3MFBA

Crystal structure of the s-type pyocin domain of eca1669 protein from erwinia carotovora, northeast structural genomics consortium target ewr82c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
150
structure length
150
Chain Sequence
MLLTPEKLLEAANKQGTVPSRVRYQWMEDEETGRLKAVGYHTSMESGRDQVRVRLLKHDFPNNRYEFWEEGATGPTILWTPDNPGIELPTDTAHGEQPVIPSAIPGLEIPEMDDVSILATPMPDEKDFRDYILVFPENAFPPIYVYLSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Northeast Structural Genomics Consortium Target EwR82C
rcsb
molecule tags Structural genomics, unknown function
source organism Erwinia carotovora
molecule keywords Uncharacterized protein
total genus 28
structure length 150
sequence length 150
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...