A;  3EDQ B;  1ANJ A;  2YKN B;  1PBA A;  1S1W B;  4KB7 A;  1XR5 A;  2CQH A;  4X4S A;  1B7Y B;  3HSJ A;  1RA7 A;  2CPF A;  3C2P A;  3H5S A;  1NK4 A;  1R0C B;  2MDA A;  4HR2 A;  4O3N A;  5I4M A;  1KVK A;  3M9M B;  3M8Y A;  4JV0 A;  1HNX J;  2HHW A;  2HHQ A;  4LRC A;  3T5J A;  4RU9 A;  3MEC A;  2DB1 A;  1EP4 B;  5F0U A;  5E41 A;  1Q95 G;  5DO2 A;  4DV0 J;  4FS1 A;  4M95 A;  2AZ1 A;  4CXK A;  2EBE A;  3TJA A;  4UT4 A;  2CPI A;  4LSZ B;  5LRM A;  2RHQ B;  2BVZ A;  1OPI A;  3MR7 A;  1N34 J;  4WJB A;  5DLF A;  1N6Q B;  3P5T L;  4LQ3 A;  4ZPW R;  1RAE B;  5ETL A;  3NGS A;  5DLW A;  4LFB J;  3Q0A A;  2MST A;  3PX4 A;  1HNW F;  1EW2 A;  2QA4 G;  2GSU A;  4NA3 A;  1YDL A;  1RT2 A;  2ZKT A;  2IYI A;  2ZIT A;  1FFS B;  3PY8 A;  3OLA A;  2PA3 A;  4KE5 A;  1FRJ A;  5IOL A;  3NWR A;  5IM0 A;  4DV5 J;  3IS9 B;  4U8Y A;  2GGP A;  2CJQ A;  2GX8 A;  3D67 A;  3W5Z A;  4Z7Y A;  4BS2 A;  2D1C A;  2GGP B;  2FJW A;  3V2U C;  1ZEF A;  4QR2 A;  4J9R A;  2R7O A;  4PRF A;  3W2V B;  1HQA A;  1OO0 B;  3M32 B;  2K3K A;  2W9B B;  3MDF A;  1I94 F;  2CJK A;  3GSD A;  4OX7 A;  5T7L B;  2JJ4 D;  2QO3 A;  2EKY A;  3GWC A;  1N0V C;  2VPY B;  3QJP A;  2ZM6 F;  1WC6 A;  1Y00 A;  3FEZ A;  3GII A;  4K0K F;  2F40 A;  1QVG R;  2DNN A;  3OTE A;  4LF1 A;  4I1T A;  3BPS P;  3NKM A;  4OHZ A;  1NH7 A;  4JP8 A;  4B3M J;  1WHW A;  2B9X A;  3FFI B;  2ZBC A;  4ICL B;  4HH0 A;  1T03 A;  1RWK B;  1X4G A;  1OIA A;  3MEK A;  3PJ9 A;  1WHY A;  3PVX A;  1JB0 C;  5MLC V;  4YHH J;  5KFI A;  2DCU B;  2YNG A;  4J9L A;  1Q79 A;  3F41 A;  3RUB L;  1YJT A;  2CWX A;  2ACY A;  1RAB B;  3HHL D;  3MPD A;  2NXU A;  2YNI A;  1PCA A;  2QL5 B;  1LKZ A;  4XTT A;  3M05 A;  4DR5 F;  3FJ2 A;  2UUA J;  4X84 A;  3RRH A;  3TUZ C;  2HSE B;  3KMS A;  1X9W A;  2FY1 A;  3UNG C;  3L7P A;  3MEE B;  5LSO A;  1V3R A;  2XYG B;  1VBY A;  3C6T B;  3M2U B;  2QX0 A;  3CCW A;  2HGN A;  3Q2S C;  3QT8 A;  5HMY A;  1MWQ A;  4ECZ A;  3V81 A;  1WOS A;  2RQ4 A;  1ALI A;  3R27 A;  2CIM A;  2YPY A;  4WKR A;  4M8L A;  2JX2 A;  2MY8 A;  2OH2 A;  2WON B;  3WAV A;  1PYO B;  4PKD B;  1CJV B;  1UMJ A;  3IGV A;  2M8D B;  2CDR B;  1PKU A;  3CCU S;  1UVJ A;  1KSP A;  3RB4 A;  5LIA A;  4J9M A;  1NHU A;  5ETM A;  4PQU B;  3CW2 C;  4CO3 A;  2E29 A;  4O3S A;  1LNQ A;  3AAW B;  1K9M T;  2B4V A;  1NJI T;  3TG0 A;  2WCX A;  1MMN A;  4R5P A;  3N01 A;  2QLX A;  2BZ2 A;  5KFJ A;  2IYG A;  4UF4 A;  4MHX A;  1HBN A;  2GZO A;  2YNH A;  3LAM A;  3LW5 C;  4TNO A;  5FDL A;  5LJ5 Y;  4DL2 A;  1V5V A;  1N34 F;  2R8K A;  2GCF A;  3I6P A;  1QDU B;  1S57 A;  2MQM A;  2XI3 A;  5E3R A;  1WOO A;  1IM4 A;  2OMO A;  1FXL A;  2X1B A;  2B7C B;  3DRS B;  4O3P A;  3J81 Y;  2LXF A;  1Q0N A;  4RWX A;  2D3U A;  3N5B A;  4PPD A;  3V6H A;  4DPY A;  1NME B;  2I5J B;  2NYI A;  3ZXW A;  5BR8 J;  4KHP F;  2WW4 A;  5LOQ A;  3CIM A;  2RSQ A;  2I5J A;  3N6L A;  1ZM9 A;  3GB0 A;  3NOG A;  3J80 U;  3Q8S B;  3NKN A;  1HQU B;  3EVM A;  1ANI A;  4NLQ A;  1C1C A;  2QLF B;  3TWZ A;  3B82 A;  2XY7 A;  1QTN B;  2XMU A;  4J9V A;  2QJ3 A;  3NGK A;  2W9C B;  2YNF A;  1WAC A;  2DEI A;  4H4O B;  2W9B A;  2G9Y A;  4CWB A;  3TAP A;  2VZ9 A;  4ECX A;  4DI6 A;  1WHX A;  4WBF A;  2GQC A;  2H48 B;  1M1H A;  4CO2 A;  3A8I A;  2K8G A;  4NL5 A;  2KM8 C;  5KFM A;  4X62 J;  3HJF A;  4XK8 C;  4A8O A;  2BXJ A;  1TAU A;  1RIS A;  2FHM A;  3BS9 A;  2YH1 A;  1C1B B;  4K7Q A;  2W4C A;  1RBA A;  1KH4 A;  4KHP J;  1M5S A;  4IRD A;  1RU1 A;  3UN3 A;  2WB1 D;  2IBO A;  4IFY A;  2Z30 B;  1U6Z A;  2FJA B;  4M5I A;  2W8K A;  2KN4 A;  4CO5 A;  4RU2 A;  2P8I A;  3Q89 A;  2GSO A;  5HQL A;  3QZ7 A;  3HX9 A;  2FVP A;  1RCO B;  1TKT B;  2KJV A;  3FMW A;  3ISZ A;  3CMA S;  1HYS A;  1JLF B;  1S6Q A;  4FNH A;  3MD3 A;  3QMQ A;  4IH6 A;  5ETR A;  2Y9H A;  1BQM A;  4I2P A;  2IM2 A;  2DR9 A;  4FDJ A;  1VRT A;  2VBZ A;  4Y34 A;  4W4M A;  4LF6 F;  2MZQ A;  2VD3 A;  4ILM A;  4OZ0 A;  1FT8 A;  4Y3C A;  4Y0F A;  2R9L A;  4FZV A;  4YR3 A;  2KB2 A;  2VG7 A;  4O44 A;  3OVB A;  3KK3 B;  2FIU A;  4DFK A;  3KLE A;  4LF9 F;  2P9G A;  4ZP9 A;  3SCI E;  4A47 A;  2UU9 J;  4FF1 A;  3MWB A;  4NLR A;  1T02 A;  2BRK A;  1S1U A;  4NLO A;  2JVO A;  4L75 A;  3TAR A;  3HD2 A;  1S1U B;  4EYH B;  4DSF A;  1K0T A;  1NM2 A;  2GML A;  1NXI A;  2Z2M A;  4RBU A;  5AJ9 A;  4IRK A;  3GFY A;  3UN5 A;  1LW0 B;  4CYR A;  3MOZ A;  2KJW A;  1BLU A;  2IJR A;  5B0G A;  3ZTS A;  2ZH3 A;  2UUA F;  1C2P A;  3NKP A;  1DBD A;  1I3O B;  2HS0 A;  5ETO A;  5DLT A;  3TA0 A;  4E0D A;  3NS6 A;  5I3U B;  2BQU A;  2DGU A;  2B4P A;  4FXV A;  3H2U B;  5D15 A;  2UUC F;  3MED A;  3OL9 A;  1S12 A;  1P1T A;  4B3S J;  4WE1 A;  4YHH F;  3ILI A;  1RBL A;  3MCS A;  4Y2I A;  1UVM A;  4Q0B B;  2AYB A;  1LK7 A;  1SL2 A;  3VAF A;  2JVR A;  1YZ7 A;  3R97 A;  3PJW A;  4MIW A;  2DRA A;  5TJ3 A;  4B3M F;  2ZBP A;  3Q22 A;  3DRY A;  2I1R A;  2WAQ D;  2XNQ A;  4OX6 A;  3UWT A;  4RPF A;  2J9D E;  2ROP A;  2ZM6 J;  2EK6 A;  1IBL F;  5LT5 A;  2DHA A;  2CYY A;  3OTD A;  4K8R A;  2ZKU A;  2J5A A;  2XGQ A;  4ECT A;  5G0R B;  2ZH6 A;  1HR0 F;  2QFI A;  5L9N A;  4OJ1 A;  3KLG B;  3VAG A;  4LF7 J;  2EPI A;  1XK8 A;  4PQU A;  3DLE B;  2XR9 A;  2QE5 A;  2VC0 A;  1R3N A;  1X4H A;  3BEG B;  3M6U A;  2PI5 A;  1VC0 A;  2Y1R I;  2NYH A;  2GO9 A;  3W65 A;  5D6G A;  4GKJ J;  1NB2 A;  3HVA A;  2KZM A;  3CF5 Q;  3DHX A;  2FGO A;  3H0P A;  1LW2 A;  1SI9 A;  3IGN A;  3VGT A;  3HMJ G;  4QU6 A;  4EFA C;  1H2U X;  1VBZ A;  3IGY B;  5J2P A;  1TU0 B;  5D8H B;  4IR1 A;  1OY6 A;  5GAG I;  1HBN B;  1F1B B;  2IVY A;  3CPW R;  2HWT A;  1HNV B;  2HZC A;  4EWT A;  2W5T A;  1LWE A;  4ATN A;  1PJ7 A;  3I82 A;  1S0O A;  1J5O A;  5K8O A;  2CQ4 A;  1JNZ B;  2GC8 A;  1BE4 A;  3KYL A;  2BE7 D;  2GO8 A;  4H4K C;  1LWF B;  3OJU A;  1XNQ J;  5A0Y A;  4Q44 A;  5F8N A;  4HI1 A;  5IZH A;  3SDE A;  4DV0 F;  1S6P A;  2HWI A;  4RNH A;  2D69 A;  5KT7 A;  1RDR A;  4MMO A;  4KBI A;  5IC4 B;  2R8I A;  2IRY A;  4J9K A;  2OFH X;  3CMQ A;  2LA4 A;  1RTI A;  5BYS A;  4B9U A;  4U7U D;  3M8S A;  1XNR F;  3I9Z A;  4CH7 A;  4DQP A;  3GR0 A;  4DJB A;  3HJV A;  3KLG A;  1FSU A;  1S1X B;  4K4S A;  4MIA A;  3DHW C;  3JSB A;  1B7F A;  2KM8 B;  2W2P P;  3NVL A;  4TQS A;  3IBC B;  3D6T B;  2W7A A;  4IFY B;  1DTQ B;  1WC1 A;  1EKR A;  5KG6 A;  3DOK A;  3K58 A;  1VLY A;  1SBR A;  4ZG6 A;  1EKS A;  2W25 A;  2AJF E;  4HLB A;  2AYM A;  4Y2C A;  5HLF A;  2DRB A;  5KFZ A;  5EGH A;  2OPP B;  3OFG A;  1HI0 P;  1SC3 B;  4P52 A;  3DPC A;  1TK0 A;  1UCN A;  2UZA A;  4L3K A;  4A46 A;  2KU7 A;  4KPY A;  3SCJ E;  1X4E A;  2HVD A;  3M8P B;  2B4O A;  1RT5 A;  3KJQ B;  3UI3 A;  4N56 A;  2WSC C;  1MLA A;  5D0E A;  5A8W B;  4U7C A;  1QSL A;  4DV3 F;  2RKI A;  1SQF A;  2XZD B;  5KFL A;  5C66 A;  4P74 A;  4X4O A;  3HFV A;  1RTZ A;  1RT1 A;  3BF4 A;  4TLR A;  2L08 A;  3TEH B;  4YY3 F;  4CIO A;  3QO9 B;  1FEH A;  1S7H A;  2KH9 A;  3RB6 A;  4PPZ A;  1D9A A;  2AEJ A;  1TR0 A;  3M2V B;  2B6A A;  1HHT P;  4HEA 9;  3C19 A;  2BMB A;  3QWU A;  1VMB A;  4M5D B;  3M9O B;  2DNL A;  3VZH A;  5M2R A;  4KJG A;  2FY8 A;  4KGK A;  1U0S A;  4OYW A;  4ECS A;  5L1L A;  1FXD A;  1QAI A;  2C3U A;  1OYD A;  4DR4 F;  3K5P A;  1GT8 A;  3TZZ A;  1NKE A;  4UPL A;  2NXC A;  1TKX B;  2OPQ B;  1DTQ A;  1U1R A;  3R7S B;  3FZB A;  3O44 A;  2NXN A;  2CQD A;  5KG0 A;  2E9Z A;  2UP1 A;  5I3U A;  3I4P A;  4F0K A;  3GTY X;  4L76 A;  3D4J A;  4LSN A;  4NLD A;  4UUX A;  4MYT A;  3MPY A;  1WI6 A;  2ADC A;  4L74 A;  3MUR P;  2YX4 A;  5AJ3 J;  2OI2 A;  4Q5V A;  4K4V A;  1YKW A;  3C46 A;  2UUT A;  4Y28 C;  2HBZ B;  2EC0 A;  4PWD A;  2W2O P;  2DXD A;  5J2N B;  5EX0 A;  2WB4 A;  2W5V A;  1RTI B;  4PG6 A;  3BDG B;  3TW0 A;  2OEK A;  4NE9 C;  4TLQ A;  4PR6 A;  3PFO A;  4Y2M A;  5LXY A;  4IG3 B;  5B0A A;  1HD0 A;  1MRO B;  1RWU A;  2VFV A;  3I0R A;  4NRU A;  4V1A k;  4ZVF A;  3VAL A;  5KFA A;  2PN6 A;  5L8R C;  3PW2 A;  2EFP A;  1FI4 A;  3BBF A;  1G2E A;  3K2Y A;  5L0B A;  2QMW A;  5JJB A;  2R8J A;  1F2H A;  3CDU A;  1P9Q C;  4YEA A;  4OMF G;  2K7J A;  2MLZ A;  3G2X A;  1YQH A;  4WTO B;  3ENA A;  5L38 A;  2MYF A;  2AW0 A;  4ILR A;  5KFD A;  4DQR A;  2MKJ A;  3AXM A;  2R7R A;  4NLS A;  1UTA A;  2ZD1 A;  4CZC A;  4DSE A;  3N9U C;  2VKR A;  2ZD1 B;  2Z2Y B;  2CNO B;  4UOP A;  3PIO Q;  3DOM B;  5KFY A;  4RUC A;  5J2Q B;  3THT A;  2AJ1 A;  2XTJ P;  1HNZ F;  2J0Q D;  2F5G A;  3D6H B;  4I2Q B;  3BDH A;  4B9N A;  1FVQ A;  4ZG7 A;  1J5O B;  5CD4 A;  2KT2 A;  4WIQ A;  3PEH A;  1B3T A;  1HNV A;  2KXH A;  5D78 A;  4UTG A;  2MQO A;  4Q8F A;  1LWE B;  3U02 A;  2IBK A;  3UNY A;  5AXK A;  4UPH A;  1R8B A;  4G1Q B;  5IT0 A;  1UPP A;  3CSK A;  1R8A A;  3FSY A;  3GFZ A;  4ZLJ A;  1S0M A;  3WZ0 A;  4KV8 A;  3QRQ A;  3E01 A;  1VLO A;  1M90 T;  1MU2 A;  5DDQ C;  2CG4 A;  4RNO A;  2ANH A;  4IO9 Q;  1KVJ A;  2IHR 1;  2BJD A;  1VBX A;  2AT1 B;  4DPW A;  4RW7 A;  3FFI A;  3VF0 B;  2HUR A;  4BLG A;  1ZA1 B;  2VAS A;  4X4U A;  1RJJ A;  1VIS A;  2V8G A;  1EAR A;  1FVS A;  5A76 A;  3BSN A;  4H4M A;  1VQN S;  3EXC X;  3DYA A;  2AZ3 A;  2FLO A;  1N5S A;  3LUY A;  1WEX A;  2I8E A;  1ZET A;  2H5E A;  4UZC A;  4LRB A;  1Q7L B;  5ETS A;  4J9Q A;  1HWU A;  3R6L B;  1RHU B;  4O4G B;  3VZI A;  3MMB A;  1ARO P;  1JLC B;  1NPR A;  1VK3 A;  4P75 A;  2IIH A;  4CYU A;  3C3L A;  4U96 A;  3ZTP A;  4HAC A;  2ALY B;  1K1Q A;  5EWF A;  5HVH A;  2EFO A;  4A8M P;  2MQ8 A;  6FDR A;  5LSL A;  3V5R A;  4X4T A;  4C8L A;  1NJW A;  2XLK A;  2OPP A;  3WAY A;  1A7G E;  2RRN A;  3OFF A;  2BBE A;  2OSQ A;  5KTQ A;  3BJY A;  2IY5 B;  2BEF A;  2BW2 A;  3T6J A;  4C48 A;  3C6U B;  2HHV A;  5DZ7 A;  4FN5 A;  1X60 A;  2A18 A;  2BE2 A;  2EFN A;  5K8M A;  4IFV A;  1URA A;  4G3I A;  5A2Q Y;  1VC5 A;  3B6B A;  1WC0 A;  2CQ2 A;  1Y10 A;  2SXL A;  4Q2M A;  4L72 B;  3TP2 A;  1YI2 S;  3K7R A;  1CS4 B;  1X5O A;  2W4D A;  2OTJ S;  5HVF A;  5A8K B;  2HW3 A;  1OSC A;  1CS4 A;  2AP6 A;  1YBT A;  2EC2 A;  2V2Z A;  1JQG A;  3UR0 A;  2BRL A;  3NCR A;  4PUO A;  1RAC B;  3R1L A;  1VHI A;  4I0W A;  4B9M A;  2PC6 A;  4K50 A;  2W5W A;  2JLF A;  1ZOT A;  4PG7 A;  3VR1 A;  4WFX A;  3EZ5 A;  2DYA A;  2DGX A;  2KYX A;  4RZR A;  2B8Q A;  3KFW X;  3CVK A;  4N47 A;  1KHV A;  5KG1 A;  3FEX B;  1TKX A;  2G1D A;  2OPQ A;  3HHK A;  2P2C B;  1SC1 B;  3MMJ A;  4ZDN A;  3CCQ S;  2AGO A;  1WD6 A;  1E33 P;  1U48 A;  4DSK A;  3MI7 X;  2KRB A;  4Y65 A;  1UZH A;  3MUM P;  3NNH A;  3PYG A;  2FVQ A;  1HR0 J;  1F6T A;  2WBR A;  4YOE A;  4JI7 J;  3W5X A;  1JXV A;  3QAT A;  2A2C A;  2KT5 A;  3HSD A;  1KHN A;  3KK3 A;  1FKP B;  2XHC A;  5FD1 A;  5IS2 A;  3AXK A;  3KJF B;  5F8G A;  1D9D A;  4GKK F;  1KHJ A;  4UUW A; 
#chains in the Genus database with same CATH homology
 1ZED A;  3NKM A;  3A52 A;  2XRG A;  4UOR A;  4ZG6 A;  3UN2 A;  1ELY A;  1ALH A;  4QAX A;  4CXS A;  5IJQ A;  2W5V A;  1P49 A;  1EJJ A;  3BDG B;  4UPK A;  4CYS A;  4UOO A;  3IDD A;  1ELZ A;  5KXA A;  3T02 A;  5L0E A;  5L0K A;  2W5X A;  1AJC A;  4KJD A;  4ZGA A;  3BDF A;  2W8D A;  5GRR A;  4LR2 A;  4GTX A;  5TJ3 A;  1B8J A;  4CXU A;  2IUC A;  5K4P A;  3WAW A;  5L0B A;  1ZEB A;  4LR9 A;  4LRA A;  3NKR A;  3WAX A;  3E2D A;  1E1Z P;  5EGE A;  5DLV A;  3KD8 A;  4LRF A;  2W5R A;  5GOV A;  1EW8 A;  1ALI A;  2W5S A;  1KH7 A;  3WAV A;  1EW9 A;  1KHL A;  4UOP A;  3SZY A;  3M8W A;  4NWX A;  1AUK A;  5LIA A;  4LR8 A;  3M7V A;  1ELX A;  2W5Q A;  3BDH A;  4ZG9 A;  4ZG7 A;  1EQJ A;  3IGY B;  3MK1 A;  3UNY A;  4GTW A;  5LQQ A;  3CMR A;  2W5T A;  4GTY A;  4GTZ A;  2W8S A;  1KH9 A;  4TN0 A;  4UPH A;  2GSN A;  3UO0 A;  3LXQ A;  1ALJ A;  2ANH A;  1ALK A;  2X98 A;  3DYC A;  1ED8 A;  1N2L A;  1E2S P;  4KJG A;  2D1G A;  3BDG A;  3MK0 A;  5HRT A;  3NKN A;  5INH A;  1ANI A;  1O98 A;  4FDI A;  4MIV A;  3TWZ A;  4KAY A;  3Q3Q A;  1KHK A;  1SHQ A;  3B5Q A;  4LRB A;  1FSU A;  3T00 A;  4MY4 A;  1HJK A;  2G9Y A;  1ANJ A;  3OT9 A;  4LQY A;  3NVL A;  2IUC B;  3ED4 A;  3WAY A;  1N2K A;  3M8Y A;  5IJS A;  1KH4 A;  4LR7 A;  2VQR A;  4LRC A;  4B56 A;  1E3C P;  2GLQ A;  5EGH A;  3UN3 A;  1URA A;  2RH6 A;  2XR9 A;  1SHN A;  4YR1 A;  2IFY A;  1HDH A;  2GSO A;  3DPC A;  4CXK A;  5LRN A;  1EI6 A;  4LRD A;  5LRM A;  4LRE A;  3SZZ A;  4KAV A;  1KH5 A;  3NKO A;  4FDJ A;  1Y7A A;  4UPI A;  3TX0 A;  5C66 A;  5DLW A;  1URB A;  1EW2 A;  2GSU A;  1AJA A;  2W5W A;  2GA3 A;  3NKQ A;  2ZKT A;  4MHX A;  3WBH A;  2QZU A;  3TG0 A;  1E33 P;  1O99 A;  3M8Z A;  1AJB A;  4N7T A;  1Y6V A;  1ZEF A;  4KM4 A;  5AJ9 A;  3IGZ B;  5DLT A;  1HQA A;  4UPL A;  3UN5 A;  3T01 A;  1AJD A;  4CYR A;  1KHN A;  3NKP A;  1K7H A;  1ED9 A;  1KHJ A;  4NWJ A;  3MK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...