3SZYA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szyA01
2GA3A 4UOOA 5LIAA 5IJQA 3NKRA 1Y7AA 1KH4A 3M8WA 5DLTA 4CXSA 4LRAA 3TWZA 3NKPA 1AJDA 5GRRA 1ZEDA 4LR9A 5K4PA 3M8ZA 3WAVA 4ZG9A 1SHNA 3WBHA 3NKMA 1EI6A 2X98A 3IGYB 4CXUA 4YR1A 4UOPA 4GTZA 2W5XA 5AJ9A 1KH7A 2VQRA 5LRNA 2W5VA 1URBA 2W8DA 4UPHA 1ANJA 4NWXA 1HQAA 1E33P 5LRMA 1KHKA 1K7HA 1SHQA 2D1GA 3B5QA 4GTYA 4LRFA 3SZYA 5DLWA 3WAWA 1KH5A 3WAXA 2G9YA 3BDFA 2IUCB 5L0BA 1B8JA 5TJ3A 3UN2A 5EGHA 3IGZB 3UNYA 1KHJA 3SZZA 3A52A 2ANHA 1URAA 2W8SA 2W5QA 1O98A 3NVLA 5LQQA 1ALKA 3KD8A 1HJKA 2W5WA 4QAXA 4ZG6A 5C66A 4NWJA 3OT9A 2W5SA 1ELZA 3UO0A 2IFYA 1E1ZP 4LRDA 1ANIA 3TX0A 2IUCA 3BDGB 1ED9A 1AJAA 4UPIA 5HRTA 1AUKA 4KM4A 4LRBA 4LREA 2GSOA 4N7TA 4MY4A 3IDDA 1KHLA 2RH6A 2GSNA 4LQYA 5IJSA 4CYRA 3NKQA 1EW2A 2GSUA 1ALIA 1ZEFA 3Q3QA 3ED4A 4KJGA 3TG0A 1ELYA 1ED8A 3WAYA 3MK0A 1N2KA 1EQJA 4LR8A 2W5RA 1EJJA 4GTWA 1P49A 2ZKTA 3MK2A 4LR7A 4FDJA 3UN3A 3T00A 3DPCA 5L0EA 3T02A 1FSUA 4LR2A 5L0KA 5DLVA 1ELXA 4UORA 4UPKA 3NKOA 3T01A 1ALHA 5GOVA 1E2SP 4ZGAA 4KAVA 2W5TA 4MIVA 4MHXA 3NKNA 3BDHA 4FDIA 1Y6VA 5KXAA 5EGEA 4UPLA 2QZUA 4LRCA 1ALJA 4KAYA 1EW9A 3M7VA 3M8YA 1HDHA 4KJDA 4CYSA 4B56A 5INHA 1KHNA 1O99A 1ZEBA 2GLQA 3DYCA 2XRGA 4TN0A 4CXKA 3E2DA 1E3CP 1EW8A 4GTXA 1N2LA 2XR9A 3LXQA 1AJBA 3MK1A 3UN5A 3BDGA 1KH9A 1AJCA 4ZG7A 3CMRA
chains in the Genus database with same CATH superfamily
2CFAB 2GA3A 1IL2A 5IYCC 3NKRA 3ADAC 3M8WA 1IW7A 1G51A 4YFNA 3GTQC 2R92A 4BY1K 4CXSA 3AD9C 3S1MK 1TWGK 5FLMC 4KM8A 1AJDA 3IPJA 1Y1VC 5D4DA 5IYDC 3M8ZA 4BY7K 1SHNA 3WBHA 3LAJA 1WCMA 4CXUA 4YR1A 4UOPA 1WCMK 3S2HK 1WOSA 3GTGA 5IP9K 3S17K 1F7VA 3GTLC 2P5MA 4OIOA 5IORA 2GAHC 2B63A 1WSRA 4LJZA 4BBSC 4GTCA 5LRMA 1Y1VK 2EBBA 2ZUEA 1I50K 1SHQA 4G0WA 4BY7C 1RU0A 3S0XA 1ZQ1C 3A8KA 2R92C 3M3YC 4A3EC 3GTPC 3S2HC 1SFOA 4GTLA 3S1NK 3BDFA 4C3IC 5IP9C 3FOEA 3S17C 1B8JA 1ZXOA 1PJ7A 2A69A 2JA8C 3UN2A 3FHZA 3RZDC 1IS1A 3SZZA 3GTOK 1I50C 3GTQA 1URAA 2JA7A 3GTOA 1O98A 5LQQA 4KMUA 1ALKA 2R92K 3M3YK 3GTPK 4NWJA 5C66A 4G0VA 1WOPA 5IYBC 4MEXA 2IFYA 1ANIA 2E2HC 4KN4A 3RZDK 1DCOA 3GTOC 4C45A 2VUMK 3M4OC 4KM4A 4BXXK 2GSNA 1TWAA 3G4AA 4KATA 2NVYK 5IJSA 4KMHA 1IE0A 3HKZD 2GSUA 1ZEFA 1F93A 3ED4A 2V6UA 3WAYA 4GTWA 5C4XK 3PO2C 3UN3A 3GTGC 2FQTA 2PHCB 3M4OK 4A3FC 4LR2A 4XSZA 2YU9A 4JK1A 4AYBD 4UPKA 4QIWL 5M5XK 2JA6C 5E68A 5IYCK 1I3QA 4KAVA 4MHXA 4FDIA 5C4XC 4LRCA 1ALJA 3OREA 5CJ9A 1TWGC 4A3LK 5FLMK 4BBRC 3NUHA 4KJDA 4WILA 1TWFA 1AB4A 1DCHA 2JA6K 3DYCA 4TN0A 2A6HA 3AQPA 1E3CP 1EW8A 3TFIA 1UV7A 4KN7A 4KAWX 2XR9A 1O25A 3LXQA 3UN5A 4Q5SA 5C44K 4KM9A 3PO3K 1V5VA 4A3LC 5C3EK 4BBRK 3GTMA 5DLTA 4GTFA 2R93A 1EFWA 1O28A 1XZPB 1XPPA 5IP7K 4A3DK 3NKPA 3TWZA 1ZEDA 5K4PA 2NVYA 4KC6A 5C44C 3N0BA 1K83K 3PO3C 3NKMA 1WOOA 5C3EC 2X98A 1B4BA 2FQOA 2ZFZA 2D6FC 4GTZA 5AJ9A 3AQOA 3JSTA 1URBA 4LLGA 5M3MK 3S14K 4UPHA 4NWXA 1HQAA 3L4JA 1XXCA 4OIPA 1K7HA 4A3KK 3HOUC 2VUMA 4X6AC 2E2HK 3B5QA 3GTKA 4GTAA 2R93C 1KH5A 2WB1L 4BXXC 2NVYC 1O24A 3UNYA 4RMFA 3HOUK 3PO2K 3GTGK 3S16K 1HJKA 2W5WA 4A3MC 1Y1VA 2R93K 1IBAA 3OT9A 1ELZA 4YG2A 1E1ZP 4LRDA 1ZYRA 3EQLA 2E2IA 2IUCA 3BDGB 1J6WA 4J3NA 1HI9A 4UPIA 4FZBA 5HRTA 4KMAA 4A3JK 1F7UA 4KB4A 1J98A 2XCRB 1Y1WC 2CW0A 3A8JA 3IDDA 4G7OA 4MEYA 1XXBA 4A3MK 4LQYA 4LK0A 3NKQA 4KJGA 3FKIA 4YFKA 3TG0A 1ED8A 4KARA 1EJJA 4QIWD 4Y7NC 3S15C 3S1QK 4C3JK 1P49A 2ZKTA 3MK2A 4LR7A 4AH6A 3T00A 1DD5A 1BS2A 4Y52C 4QJVB 5L0KA 1WQHA 3T01A 1ALHA 1O26A 2XCQA 4MIVA 3G4CA 3NKNA 5EGEA 3GEIA 4Y7NK 3S1QC 4UPLA 2QZUA 1BGWA 5JVOA 5FJ8K 1R9TA 3QX3A 5IP7C 4A3DC 4Y52K 2XCOA 2E2IC 4GTDA 1K83C 4FM9A 4B56A 2Y0SL 5INHA 1O99A 1ZEBA 2GLQA 3E2DA 4GTXA 1N2LA 4GFQA 3MK1A 3S14C 3WODA 2WAQD 4ZH4A 2NVXC 4UOOA 5LIAA 1VJEA 3GDZA 2E2IK 4KDDA 3GSIA 2Y0SD 4A3KC 4X6AK 1KH4A 1SFOC 1EK8A 3DXJA 1WSVA 3TFJA 4LR9A 3LAPA 4GT9A 3WAVA 1TWAK 1F9NA 1EI6A 2PA8L 2NVXK 3GTJA 3IGYB 1I6VA 4P9SA 5IOTA 1TWHK 2W5XA 2R7ZC 1KH7A 3S16C 2W8DA 5M3FK 1HQMA 4Q4ZA 3BP8C 2W7VA 1ANJA 3GTLA 1GE9A 1C0AA 1JVIA 2D1GA 1X31C 4ILDA 3HKZL 1Y1WA 3WAWA 4A3JC 3OPFA 3WAXA 1Y1WK 3HOXC 4A3BC 1TWHC 5IOQA 2IUCB 3BUEA 2R7ZK 5L0BA 5TJ3A 3AD8C 1I50A 5EGHA 2P8TA 1KHJA 1I6HC 1O29A 1B4AA 3GIRA 3S15K 2W5QA 3NVLA 4C3JC 2A68A 2JA7C 4A3GC 4ZG6A 3OEPA 3AD7C 4A3BK 2O5IA 1J6VA 3V4GA 3VA7A 1ED9A 5JFEA 3A8IA 4G7ZA 4LRBA 3K7AC 4N7TA 2V6SA 2WB1D 2Y3PA 4MY4A 1KHLA 4LOWA 1L0WA 1EQRA 4A3GK 3N3YA 4CYRA 1PJ6A 1KQ4A 3MMLB 3Q3QA 3HOWC 1ELYA 2B63C 3MK0A 3RZOC 3CQZA 4LR8A 2W5RA 5IOSA 1WORA 3I4MK 3H0GK 3K7AK 5M5WK 3T02A 1FSUA 5CHPA 3GTPA 3FKIC 3N0CA 5DLVA 1ELXA 1INNA 3HXAA 3NKOA 3S1RC 1VLOA 5GOVA 1E2SP 2W5TA 3HOWK 4LK1A 3BDHA 2JA6A 1Y6VA 4P5AA 1SFOK 2NVQK 4GTBA 1PJ5A 3M7VA 2E2HA 3H0GC 3L4KA 2NVXA 1TWAC 1VGXA 5C4JK 3FKIK 4CYSA 4A3CC 1TWCA 3S1RK 2XRGA 1JOEA 4DDQA 1TWGA 4A3IK 2V6TA 5TMCA 2E2JC 1YNNA 4MQ9A 3BDGA 4G0UA 1KH9A 1AJCA 4ZG7A 2NVTC 5IJQA 3LPXA 1DCPA 2O5JA 1Y7AA 1I3QK 2PMZD 4BKWA 3HOYK 4WJ3M 1YCLA 1WQFA 2JA5C 3ERED 3S2DC 3H3VL 4LRAA 4A3IC 3HOXK 2PPBA 2YU9K 5GRRA 2E2JK 3H0GA 1BJTA 4OINA 4ZG9A 1XZPA 2ZUFA 1O2FB 3HOVK 5L46A 4QJVA 1I6HK 1TWFC 4AYBL 5M5YK 1O2AA 1I3QC 2VQRA 3HOYC 5LRNA 4M1XA 1ISEA 2W5VA 2JA7K 2YU9C 1E33P 3HOZK 1KHKA 2GAGC 3TTGA 3GTKC 2PA8D 1WIHA 5HL8A 4C2MC 4LRFA 4GTYA 4XCHA 3HOVC 1VRQC 3SZYA 1YX2A 1TWFK 5DLWA 3S1MC 2G9YA 3I4NK 4OIRA 3H3VD 4PABA 5IYDK 4C3HK 2PMZL 3IGZB 1SMYA 4KASA 1XZQA 3GEEA 3A52A 3HOZC 2ANHA 2B63K 3GTKK 4GZYA 3RZOK 1WCMC 2W8SA 4C2MK 1BDFA 1JQWA 2WAQL 4XLPA 4XSXA 1TWHA 1XZQB 3KD8A 4QAXA 3GTLK 3I4MC 4PAAA 3BP3A 4BBSK 1XXAA 3CQZK 1J6XA 4XLNA 3I4NC 2W5SA 3UO0A 4YFXA 4GTEA 4C3HC 3TX0A 2KWAA 3AH5A 4A93C 1AJAA 1ZBSA 4BLBA 1ZVUA 4A3EK 1AUKA 1O2BA 4LREA 2GSOA 3S1NC 1IQ0A 2NVQC 2RH6A 4C3IK 1K83A 4NOIA 2A6EA 4KMDA 2JA8K 3CQZC 1EW2A 4OIQA 1ALIA 4O2DA 5C4JC 1N2KA 3FOFA 1EQJA 1YNJA 4A3CK 5TMFA 3GTJK 4FDJA 4A93K 3TFHA 3DPCA 3GEHA 5L0EA 5IYBK 1TWCK 2RGRA 1R9TC 3CAGA 1WQGA 4UORA 1EH1A 4BLAA 2NVTK 4ZGAA 1USOA 3GTMK 2VUMC 1USMA 4P5BA 5KXAA 2JA5A 3GTJC 2BE5A 2JA5K 3S2DK 4KAYA 1EW9A 2R7ZA 4G7HA 3M8YA 1TWCC 1HDHA 1R9TK 1O27A 1VH2A 1KHNA 3GTQK 4CXKA 4BY1C 3GTMC 2CFAA 4KB2A 1AJBA 4A3FK 2JH3A 4WJ4A 3CMRA
chains in the Genus database with same CATH topology
2GA3A 4UOOA 5LIAA 5IJQA 3NKRA 1Y7AA 1KH4A 3M8WA 5DLTA 4CXSA 4LRAA 3TWZA 3NKPA 1AJDA 5GRRA 1ZEDA 4LR9A 5K4PA 3M8ZA 3WAVA 4ZG9A 1SHNA 3WBHA 3NKMA 1EI6A 2X98A 3IGYB 4CXUA 4YR1A 4UOPA 4GTZA 2W5XA 5AJ9A 1KH7A 2VQRA 5LRNA 2W5VA 1URBA 2W8DA 4UPHA 1ANJA 4NWXA 1HQAA 1E33P 5LRMA 1KHKA 1K7HA 1SHQA 2D1GA 3B5QA 4GTYA 4LRFA 3SZYA 5DLWA 3WAWA 1KH5A 3WAXA 2G9YA 3BDFA 2IUCB 5L0BA 1B8JA 5TJ3A 3UN2A 5EGHA 3IGZB 3UNYA 1KHJA 3SZZA 3A52A 2ANHA 1URAA 2W8SA 2W5QA 1O98A 3NVLA 5LQQA 1ALKA 3KD8A 1HJKA 2W5WA 4QAXA 4ZG6A 5C66A 4NWJA 3OT9A 2W5SA 1ELZA 3UO0A 2IFYA 1E1ZP 4LRDA 1ANIA 3TX0A 2IUCA 3BDGB 1ED9A 1AJAA 4UPIA 5HRTA 1AUKA 4KM4A 4LRBA 4LREA 2GSOA 4N7TA 4MY4A 3IDDA 1KHLA 2RH6A 2GSNA 4LQYA 5IJSA 4CYRA 3NKQA 1EW2A 2GSUA 1ALIA 1ZEFA 3Q3QA 3ED4A 4KJGA 3TG0A 1ELYA 1ED8A 3WAYA 3MK0A 1N2KA 1EQJA 4LR8A 2W5RA 1EJJA 4GTWA 1P49A 2ZKTA 3MK2A 4LR7A 4FDJA 3UN3A 3T00A 3DPCA 5L0EA 3T02A 1FSUA 4LR2A 5L0KA 5DLVA 1ELXA 4UORA 4UPKA 3NKOA 3T01A 1ALHA 5GOVA 1E2SP 4ZGAA 4KAVA 2W5TA 4MIVA 4MHXA 3NKNA 3BDHA 4FDIA 1Y6VA 5KXAA 5EGEA 4UPLA 2QZUA 4LRCA 1ALJA 4KAYA 1EW9A 3M7VA 3M8YA 1HDHA 4KJDA 4CYSA 4B56A 5INHA 1KHNA 1O99A 1ZEBA 2GLQA 3DYCA 2XRGA 4TN0A 4CXKA 3E2DA 1E3CP 1EW8A 4GTXA 1N2LA 2XR9A 3LXQA 1AJBA 3MK1A 3UN5A 3BDGA 1KH9A 1AJCA 4ZG7A 3CMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA3 A;  4UOO A;  5LIA A;  5IJQ A;  3NKR A;  1Y7A A;  1KH4 A;  3M8W A;  5DLT A;  4CXS A;  4LRA A;  3TWZ A;  3NKP A;  1AJD A;  5GRR A;  1ZED A;  4LR9 A;  5K4P A;  3M8Z A;  3WAV A;  4ZG9 A;  1SHN A;  3WBH A;  3NKM A;  1EI6 A;  2X98 A;  3IGY B;  4CXU A;  4YR1 A;  4UOP A;  4GTZ A;  2W5X A;  5AJ9 A;  1KH7 A;  2VQR A;  5LRN A;  2W5V A;  1URB A;  2W8D A;  4UPH A;  1ANJ A;  4NWX A;  1HQA A;  1E33 P;  5LRM A;  1KHK A;  1K7H A;  1SHQ A;  2D1G A;  3B5Q A;  4GTY A;  4LRF A;  3SZY A;  5DLW A;  3WAW A;  1KH5 A;  3WAX A;  2G9Y A;  3BDF A;  2IUC B;  5L0B A;  1B8J A;  5TJ3 A;  3UN2 A;  5EGH A;  3IGZ B;  3UNY A;  1KHJ A;  3SZZ A;  3A52 A;  2ANH A;  1URA A;  2W8S A;  2W5Q A;  1O98 A;  3NVL A;  5LQQ A;  1ALK A;  3KD8 A;  1HJK A;  2W5W A;  4QAX A;  4ZG6 A;  5C66 A;  4NWJ A;  3OT9 A;  2W5S A;  1ELZ A;  3UO0 A;  2IFY A;  1E1Z P;  4LRD A;  1ANI A;  3TX0 A;  2IUC A;  3BDG B;  1ED9 A;  1AJA A;  4UPI A;  5HRT A;  1AUK A;  4KM4 A;  4LRB A;  4LRE A;  2GSO A;  4N7T A;  4MY4 A;  3IDD A;  1KHL A;  2RH6 A;  2GSN A;  4LQY A;  5IJS A;  4CYR A;  3NKQ A;  1EW2 A;  2GSU A;  1ALI A;  1ZEF A;  3Q3Q A;  3ED4 A;  4KJG A;  3TG0 A;  1ELY A;  1ED8 A;  3WAY A;  3MK0 A;  1N2K A;  1EQJ A;  4LR8 A;  2W5R A;  1EJJ A;  4GTW A;  1P49 A;  2ZKT A;  3MK2 A;  4LR7 A;  4FDJ A;  3UN3 A;  3T00 A;  3DPC A;  5L0E A;  3T02 A;  1FSU A;  4LR2 A;  5L0K A;  5DLV A;  1ELX A;  4UOR A;  4UPK A;  3NKO A;  3T01 A;  1ALH A;  5GOV A;  1E2S P;  4ZGA A;  4KAV A;  2W5T A;  4MIV A;  4MHX A;  3NKN A;  3BDH A;  4FDI A;  1Y6V A;  5KXA A;  5EGE A;  4UPL A;  2QZU A;  4LRC A;  1ALJ A;  4KAY A;  1EW9 A;  3M7V A;  3M8Y A;  1HDH A;  4KJD A;  4CYS A;  4B56 A;  5INH A;  1KHN A;  1O99 A;  1ZEB A;  2GLQ A;  3DYC A;  2XRG A;  4TN0 A;  4CXK A;  3E2D A;  1E3C P;  1EW8 A;  4GTX A;  1N2L A;  2XR9 A;  3LXQ A;  1AJB A;  3MK1 A;  3UN5 A;  3BDG A;  1KH9 A;  1AJC A;  4ZG7 A;  3CMR A; 
#chains in the Genus database with same CATH topology
 2CFA B;  2GA3 A;  1IL2 A;  5IYC C;  3NKR A;  3ADA C;  3M8W A;  1IW7 A;  1G51 A;  4YFN A;  3GTQ C;  2R92 A;  4BY1 K;  4CXS A;  3AD9 C;  3S1M K;  1TWG K;  5FLM C;  4KM8 A;  1AJD A;  3IPJ A;  1Y1V C;  5D4D A;  5IYD C;  3M8Z A;  4BY7 K;  1SHN A;  3WBH A;  3LAJ A;  1WCM A;  4CXU A;  4YR1 A;  4UOP A;  1WCM K;  3S2H K;  1WOS A;  3GTG A;  5IP9 K;  3S17 K;  1F7V A;  3GTL C;  2P5M A;  4OIO A;  5IOR A;  2GAH C;  2B63 A;  1WSR A;  4LJZ A;  4BBS C;  4GTC A;  5LRM A;  1Y1V K;  2EBB A;  2ZUE A;  1I50 K;  1SHQ A;  4G0W A;  4BY7 C;  1RU0 A;  3S0X A;  1ZQ1 C;  3A8K A;  2R92 C;  3M3Y C;  4A3E C;  3GTP C;  3S2H C;  1SFO A;  4GTL A;  3S1N K;  3BDF A;  4C3I C;  5IP9 C;  3FOE A;  3S17 C;  1B8J A;  1ZXO A;  1PJ7 A;  2A69 A;  2JA8 C;  3UN2 A;  3FHZ A;  3RZD C;  1IS1 A;  3SZZ A;  3GTO K;  1I50 C;  3GTQ A;  1URA A;  2JA7 A;  3GTO A;  1O98 A;  5LQQ A;  4KMU A;  1ALK A;  2R92 K;  3M3Y K;  3GTP K;  4NWJ A;  5C66 A;  4G0V A;  1WOP A;  5IYB C;  4MEX A;  2IFY A;  1ANI A;  2E2H C;  4KN4 A;  3RZD K;  1DCO A;  3GTO C;  4C45 A;  2VUM K;  3M4O C;  4KM4 A;  4BXX K;  2GSN A;  1TWA A;  3G4A A;  4KAT A;  2NVY K;  5IJS A;  4KMH A;  1IE0 A;  3HKZ D;  2GSU A;  1ZEF A;  1F93 A;  3ED4 A;  2V6U A;  3WAY A;  4GTW A;  5C4X K;  3PO2 C;  3UN3 A;  3GTG C;  2FQT A;  2PHC B;  3M4O K;  4A3F C;  4LR2 A;  4XSZ A;  2YU9 A;  4JK1 A;  4AYB D;  4UPK A;  4QIW L;  5M5X K;  2JA6 C;  5E68 A;  5IYC K;  1I3Q A;  4KAV A;  4MHX A;  4FDI A;  5C4X C;  4LRC A;  1ALJ A;  3ORE A;  5CJ9 A;  1TWG C;  4A3L K;  5FLM K;  4BBR C;  3NUH A;  4KJD A;  4WIL A;  1TWF A;  1AB4 A;  1DCH A;  2JA6 K;  3DYC A;  4TN0 A;  2A6H A;  3AQP A;  1E3C P;  1EW8 A;  3TFI A;  1UV7 A;  4KN7 A;  4KAW X;  2XR9 A;  1O25 A;  3LXQ A;  3UN5 A;  4Q5S A;  5C44 K;  4KM9 A;  3PO3 K;  1V5V A;  4A3L C;  5C3E K;  4BBR K;  3GTM A;  5DLT A;  4GTF A;  2R93 A;  1EFW A;  1O28 A;  1XZP B;  1XPP A;  5IP7 K;  4A3D K;  3NKP A;  3TWZ A;  1ZED A;  5K4P A;  2NVY A;  4KC6 A;  5C44 C;  3N0B A;  1K83 K;  3PO3 C;  3NKM A;  1WOO A;  5C3E C;  2X98 A;  1B4B A;  2FQO A;  2ZFZ A;  2D6F C;  4GTZ A;  5AJ9 A;  3AQO A;  3JST A;  1URB A;  4LLG A;  5M3M K;  3S14 K;  4UPH A;  4NWX A;  1HQA A;  3L4J A;  1XXC A;  4OIP A;  1K7H A;  4A3K K;  3HOU C;  2VUM A;  4X6A C;  2E2H K;  3B5Q A;  3GTK A;  4GTA A;  2R93 C;  1KH5 A;  2WB1 L;  4BXX C;  2NVY C;  1O24 A;  3UNY A;  4RMF A;  3HOU K;  3PO2 K;  3GTG K;  3S16 K;  1HJK A;  2W5W A;  4A3M C;  1Y1V A;  2R93 K;  1IBA A;  3OT9 A;  1ELZ A;  4YG2 A;  1E1Z P;  4LRD A;  1ZYR A;  3EQL A;  2E2I A;  2IUC A;  3BDG B;  1J6W A;  4J3N A;  1HI9 A;  4UPI A;  4FZB A;  5HRT A;  4KMA A;  4A3J K;  1F7U A;  4KB4 A;  1J98 A;  2XCR B;  1Y1W C;  2CW0 A;  3A8J A;  3IDD A;  4G7O A;  4MEY A;  1XXB A;  4A3M K;  4LQY A;  4LK0 A;  3NKQ A;  4KJG A;  3FKI A;  4YFK A;  3TG0 A;  1ED8 A;  4KAR A;  1EJJ A;  4QIW D;  4Y7N C;  3S15 C;  3S1Q K;  4C3J K;  1P49 A;  2ZKT A;  3MK2 A;  4LR7 A;  4AH6 A;  3T00 A;  1DD5 A;  1BS2 A;  4Y52 C;  4QJV B;  5L0K A;  1WQH A;  3T01 A;  1ALH A;  1O26 A;  2XCQ A;  4MIV A;  3G4C A;  3NKN A;  5EGE A;  3GEI A;  4Y7N K;  3S1Q C;  4UPL A;  2QZU A;  1BGW A;  5JVO A;  5FJ8 K;  1R9T A;  3QX3 A;  5IP7 C;  4A3D C;  4Y52 K;  2XCO A;  2E2I C;  4GTD A;  1K83 C;  4FM9 A;  4B56 A;  2Y0S L;  5INH A;  1O99 A;  1ZEB A;  2GLQ A;  3E2D A;  4GTX A;  1N2L A;  4GFQ A;  3MK1 A;  3S14 C;  3WOD A;  2WAQ D;  4ZH4 A;  2NVX C;  4UOO A;  5LIA A;  1VJE A;  3GDZ A;  2E2I K;  4KDD A;  3GSI A;  2Y0S D;  4A3K C;  4X6A K;  1KH4 A;  1SFO C;  1EK8 A;  3DXJ A;  1WSV A;  3TFJ A;  4LR9 A;  3LAP A;  4GT9 A;  3WAV A;  1TWA K;  1F9N A;  1EI6 A;  2PA8 L;  2NVX K;  3GTJ A;  3IGY B;  1I6V A;  4P9S A;  5IOT A;  1TWH K;  2W5X A;  2R7Z C;  1KH7 A;  3S16 C;  2W8D A;  5M3F K;  1HQM A;  4Q4Z A;  3BP8 C;  2W7V A;  1ANJ A;  3GTL A;  1GE9 A;  1C0A A;  1JVI A;  2D1G A;  1X31 C;  4ILD A;  3HKZ L;  1Y1W A;  3WAW A;  4A3J C;  3OPF A;  3WAX A;  1Y1W K;  3HOX C;  4A3B C;  1TWH C;  5IOQ A;  2IUC B;  3BUE A;  2R7Z K;  5L0B A;  5TJ3 A;  3AD8 C;  1I50 A;  5EGH A;  2P8T A;  1KHJ A;  1I6H C;  1O29 A;  1B4A A;  3GIR A;  3S15 K;  2W5Q A;  3NVL A;  4C3J C;  2A68 A;  2JA7 C;  4A3G C;  4ZG6 A;  3OEP A;  3AD7 C;  4A3B K;  2O5I A;  1J6V A;  3V4G A;  3VA7 A;  1ED9 A;  5JFE A;  3A8I A;  4G7Z A;  4LRB A;  3K7A C;  4N7T A;  2V6S A;  2WB1 D;  2Y3P A;  4MY4 A;  1KHL A;  4LOW A;  1L0W A;  1EQR A;  4A3G K;  3N3Y A;  4CYR A;  1PJ6 A;  1KQ4 A;  3MML B;  3Q3Q A;  3HOW C;  1ELY A;  2B63 C;  3MK0 A;  3RZO C;  3CQZ A;  4LR8 A;  2W5R A;  5IOS A;  1WOR A;  3I4M K;  3H0G K;  3K7A K;  5M5W K;  3T02 A;  1FSU A;  5CHP A;  3GTP A;  3FKI C;  3N0C A;  5DLV A;  1ELX A;  1INN A;  3HXA A;  3NKO A;  3S1R C;  1VLO A;  5GOV A;  1E2S P;  2W5T A;  3HOW K;  4LK1 A;  3BDH A;  2JA6 A;  1Y6V A;  4P5A A;  1SFO K;  2NVQ K;  4GTB A;  1PJ5 A;  3M7V A;  2E2H A;  3H0G C;  3L4K A;  2NVX A;  1TWA C;  1VGX A;  5C4J K;  3FKI K;  4CYS A;  4A3C C;  1TWC A;  3S1R K;  2XRG A;  1JOE A;  4DDQ A;  1TWG A;  4A3I K;  2V6T A;  5TMC A;  2E2J C;  1YNN A;  4MQ9 A;  3BDG A;  4G0U A;  1KH9 A;  1AJC A;  4ZG7 A;  2NVT C;  5IJQ A;  3LPX A;  1DCP A;  2O5J A;  1Y7A A;  1I3Q K;  2PMZ D;  4BKW A;  3HOY K;  4WJ3 M;  1YCL A;  1WQF A;  2JA5 C;  3ERE D;  3S2D C;  3H3V L;  4LRA A;  4A3I C;  3HOX K;  2PPB A;  2YU9 K;  5GRR A;  2E2J K;  3H0G A;  1BJT A;  4OIN A;  4ZG9 A;  1XZP A;  2ZUF A;  1O2F B;  3HOV K;  5L46 A;  4QJV A;  1I6H K;  1TWF C;  4AYB L;  5M5Y K;  1O2A A;  1I3Q C;  2VQR A;  3HOY C;  5LRN A;  4M1X A;  1ISE A;  2W5V A;  2JA7 K;  2YU9 C;  1E33 P;  3HOZ K;  1KHK A;  2GAG C;  3TTG A;  3GTK C;  2PA8 D;  1WIH A;  5HL8 A;  4C2M C;  4LRF A;  4GTY A;  4XCH A;  3HOV C;  1VRQ C;  3SZY A;  1YX2 A;  1TWF K;  5DLW A;  3S1M C;  2G9Y A;  3I4N K;  4OIR A;  3H3V D;  4PAB A;  5IYD K;  4C3H K;  2PMZ L;  3IGZ B;  1SMY A;  4KAS A;  1XZQ A;  3GEE A;  3A52 A;  3HOZ C;  2ANH A;  2B63 K;  3GTK K;  4GZY A;  3RZO K;  1WCM C;  2W8S A;  4C2M K;  1BDF A;  1JQW A;  2WAQ L;  4XLP A;  4XSX A;  1TWH A;  1XZQ B;  3KD8 A;  4QAX A;  3GTL K;  3I4M C;  4PAA A;  3BP3 A;  4BBS K;  1XXA A;  3CQZ K;  1J6X A;  4XLN A;  3I4N C;  2W5S A;  3UO0 A;  4YFX A;  4GTE A;  4C3H C;  3TX0 A;  2KWA A;  3AH5 A;  4A93 C;  1AJA A;  1ZBS A;  4BLB A;  1ZVU A;  4A3E K;  1AUK A;  1O2B A;  4LRE A;  2GSO A;  3S1N C;  1IQ0 A;  2NVQ C;  2RH6 A;  4C3I K;  1K83 A;  4NOI A;  2A6E A;  4KMD A;  2JA8 K;  3CQZ C;  1EW2 A;  4OIQ A;  1ALI A;  4O2D A;  5C4J C;  1N2K A;  3FOF A;  1EQJ A;  1YNJ A;  4A3C K;  5TMF A;  3GTJ K;  4FDJ A;  4A93 K;  3TFH A;  3DPC A;  3GEH A;  5L0E A;  5IYB K;  1TWC K;  2RGR A;  1R9T C;  3CAG A;  1WQG A;  4UOR A;  1EH1 A;  4BLA A;  2NVT K;  4ZGA A;  1USO A;  3GTM K;  2VUM C;  1USM A;  4P5B A;  5KXA A;  2JA5 A;  3GTJ C;  2BE5 A;  2JA5 K;  3S2D K;  4KAY A;  1EW9 A;  2R7Z A;  4G7H A;  3M8Y A;  1TWC C;  1HDH A;  1R9T K;  1O27 A;  1VH2 A;  1KHN A;  3GTQ K;  4CXK A;  4BY1 C;  3GTM C;  2CFA A;  4KB2 A;  1AJB A;  4A3F K;  2JH3 A;  4WJ4 A;  3CMR A; 
#chains in the Genus database with same CATH homology
 2GA3 A;  4UOO A;  5LIA A;  5IJQ A;  3NKR A;  1Y7A A;  1KH4 A;  3M8W A;  5DLT A;  4CXS A;  4LRA A;  3TWZ A;  3NKP A;  1AJD A;  5GRR A;  1ZED A;  4LR9 A;  5K4P A;  3M8Z A;  3WAV A;  4ZG9 A;  1SHN A;  3WBH A;  3NKM A;  1EI6 A;  2X98 A;  3IGY B;  4CXU A;  4YR1 A;  4UOP A;  4GTZ A;  2W5X A;  5AJ9 A;  1KH7 A;  2VQR A;  5LRN A;  2W5V A;  1URB A;  2W8D A;  4UPH A;  1ANJ A;  4NWX A;  1HQA A;  1E33 P;  5LRM A;  1KHK A;  1K7H A;  1SHQ A;  2D1G A;  3B5Q A;  4GTY A;  4LRF A;  3SZY A;  5DLW A;  3WAW A;  1KH5 A;  3WAX A;  2G9Y A;  3BDF A;  2IUC B;  5L0B A;  1B8J A;  5TJ3 A;  3UN2 A;  5EGH A;  3IGZ B;  3UNY A;  1KHJ A;  3SZZ A;  3A52 A;  2ANH A;  1URA A;  2W8S A;  2W5Q A;  1O98 A;  3NVL A;  5LQQ A;  1ALK A;  3KD8 A;  1HJK A;  2W5W A;  4QAX A;  4ZG6 A;  5C66 A;  4NWJ A;  3OT9 A;  2W5S A;  1ELZ A;  3UO0 A;  2IFY A;  1E1Z P;  4LRD A;  1ANI A;  3TX0 A;  2IUC A;  3BDG B;  1ED9 A;  1AJA A;  4UPI A;  5HRT A;  1AUK A;  4KM4 A;  4LRB A;  4LRE A;  2GSO A;  4N7T A;  4MY4 A;  3IDD A;  1KHL A;  2RH6 A;  2GSN A;  4LQY A;  5IJS A;  4CYR A;  3NKQ A;  1EW2 A;  2GSU A;  1ALI A;  1ZEF A;  3Q3Q A;  3ED4 A;  4KJG A;  3TG0 A;  1ELY A;  1ED8 A;  3WAY A;  3MK0 A;  1N2K A;  1EQJ A;  4LR8 A;  2W5R A;  1EJJ A;  4GTW A;  1P49 A;  2ZKT A;  3MK2 A;  4LR7 A;  4FDJ A;  3UN3 A;  3T00 A;  3DPC A;  5L0E A;  3T02 A;  1FSU A;  4LR2 A;  5L0K A;  5DLV A;  1ELX A;  4UOR A;  4UPK A;  3NKO A;  3T01 A;  1ALH A;  5GOV A;  1E2S P;  4ZGA A;  4KAV A;  2W5T A;  4MIV A;  4MHX A;  3NKN A;  3BDH A;  4FDI A;  1Y6V A;  5KXA A;  5EGE A;  4UPL A;  2QZU A;  4LRC A;  1ALJ A;  4KAY A;  1EW9 A;  3M7V A;  3M8Y A;  1HDH A;  4KJD A;  4CYS A;  4B56 A;  5INH A;  1KHN A;  1O99 A;  1ZEB A;  2GLQ A;  3DYC A;  2XRG A;  4TN0 A;  4CXK A;  3E2D A;  1E3C P;  1EW8 A;  4GTX A;  1N2L A;  2XR9 A;  3LXQ A;  1AJB A;  3MK1 A;  3UN5 A;  3BDG A;  1KH9 A;  1AJC A;  4ZG7 A;  3CMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...