3SIJA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase e115a mutant from thermomonospora curvata
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
274
structure length
265
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEAGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords poly(ADP-ribose) glycohydrolase
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase
total genus 89
structure length 265
sequence length 274
other databases KnotProt 2.0: K +31
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sijA00
1TY8A 2J9AA 4K0CA 5CB5A 3V45A 4X2TA 1LAPA 4J5RA 3EW5A 1LANA 4J5QA 3KQZA 2LGRA 5HOLA 4KSIA 4JLLA 4ETJA 4ABKA 2FG1A 4R7MA 3SIHA 1YD9A 5D8NA 5FSVA 1ZR5A 4ZY1A 5FSXA 4JCAA 4K3NA 4ZYQA 4GVVA 1GYTA 2EEEA 1BPMA 1TXZA 3H8GA 3KQXA 2X47A 4JGKA 3ETIA 5AILA 1BLLE 4ZI6A 2VRIA 1NJRA 3EJGA 4ESSA 2EWBA 3EWQA 4D86A 4ZX8A 4ZY2A 4TU0A 2ACFA 5DUSA 3KR5A 1BPNA 4J5SA 3VFQA 5CBMA 3GPOA 1LCPA 3GPQA 3H8FA 3EWRA 3GQEA 2DX6A 3IIDA 2AFCA 4J4ZA 5FSZA 2FAVA 5CB3A 3JRUA 4ABLA 3V2BA 3SIGA 2L8RA 3KR4A 3SIJA 3EWPA 4KYBA 3EKEA 2FXKA 4ZX9A 5FSUA 1SPVA 3SIIA 3KZWA 4IQYA 2XD7A 3T8WA 3Q6ZA 1VHUA 5HIHA 5E3BA 3H8EA 1ZR3A 2BFQA 4GVWA 3PEIA 3GPGA 1LAMA 3JZTA 4R6TA 3EJFA 1HJZA 4GUAA 3EWOA 4ZY0A 3Q71A 3IJ3A 4JVVA 2BFRA 3GQOA 4R76A 4UMLA 4ETKA 3IIFA 5FSYA 5CMSA
chains in the Genus database with same CATH superfamily
1TY8A 2J9AA 4K0CA 5CB5A 2W2GA 3V45A 4X2TA 1LAPA 4J5RA 3EW5A 1LANA 4J5QA 3KQZA 2LGRA 5HOLA 4KSIA 4JLLA 4ETJA 4ABKA 2FG1A 4R7MA 3SIHA 1YD9A 5D8NA 5FSVA 1ZR5A 4ZY1A 5FSXA 4JCAA 4K3NA 4ZYQA 2JZFA 4GVVA 1GYTA 2EEEA 1BPMA 1TXZA 2KQVA 3H8GA 3KQXA 2X47A 4JGKA 3ETIA 5AILA 1BLLE 4ZI6A 2VRIA 1NJRA 3EJGA 4ESSA 2EWBA 3EWQA 4D86A 4ZX8A 4ZY2A 4TU0A 2ACFA 5DUSA 3KR5A 1BPNA 4J5SA 3VFQA 5CBMA 3GPOA 1LCPA 3GPQA 3H8FA 3EWRA 2WCTA 3GQEA 2JZEA 2DX6A 3IIDA 2AFCA 4J4ZA 5FSZA 2FAVA 5CB3A 3JRUA 4ABLA 3V2BA 3SIGA 2L8RA 3KR4A 3SIJA 3EWPA 4KYBA 3EKEA 2FXKA 4ZX9A 5FSUA 2JZDA 1SPVA 3SIIA 3KZWA 4IQYA 2XD7A 3T8WA 3Q6ZA 1VHUA 5HIHA 5E3BA 3H8EA 1ZR3A 2BFQA 4GVWA 3PEIA 3GPGA 1LAMA 3JZTA 4R6TA 2RNKA 3EJFA 1HJZA 4GUAA 3EWOA 4ZY0A 3Q71A 3IJ3A 4JVVA 2BFRA 3GQOA 4R76A 4UMLA 4ETKA 3IIFA 5FSYA 5CMSA
chains in the Genus database with same CATH topology
1TY8A 2J9AA 4K0CA 5CB5A 3V45A 4X2TA 1LAPA 4J5RA 3EW5A 1LANA 4J5QA 3KQZA 2LGRA 5HOLA 4KSIA 4JLLA 4ETJA 4ABKA 2FG1A 4R7MA 3SIHA 1YD9A 5D8NA 5FSVA 1ZR5A 4ZY1A 5FSXA 4JCAA 4K3NA 4ZYQA 4GVVA 1GYTA 2EEEA 1BPMA 1TXZA 3H8GA 3KQXA 2X47A 4JGKA 3ETIA 5AILA 1BLLE 4ZI6A 2VRIA 1NJRA 3EJGA 4ESSA 2EWBA 3EWQA 4D86A 4ZX8A 4ZY2A 4TU0A 2ACFA 5DUSA 3KR5A 1BPNA 4J5SA 3VFQA 5CBMA 3GPOA 1LCPA 3GPQA 3H8FA 3EWRA 3GQEA 2DX6A 3IIDA 2AFCA 4J4ZA 5FSZA 2FAVA 5CB3A 3JRUA 4ABLA 3V2BA 3SIGA 2L8RA 3KR4A 3SIJA 3EWPA 4KYBA 3EKEA 2FXKA 4ZX9A 5FSUA 1SPVA 3SIIA 3KZWA 4IQYA 2XD7A 3T8WA 3Q6ZA 1VHUA 5HIHA 5E3BA 3H8EA 1ZR3A 2BFQA 4GVWA 3PEIA 3GPGA 1LAMA 3JZTA 4R6TA 3EJFA 1HJZA 4GUAA 3EWOA 4ZY0A 3Q71A 3IJ3A 4JVVA 2BFRA 3GQOA 4R76A 4UMLA 4ETKA 3IIFA 5FSYA 5CMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TY8 A;  2J9A A;  4K0C A;  5CB5 A;  3V45 A;  4X2T A;  1LAP A;  4J5R A;  3EW5 A;  1LAN A;  4J5Q A;  3KQZ A;  2LGR A;  5HOL A;  4KSI A;  4JLL A;  4ETJ A;  4ABK A;  2FG1 A;  4R7M A;  3SIH A;  1YD9 A;  5D8N A;  5FSV A;  1ZR5 A;  4ZY1 A;  5FSX A;  4JCA A;  4K3N A;  4ZYQ A;  4GVV A;  1GYT A;  2EEE A;  1BPM A;  1TXZ A;  3H8G A;  3KQX A;  2X47 A;  4JGK A;  3ETI A;  5AIL A;  1BLL E;  4ZI6 A;  2VRI A;  1NJR A;  3EJG A;  4ESS A;  2EWB A;  3EWQ A;  4D86 A;  4ZX8 A;  4ZY2 A;  4TU0 A;  2ACF A;  5DUS A;  3KR5 A;  1BPN A;  4J5S A;  3VFQ A;  5CBM A;  3GPO A;  1LCP A;  3GPQ A;  3H8F A;  3EWR A;  3GQE A;  2DX6 A;  3IID A;  2AFC A;  4J4Z A;  5FSZ A;  2FAV A;  5CB3 A;  3JRU A;  4ABL A;  3V2B A;  3SIG A;  2L8R A;  3KR4 A;  3SIJ A;  3EWP A;  4KYB A;  3EKE A;  2FXK A;  4ZX9 A;  5FSU A;  1SPV A;  3SII A;  3KZW A;  4IQY A;  2XD7 A;  3T8W A;  3Q6Z A;  1VHU A;  5HIH A;  5E3B A;  3H8E A;  1ZR3 A;  2BFQ A;  4GVW A;  3PEI A;  3GPG A;  1LAM A;  3JZT A;  4R6T A;  3EJF A;  1HJZ A;  4GUA A;  3EWO A;  4ZY0 A;  3Q71 A;  3IJ3 A;  4JVV A;  2BFR A;  3GQO A;  4R76 A;  4UML A;  4ETK A;  3IIF A;  5FSY A;  5CMS A; 
#chains in the Genus database with same CATH topology
 1TY8 A;  2J9A A;  4K0C A;  5CB5 A;  2W2G A;  3V45 A;  4X2T A;  1LAP A;  4J5R A;  3EW5 A;  1LAN A;  4J5Q A;  3KQZ A;  2LGR A;  5HOL A;  4KSI A;  4JLL A;  4ETJ A;  4ABK A;  2FG1 A;  4R7M A;  3SIH A;  1YD9 A;  5D8N A;  5FSV A;  1ZR5 A;  4ZY1 A;  5FSX A;  4JCA A;  4K3N A;  4ZYQ A;  2JZF A;  4GVV A;  1GYT A;  2EEE A;  1BPM A;  1TXZ A;  2KQV A;  3H8G A;  3KQX A;  2X47 A;  4JGK A;  3ETI A;  5AIL A;  1BLL E;  4ZI6 A;  2VRI A;  1NJR A;  3EJG A;  4ESS A;  2EWB A;  3EWQ A;  4D86 A;  4ZX8 A;  4ZY2 A;  4TU0 A;  2ACF A;  5DUS A;  3KR5 A;  1BPN A;  4J5S A;  3VFQ A;  5CBM A;  3GPO A;  1LCP A;  3GPQ A;  3H8F A;  3EWR A;  2WCT A;  3GQE A;  2JZE A;  2DX6 A;  3IID A;  2AFC A;  4J4Z A;  5FSZ A;  2FAV A;  5CB3 A;  3JRU A;  4ABL A;  3V2B A;  3SIG A;  2L8R A;  3KR4 A;  3SIJ A;  3EWP A;  4KYB A;  3EKE A;  2FXK A;  4ZX9 A;  5FSU A;  2JZD A;  1SPV A;  3SII A;  3KZW A;  4IQY A;  2XD7 A;  3T8W A;  3Q6Z A;  1VHU A;  5HIH A;  5E3B A;  3H8E A;  1ZR3 A;  2BFQ A;  4GVW A;  3PEI A;  3GPG A;  1LAM A;  3JZT A;  4R6T A;  2RNK A;  3EJF A;  1HJZ A;  4GUA A;  3EWO A;  4ZY0 A;  3Q71 A;  3IJ3 A;  4JVV A;  2BFR A;  3GQO A;  4R76 A;  4UML A;  4ETK A;  3IIF A;  5FSY A;  5CMS A; 
#chains in the Genus database with same CATH homology
 1TY8 A;  2J9A A;  4K0C A;  5CB5 A;  3V45 A;  4X2T A;  1LAP A;  4J5R A;  3EW5 A;  1LAN A;  4J5Q A;  3KQZ A;  2LGR A;  5HOL A;  4KSI A;  4JLL A;  4ETJ A;  4ABK A;  2FG1 A;  4R7M A;  3SIH A;  1YD9 A;  5D8N A;  5FSV A;  1ZR5 A;  4ZY1 A;  5FSX A;  4JCA A;  4K3N A;  4ZYQ A;  4GVV A;  1GYT A;  2EEE A;  1BPM A;  1TXZ A;  3H8G A;  3KQX A;  2X47 A;  4JGK A;  3ETI A;  5AIL A;  1BLL E;  4ZI6 A;  2VRI A;  1NJR A;  3EJG A;  4ESS A;  2EWB A;  3EWQ A;  4D86 A;  4ZX8 A;  4ZY2 A;  4TU0 A;  2ACF A;  5DUS A;  3KR5 A;  1BPN A;  4J5S A;  3VFQ A;  5CBM A;  3GPO A;  1LCP A;  3GPQ A;  3H8F A;  3EWR A;  3GQE A;  2DX6 A;  3IID A;  2AFC A;  4J4Z A;  5FSZ A;  2FAV A;  5CB3 A;  3JRU A;  4ABL A;  3V2B A;  3SIG A;  2L8R A;  3KR4 A;  3SIJ A;  3EWP A;  4KYB A;  3EKE A;  2FXK A;  4ZX9 A;  5FSU A;  1SPV A;  3SII A;  3KZW A;  4IQY A;  2XD7 A;  3T8W A;  3Q6Z A;  1VHU A;  5HIH A;  5E3B A;  3H8E A;  1ZR3 A;  2BFQ A;  4GVW A;  3PEI A;  3GPG A;  1LAM A;  3JZT A;  4R6T A;  3EJF A;  1HJZ A;  4GUA A;  3EWO A;  4ZY0 A;  3Q71 A;  3IJ3 A;  4JVV A;  2BFR A;  3GQO A;  4R76 A;  4UML A;  4ETK A;  3IIF A;  5FSY A;  5CMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...