The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
109
|
structure length |
109
|
Chain Sequence |
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Signaling protein
|
| molecule keywords |
Growth/differentiation factor 8
|
| publication title |
Structure of myostatinfollistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
pubmed doi rcsb |
| source organism |
Mus musculus
|
| total genus |
16
|
| structure length |
109
|
| sequence length |
109
|
| ec nomenclature | |
| pdb deposition date | 2011-06-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00019 | TGF_beta | Transforming growth factor beta like domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Cystine Knot Cytokines, subunit B | Cystine-knot cytokines |
#chains in the Genus database with same CATH superfamily 5E4G A; 1M4U L; 3EVS B; 4BV4 L; 1BMP A; 1FL7 B; 1TZH V; 4QAF C; 5HI3 A; 3QTK A; 4YCG C; 2GH0 C; 1REW A; 3BDY V; 4QHU C; 2QJA A; 1VPP V; 4YCI C; 5BQ8 B; 1ES7 A; 1FLT V; 1XWD A; 3QB4 A; 1PDG A; 1M4U A; 2KD3 A; 4N1D A; 1BND B; 5F3B C; 5HK5 A; 2GOO A; 5HHC A; 1E9J A; 1BTG A; 1FZV A; 2TGI A; 3BMP A; 1B8M B; 5HI5 A; 3SEK B; 1NYS B; 1QFW B; 4QCI C; 2PJY A; 5F3H I; 2P6A A; 5HHD A; 5FV1 V; 1B8M A; 5BQ8 D; 1REU A; 4ZBN A; 1AOC A; 2IFG E; 2FJG V; 3B4V A; 4GLN E; 2QJB A; 1HCF A; 3KFD A; 3JVF A; 5BQE A; 1B98 A; 1BET A; 1XWD B; 2QCW A; 1SG1 A; 1TGJ A; 4EFV A; 4LXR J; 4KV5 A; 3BK3 A; 4UI0 A; 4UI2 B; 1SGF B; 4UHZ A; 3P9W A; 5BPU A; 2GNN A; 2X1W A; 3IJ2 A; 1ZKZ A; 2X1X E; 4AY9 A; 4EAX A; 2GYZ A; 3HH2 A; 4KZN A; 4X1J A; 2QCQ A; 1TGK A; 5HI4 A; 2BHK A; 1HCN A; 1AGQ A; 1BJ1 V; 1NT3 A; 4KXZ A; 4MQW B; 1LXI A; 1MKK A; 5BQE B; 1KTZ A; 4WPB A; 1KAT W; 1CZ8 V; 3MJG A; 4XPJ A; 3V2A A; 4HQU A; 1KLA A; 4MQW A; 4EDW V; 1WAQ A; 1WQ9 A; 1RV6 V; 1MKG A; 1TFG A; 1VPF A; 1JPY A; 4FAO A; 4HR9 A; 4AY9 B; 3FUB B; 2ARP A; 2H64 A; 1TZI V; 2FJH V; 2XV7 A; 3BUK A; 4GLS E; 3V6B A; 1NYU B; 2C7W A; 2QJ9 A; 4MPL A; 2GYR A; 2VWE A; 1HCN B; 1WQ8 A; 2H62 A; 2ARV A; 1HRP A; 5JZ7 A; 4EDX V; 4LXS J; 5BQB A; 1HD4 A; 4HSA A; 5FV2 V; 2QR0 C; 1LX5 A; 1DZ7 A; 1WQ9 B; 1WWW V; 4UI1 A; 5HK5 E; 3MJK A; 4EC7 A; 1FL7 A; 5HHX A; 1MJV A; 4ZFF C; 5HHV A; 3EO1 C; 4HQX A; 2VPF A; 1KLC A; 5BQ8 A; 1BND A; 3S1B V; 2R52 A; 2V5E B; 3S1K V; 5AEJ A; 5BQC A; 4MID A; 2R53 A; 1HRP B; 4UHY A; 1B8K A; 3E07 A; 2ASK A; 2B0U A; 1S4Y B; 2XAC A; 1QTY R; 1QFW A; 3RJR A; 2VXS A; #chains in the Genus database with same CATH topology 5E4G A; 1M4U L; 3EVS B; 4BV4 L; 1BMP A; 1FL7 B; 1TZH V; 4QAF C; 5HI3 A; 3QTK A; 4YCG C; 2GH0 C; 1REW A; 3BDY V; 4QHU C; 2QJA A; 1VPP V; 4YCI C; 5BQ8 B; 1ES7 A; 1FLT V; 1XWD A; 3QB4 A; 1PDG A; 1M4U A; 2KD3 A; 4N1D A; 1BND B; 5F3B C; 5HK5 A; 2GOO A; 5HHC A; 1E9J A; 1BTG A; 1FZV A; 2TGI A; 3BMP A; 1B8M B; 5HI5 A; 3SEK B; 1NYS B; 1QFW B; 4QCI C; 2PJY A; 5F3H I; 2P6A A; 5HHD A; 5FV1 V; 1B8M A; 5BQ8 D; 1REU A; 4ZBN A; 1AOC A; 2IFG E; 2FJG V; 3B4V A; 4GLN E; 2QJB A; 1HCF A; 3KFD A; 3JVF A; 5BQE A; 1B98 A; 1BET A; 1XWD B; 2QCW A; 1SG1 A; 1TGJ A; 4EFV A; 4LXR J; 4KV5 A; 3BK3 A; 4UI0 A; 4UI2 B; 1SGF B; 4UHZ A; 3P9W A; 5BPU A; 2GNN A; 2X1W A; 3IJ2 A; 1ZKZ A; 2X1X E; 4AY9 A; 4EAX A; 2GYZ A; 3HH2 A; 4KZN A; 4X1J A; 2QCQ A; 1TGK A; 5HI4 A; 2BHK A; 1HCN A; 1AGQ A; 1BJ1 V; 1NT3 A; 4KXZ A; 4MQW B; 1LXI A; 1MKK A; 5BQE B; 1KTZ A; 4WPB A; 1KAT W; 1CZ8 V; 3MJG A; 4XPJ A; 3V2A A; 4HQU A; 1KLA A; 4MQW A; 4EDW V; 1WAQ A; 1WQ9 A; 1RV6 V; 1MKG A; 1TFG A; 1VPF A; 1JPY A; 4FAO A; 4HR9 A; 4AY9 B; 3FUB B; 2ARP A; 2H64 A; 1TZI V; 2FJH V; 2XV7 A; 3BUK A; 4GLS E; 3V6B A; 1NYU B; 2C7W A; 2QJ9 A; 4MPL A; 2GYR A; 2VWE A; 1HCN B; 1WQ8 A; 2H62 A; 2ARV A; 1HRP A; 5JZ7 A; 4EDX V; 4LXS J; 5BQB A; 1HD4 A; 4HSA A; 5FV2 V; 2QR0 C; 1LX5 A; 1DZ7 A; 1WQ9 B; 1WWW V; 4UI1 A; 5HK5 E; 3MJK A; 4EC7 A; 1FL7 A; 5HHX A; 1MJV A; 4ZFF C; 5HHV A; 3EO1 C; 4HQX A; 2VPF A; 1KLC A; 5BQ8 A; 1BND A; 3S1B V; 2R52 A; 2V5E B; 3S1K V; 5AEJ A; 5BQC A; 4MID A; 2R53 A; 1HRP B; 4UHY A; 1B8K A; 3E07 A; 2ASK A; 2B0U A; 1S4Y B; 2XAC A; 1QTY R; 1QFW A; 3RJR A; 2VXS A; #chains in the Genus database with same CATH homology 5E4G A; 1M4U L; 3EVS B; 4BV4 L; 1BMP A; 1FL7 B; 1TZH V; 4QAF C; 5HI3 A; 3QTK A; 4YCG C; 2GH0 C; 1REW A; 3BDY V; 4QHU C; 2QJA A; 1VPP V; 4YCI C; 5BQ8 B; 1ES7 A; 1FLT V; 1XWD A; 3QB4 A; 1PDG A; 1M4U A; 2KD3 A; 4N1D A; 1BND B; 5F3B C; 5HK5 A; 2GOO A; 5HHC A; 1E9J A; 1BTG A; 1FZV A; 2TGI A; 3BMP A; 1B8M B; 5HI5 A; 3SEK B; 1NYS B; 1QFW B; 4QCI C; 2PJY A; 5F3H I; 2P6A A; 5HHD A; 5FV1 V; 1B8M A; 5BQ8 D; 1REU A; 4ZBN A; 1AOC A; 2IFG E; 2FJG V; 3B4V A; 4GLN E; 2QJB A; 1HCF A; 3KFD A; 3JVF A; 5BQE A; 1B98 A; 1BET A; 1XWD B; 2QCW A; 1SG1 A; 1TGJ A; 4EFV A; 4LXR J; 4KV5 A; 3BK3 A; 4UI0 A; 4UI2 B; 1SGF B; 4UHZ A; 3P9W A; 5BPU A; 2GNN A; 2X1W A; 3IJ2 A; 1ZKZ A; 2X1X E; 4AY9 A; 4EAX A; 2GYZ A; 3HH2 A; 4KZN A; 4X1J A; 2QCQ A; 1TGK A; 5HI4 A; 2BHK A; 1HCN A; 1AGQ A; 1BJ1 V; 1NT3 A; 4KXZ A; 4MQW B; 1LXI A; 1MKK A; 5BQE B; 1KTZ A; 4WPB A; 1KAT W; 1CZ8 V; 3MJG A; 4XPJ A; 3V2A A; 4HQU A; 1KLA A; 4MQW A; 4EDW V; 1WAQ A; 1WQ9 A; 1RV6 V; 1MKG A; 1TFG A; 1VPF A; 1JPY A; 4FAO A; 4HR9 A; 4AY9 B; 3FUB B; 2ARP A; 2H64 A; 1TZI V; 2FJH V; 2XV7 A; 3BUK A; 4GLS E; 3V6B A; 1NYU B; 2C7W A; 2QJ9 A; 4MPL A; 2GYR A; 2VWE A; 1HCN B; 1WQ8 A; 2H62 A; 2ARV A; 1HRP A; 5JZ7 A; 4EDX V; 4LXS J; 5BQB A; 1HD4 A; 4HSA A; 5FV2 V; 2QR0 C; 1LX5 A; 1DZ7 A; 1WQ9 B; 1WWW V; 4UI1 A; 5HK5 E; 3MJK A; 4EC7 A; 1FL7 A; 5HHX A; 1MJV A; 4ZFF C; 5HHV A; 3EO1 C; 4HQX A; 2VPF A; 1KLC A; 5BQ8 A; 1BND A; 3S1B V; 2R52 A; 2V5E B; 3S1K V; 5AEJ A; 5BQC A; 4MID A; 2R53 A; 1HRP B; 4UHY A; 1B8K A; 3E07 A; 2ASK A; 2B0U A; 1S4Y B; 2XAC A; 1QTY R; 1QFW A; 3RJR A; 2VXS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
