3U3AX

Structure of human carbonic anhydrase ii v143i
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAILGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 2
publication title Structural Analysis of Human Carbonic Anhydrase II Binding Pocket
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 79
structure length 258
sequence length 258
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2011-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3u3aX00
5JDVB 2QO8A 3MYQA 1I90A 4YGLA 1BICA 1HVAA 1UGCA 7CA2A 3TMJA 2FNKA 1ZE8A 3ML5A 3TVOX 3JXGA 2Q1QA 5JQ0A 1HUGA 5DOGA 2GD8A 1HEBA 4WW8A 2Q38A 4KNMA 3N4BA 4XZ5A 1YDBA 4YXIA 5EHVA 4HU1A 4K0ZA 1DCBA 5FNGA 3KNEA 1ZGFA 4N16A 3PJJA 4QIYA 1FQRA 1ZNCA 1KWQA 4Q78A 5FL6A 5CACA 1ZFQA 1I9QA 5SZ3A 2EU3A 5G0CA 4Q83A 1CAZA 4YGJA 5EIJA 1IF6A 3M40A 5JGSB 1IF8A 4KP8A 2CBEA 4KP5A 1FLJA 1G1DA 1IF4A 1CAYA 1UGDA 3DCWA 3HS4A 3V3IB 2FNNA 4K13A 1I8ZA 3NI5A 4K1QA 4FIKA 1UGEA 4M2UA 3M5SA 4CNXA 3MNUA 3KOKA 2WD2A 2FNMA 4QIZA 2F14A 4E5QA 1UGAA 3P5AA 1FR4A 1RJ5A 5A6HA 4R59A 3S97A 2NMXA 3DC9A 2WEOA 4ZX1A 3MNJA 1RZAA 4MDMA 4Q7VA 4MO8A 4YXUA 1JD0A 1OKLA 3KONA 5LMDA 3QYKA 4Q08A 4ZX0A 3JXFA 4QJPA 5FDIA 2HFWA 3DV7A 3M04A 1Z97A 3FW3A 3R16A 2NXSA 4DZ7A 3IBIA 1CAOA 1RJ6A 1HEDA 4ITOA 3U47A 4JSAA 3RZ7A 3M96A 1CVAA 1CVCA 1FQMA 1G3ZA 3RLDA 2NN7A 4MDGA 4ZWZA 3F8EA 3LXEA 3T83A 2POUA 4ILXA 4XE1A 3UYQA 1UGBA 3KKXA 4JS6A 1FR7A 1TE3X 2FOQA 5DSPA 2FMGA 5DSRA 4E3HA 4HT0A 5FLTA 5L6KA 2NXTA 3FFPX 4QSJA 3RZ1B 4Z1NA 2HL4A 5JEPB 1BN4A 4Q7SA 1LG6A 3DD8A 3MZCA 1G53A 5FNMA 5DSLA 4YGKA 5EHEA 5BRVA 3U7CA 1FQNA 2CBCA 5SZ0A 3SBIA 1H9NA 3RYXB 4Q9YA 4QJOA 1FSQA 4FPTA 4ITPA 3V5GA 3HKUA 3RJ7A 3SBHA 5BYIA 2FOUA 5FDCA 12CAA 5HPJA 1RZBA 5CA2A 5DOHA 1YO2A 4Z1JA 5EH7A 4G0CA 3DA2A 3OKUA 1MUAA 2ABEA 2EZ7A 2CBAA 3MDZA 3B1BA 5FLSA 3HKNA 4WUQA 2X7UA 1AVNA 4HEWA 4FVNA 1CAMA 4CACA 1OKNA 4BF6A 2O4ZA 3OILA 4Q49A 5G01A 5DRSA 4Z1EA 3DCCA 1DMXA 2CBBA 3M5EA 3T84A 1CAIA 2WEHA 4RFCA 3MNKA 1IF7A 4Q0LA 4CQ0A 4E3GA 1FQLA 3RZ8A 4QSIA 1CNHA 3UYNA 3VBDA 1HCAA 3D93A 3DVCA 2H15A 5JESB 4FVOA 3M2ZA 4QSAA 1DMYA 3MHIA 3RG4A 3K2FA 4QY3A 3BETA 1DCAA 2ZNCA 3N2PA 3KIGA 3U3AX 3N0NA 2X7SA 4Q81A 8CA2A 1YDAA 4HT2A 4WW6A 4YX4A 3R17B 4BCWA 3RYJB 3FE4A 1CAJA 1CVBA 2NWZA 4KUVA 2NWYA 4YHAA 2Q1BA 5FLOA 1XEVA 4M2RA 4FRCA 4QJWA 5FLRA 1Z9YA 3DCSA 1UGGA 3M5TA 1CVEA 3TVNX 6CA2A 4XIWA 2POVA 3S76A 2POWA 4Q90A 5IPZA 4KUWA 4MLTA 5SZ5A 2IT4A 1CNYA 4Y0JA 3RG3A 4JSSA 1CNBA 3K7KA 3P3JA 4WL4A 5E28A 3BL1A 5JEHB 1F2WA 2ILIA 4RH2A 2FW4A 5FNKA 1I9OA 5FNLA 4E9OX 5AMDA 1HCBA 4E3FA 3M67A 2NN1A 4QSBA 1AZMA 1EOUA 4PXXA 2NNOA 3PYKA 1ZFKA 4Z0QA 4YWPA 3RZ0B 2NNSA 4YGFA 3JXHC 4RIUA 2EU2A 5FL5A 1TEUX 1YDCA 2CBDA 2NWPA 3OYQA 1TG9A 2FOYA 3MMFA 2NXRA 1BNTA 4CNWA 2NNVA 4XFWA 5BRUA 1CNKA 1TTMA 3K34A 3OIKA 3V3JA 3F7UA 4QJXA 4E3DA 1CNGA 3DVDA 1BNQA 4N0XB 2AW1A 3IBLA 1IF5A 4UOVA 4WR7A 3S73B 2X7TA 2AX2A 3M2XA 1BCDA 1CVDA 3M1JA 4JSWA 4RUZA 1CCUA 4KUYA 3S74B 1CNCA 2HKKA 3SAXA 3IBUA 3OIMA 5DSIA 3P4VA 1H9QA 2WD3A 3GZ0A 3D8WA 1URTA 4C3TA 4Q87A 1TH9A 5CLUA 1MOOA 3PO6A 1BN3A 1G4JA 1CANA 3RGEA 1CIMA 1CNWA 4KNJA 4KNNA 4RIVA 4Q99A 3MHLA 1ZH9A 4TWLA 5JEGB 5DVXA 4ZAOA 1CNXA 3IBNA 5C8IA 1KWRA 5J8ZA 4MTYA 5SZ2A 1A42A 3HFPA 1KOQA 3S72B 4RFDA 1HEAA 1G52A 3M14A 1XQ0A 5EKMA 5AMGA 2NWOA 4L5UA 2FOVA 4RUYA 5G0BA 2QOAA 2NNGA 3D9ZA 3Q31A 1CINA 4HBAA 1I9LA 5SZ4A 3KWAA 3MHCA 1YO0A 1ZSBA 5JGTB 4QTLA 4ZWIA 1CILA 3EFTA 4LHIA 1TEQX 4QK1A 3RYVB 4IDRX 4Q7PA 4WUPA 1CNIA 1ZSCA 3ML2A 1G45A 3CAJA 3DD0A 1HECA 3IEOA 4GL1X 5E2NA 5BRWA 2QP6A 4K0TA 5A25A 3S8XA 3HKTA 3V2JA 5JG3B 5EKHA 1BZMA 1HUHA 2FMZA 3CZVA 1KOPA 3C7PA 1J9WA 1XEGA 4YGNA 1THKA 3P55A 3KLDB 4KNIA 4ZWXA 1CCSA 5DSQA 1OQ5A 5E2RA 3V2MA 2CA2A 5E2KA 1V9IC 2VVBX 4JSZA 3T82A 5DSOA 2HNCA 3MHMA 3MHOA 4XIXA 5DSKA 5EH5A 3DVBA 2HOCA 4E49A 4FU5A 5EHWA 3T85A 4R5BA 1I9NA 3BL0A 5SZ7A 3M98A 5E2SA 4BF1A 2HD6A 1KEQA 3NJ9A 4E4AA 4RN4A 3F4XA 1YO1A 5FNIA 3P44A 3W6IA 1CALA 1ZSAA 1IF9A 4HF3A 3RYZA 3MNAA 2VVAX 3F7BA 1CA3A 4Q6DA 4Q8YA 4QJ0A 2OSMA 4CA2A 1BNUA 5BNLA 1OKMA 4K0SA 1BNMA 4RUXA 1V9EA 1XPZA 5SZ1A 1BN1A 1BNNA 4X5SA 4Q09A 1LGDA 3MNIA 4LP6A 1CAHA 3HLJA 5DSMA 3U45X 3L14A 1AM6A 1BV3A 4HEZA 4G7AA 5G03A 4LU3A 5SZ6A 3DBUA 3S77B 5EOIA 4Q8ZA 5FL4A 4PZHA 1CVHA 1G6VA 1CCTA 5AMLA 3S78B 3W6HA 3OYSA 1CRAA 1CA2A 1G48A 3D0NA 3RZ5A 1RZDA 3NB5A 3SAPA 4YXOA 3V7XA 2OSFA 1TB0X 4MDLA 3HKQA 1I9MA 1JV0A 5DSJA 4M2VA 4QEFA 4KAPA 5L3OA 3B4FA 4L5VA 3D92A 4PYYA 1CNJA 4FL7A 4ETQC 3MNHA 5FLPA 3S71B 3MWOA 5EH8A 4PYXA 1FSNA 5FNHA 2GEHA 1G0FA 5DSNA 4MLXA 1BNWA 1G54A 4TWMA 3M1QA 5FLQA 1Y7WA 4HEYA 1CRMA 3N3JA 5JQTA 5FNJA 4QK2A 3RYYA 3IAIA 1CZMA 1RAYA 1I91A 3T5UA 3T5ZA 4M2WA 4ZWYA 4COQA 3OKVA 4QJMA 4Q07A 3CYUA 4CNVA 1G4OA 3DC3A 1I9PA 1LG5A 4KV0A 4Z1KA 1Z93A 1CVFA 1RZCA 3M1WA 4Q8XA 4DZ9A 2WEGA 3CA2A 3P58A 3S9TA 3DAZA 1CAKA 2W2JA 3ZNCA 4CNRA 4YYTA 1JCZA 1BNVA 3IGPA 3OY0A 3ZP9A 3EFIA 3P5LA 5EKJA 1TG3A 3V3GB 5JG5B 5CJFA 4IWZA 2CABA 3M1KA 2H4NA 3M3XA 5EZTX 1YDDA 1G46A 1G0EA 2FOSA 4Q7WA 4PQ7A 5E5RA 1H4NA 3KOIA 5E5UA 1TBTX 3M2YA 1RZEA 1UGFA 4Q6EA 1T9NA 9CA2A 3V3FA 3P3HA 4YVYA 3V3HB 3KS3A 5E2MA 4R5AA 2WEJA 4L5WA 3S75B 4QK3A 1ZGEA 1LUGA 4Q06A 3M2NA 1FSRA 1RAZA 1LZVA
chains in the Genus database with same CATH superfamily
5JDVB 2QO8A 3MYQA 1I90A 4YGLA 1BICA 1HVAA 1UGCA 7CA2A 3TMJA 2FNKA 1ZE8A 3ML5A 3TVOX 3JXGA 2Q1QA 5JQ0A 1HUGA 5DOGA 2GD8A 1HEBA 4WW8A 2Q38A 4KNMA 3N4BA 4XZ5A 1YDBA 4YXIA 5EHVA 4HU1A 4K0ZA 1DCBA 5FNGA 3KNEA 1ZGFA 4N16A 3PJJA 4QIYA 1FQRA 1ZNCA 1KWQA 4Q78A 5FL6A 5CACA 1ZFQA 1I9QA 5SZ3A 2EU3A 5G0CA 4Q83A 1CAZA 4YGJA 5EIJA 1IF6A 3M40A 5JGSB 1IF8A 4KP8A 2CBEA 4KP5A 1FLJA 1G1DA 1IF4A 1CAYA 1UGDA 3DCWA 3HS4A 3V3IB 2FNNA 4K13A 1I8ZA 3NI5A 4K1QA 4FIKA 1UGEA 4M2UA 3M5SA 4CNXA 3MNUA 3KOKA 2WD2A 2FNMA 4QIZA 2F14A 4E5QA 1UGAA 3P5AA 1FR4A 1RJ5A 5A6HA 4R59A 3S97A 2NMXA 3DC9A 2WEOA 4ZX1A 3MNJA 1RZAA 4MDMA 4Q7VA 4MO8A 4YXUA 1JD0A 1OKLA 3KONA 5LMDA 3QYKA 4Q08A 4ZX0A 3JXFA 4QJPA 5FDIA 2HFWA 3DV7A 3M04A 1Z97A 3FW3A 3R16A 2NXSA 4DZ7A 3IBIA 1CAOA 1RJ6A 1HEDA 4ITOA 3U47A 4JSAA 3RZ7A 3M96A 1CVAA 1CVCA 1FQMA 1G3ZA 3RLDA 2NN7A 4MDGA 4ZWZA 3F8EA 3LXEA 3T83A 2POUA 4ILXA 4XE1A 3UYQA 1UGBA 3KKXA 4JS6A 1FR7A 1TE3X 2FOQA 5DSPA 2FMGA 5DSRA 4E3HA 4HT0A 5FLTA 5L6KA 2NXTA 3FFPX 4QSJA 3RZ1B 4Z1NA 2HL4A 5JEPB 1BN4A 4Q7SA 1LG6A 3DD8A 3MZCA 1G53A 5FNMA 5DSLA 4YGKA 5EHEA 5BRVA 3U7CA 1FQNA 2CBCA 5SZ0A 3SBIA 1H9NA 3RYXB 4Q9YA 4QJOA 1FSQA 4FPTA 4ITPA 3V5GA 3HKUA 3RJ7A 3SBHA 5BYIA 2FOUA 5FDCA 12CAA 5HPJA 1RZBA 5CA2A 5DOHA 1YO2A 4Z1JA 5EH7A 4G0CA 3DA2A 3OKUA 1MUAA 2ABEA 2EZ7A 2CBAA 3MDZA 3B1BA 5FLSA 3HKNA 4WUQA 2X7UA 1AVNA 4HEWA 4FVNA 1CAMA 4CACA 1OKNA 4BF6A 2O4ZA 3OILA 4Q49A 5G01A 5DRSA 4Z1EA 3DCCA 1DMXA 2CBBA 3M5EA 3T84A 1CAIA 2WEHA 4RFCA 3MNKA 1IF7A 4Q0LA 4CQ0A 4E3GA 1FQLA 3RZ8A 4QSIA 1CNHA 3UYNA 3VBDA 1HCAA 3D93A 3DVCA 2H15A 5JESB 4FVOA 3M2ZA 4QSAA 1DMYA 3MHIA 3RG4A 3K2FA 4QY3A 3BETA 1DCAA 2ZNCA 3N2PA 3KIGA 3U3AX 3N0NA 2X7SA 4Q81A 8CA2A 1YDAA 4HT2A 4WW6A 4YX4A 3R17B 4BCWA 3RYJB 3FE4A 1CAJA 1CVBA 2NWZA 4KUVA 2NWYA 4YHAA 2Q1BA 5FLOA 1XEVA 4M2RA 4FRCA 4QJWA 5FLRA 1Z9YA 3DCSA 1UGGA 3M5TA 1CVEA 3TVNX 6CA2A 4XIWA 2POVA 3S76A 2POWA 4Q90A 5IPZA 4KUWA 4MLTA 5SZ5A 2IT4A 1CNYA 4Y0JA 3RG3A 4JSSA 1CNBA 3K7KA 3P3JA 4WL4A 5E28A 3BL1A 5JEHB 1F2WA 2ILIA 4RH2A 2FW4A 5FNKA 1I9OA 5FNLA 4E9OX 5AMDA 1HCBA 4E3FA 3M67A 2NN1A 4QSBA 1AZMA 1EOUA 4PXXA 2NNOA 3PYKA 1ZFKA 4Z0QA 4YWPA 3RZ0B 2NNSA 4YGFA 3JXHC 4RIUA 2EU2A 5FL5A 1TEUX 1YDCA 2CBDA 2NWPA 3OYQA 1TG9A 2FOYA 3MMFA 2NXRA 1BNTA 4CNWA 2NNVA 4XFWA 5BRUA 1CNKA 1TTMA 3K34A 3OIKA 3V3JA 3F7UA 4QJXA 4E3DA 1CNGA 3DVDA 1BNQA 4N0XB 2AW1A 3IBLA 1IF5A 4UOVA 4WR7A 3S73B 2X7TA 2AX2A 3M2XA 1BCDA 1CVDA 3M1JA 4JSWA 4RUZA 1CCUA 4KUYA 3S74B 1CNCA 2HKKA 3SAXA 3IBUA 3OIMA 5DSIA 3P4VA 1H9QA 2WD3A 3GZ0A 3D8WA 1URTA 4C3TA 4Q87A 1TH9A 5CLUA 1MOOA 3PO6A 1BN3A 1G4JA 1CANA 3RGEA 1CIMA 1CNWA 4KNJA 4KNNA 4RIVA 4Q99A 3MHLA 1ZH9A 4TWLA 5JEGB 5DVXA 4ZAOA 1CNXA 3IBNA 5C8IA 1KWRA 5J8ZA 4MTYA 5SZ2A 1A42A 3HFPA 1KOQA 3S72B 4RFDA 1HEAA 1G52A 3M14A 1XQ0A 5EKMA 5AMGA 2NWOA 4L5UA 2FOVA 4RUYA 5G0BA 2QOAA 2NNGA 3D9ZA 3Q31A 1CINA 4HBAA 1I9LA 5SZ4A 3KWAA 3MHCA 1YO0A 1ZSBA 5JGTB 4QTLA 4ZWIA 1CILA 3EFTA 4LHIA 1TEQX 4QK1A 3RYVB 4IDRX 4Q7PA 4WUPA 1CNIA 1ZSCA 3ML2A 1G45A 3CAJA 3DD0A 1HECA 3IEOA 4GL1X 5E2NA 5BRWA 2QP6A 4K0TA 5A25A 3S8XA 3HKTA 3V2JA 5JG3B 5EKHA 1BZMA 1HUHA 2FMZA 3CZVA 1KOPA 3C7PA 1J9WA 1XEGA 4YGNA 1THKA 3P55A 3KLDB 4KNIA 4ZWXA 1CCSA 5DSQA 1OQ5A 5E2RA 3V2MA 2CA2A 5E2KA 1V9IC 2VVBX 4JSZA 3T82A 5DSOA 2HNCA 3MHMA 3MHOA 4XIXA 5DSKA 5EH5A 3DVBA 2HOCA 4E49A 4FU5A 5EHWA 3T85A 4R5BA 1I9NA 3BL0A 5SZ7A 3M98A 5E2SA 4BF1A 2HD6A 1KEQA 3NJ9A 4E4AA 4RN4A 3F4XA 1YO1A 5FNIA 3P44A 3W6IA 1CALA 1ZSAA 1IF9A 4HF3A 3RYZA 3MNAA 2VVAX 3F7BA 1CA3A 4Q6DA 4Q8YA 4QJ0A 2OSMA 4CA2A 1BNUA 5BNLA 1OKMA 4K0SA 1BNMA 4RUXA 1V9EA 1XPZA 5SZ1A 1BN1A 1BNNA 4X5SA 4Q09A 1LGDA 3MNIA 4LP6A 1CAHA 3HLJA 5DSMA 3U45X 3L14A 1AM6A 1BV3A 4HEZA 4G7AA 5G03A 4LU3A 5SZ6A 3DBUA 3S77B 5EOIA 4Q8ZA 5FL4A 4PZHA 1CVHA 1G6VA 1CCTA 5AMLA 3S78B 3W6HA 3OYSA 1CRAA 1CA2A 1G48A 3D0NA 3RZ5A 1RZDA 3NB5A 3SAPA 4YXOA 3V7XA 2OSFA 1TB0X 4MDLA 3HKQA 1I9MA 1JV0A 5DSJA 4M2VA 4QEFA 4KAPA 5L3OA 3B4FA 4L5VA 3D92A 4PYYA 1CNJA 4FL7A 4ETQC 3MNHA 5FLPA 3S71B 3MWOA 5EH8A 4PYXA 1FSNA 5FNHA 2GEHA 1G0FA 5DSNA 4MLXA 1BNWA 1G54A 4TWMA 3M1QA 5FLQA 1Y7WA 4HEYA 1CRMA 3N3JA 5JQTA 5FNJA 4QK2A 3RYYA 3IAIA 1CZMA 1RAYA 1I91A 3T5UA 3T5ZA 4M2WA 4ZWYA 4COQA 3OKVA 4QJMA 4Q07A 3CYUA 4CNVA 1G4OA 3DC3A 1I9PA 1LG5A 4KV0A 4Z1KA 1Z93A 1CVFA 1RZCA 3M1WA 4Q8XA 4DZ9A 2WEGA 3CA2A 3P58A 3S9TA 3DAZA 1CAKA 2W2JA 3ZNCA 4CNRA 4YYTA 1JCZA 1BNVA 3IGPA 3OY0A 3ZP9A 3EFIA 3P5LA 5EKJA 1TG3A 3V3GB 5JG5B 5CJFA 4IWZA 2CABA 3M1KA 2H4NA 3M3XA 5EZTX 1YDDA 1G46A 1G0EA 2FOSA 4Q7WA 4PQ7A 5E5RA 1H4NA 3KOIA 5E5UA 1TBTX 3M2YA 1RZEA 1UGFA 4Q6EA 1T9NA 9CA2A 3V3FA 3P3HA 4YVYA 3V3HB 3KS3A 5E2MA 4R5AA 2WEJA 4L5WA 3S75B 4QK3A 1ZGEA 1LUGA 4Q06A 3M2NA 1FSRA 1RAZA 1LZVA
chains in the Genus database with same CATH topology
5JDVB 2QO8A 3MYQA 1I90A 4YGLA 1BICA 1HVAA 1UGCA 7CA2A 3TMJA 2FNKA 1ZE8A 3ML5A 3TVOX 3JXGA 2Q1QA 5JQ0A 1HUGA 5DOGA 2GD8A 1HEBA 4WW8A 2Q38A 4KNMA 3N4BA 4XZ5A 1YDBA 4YXIA 5EHVA 4HU1A 4K0ZA 1DCBA 5FNGA 3KNEA 1ZGFA 4N16A 3PJJA 4QIYA 1FQRA 1ZNCA 1KWQA 4Q78A 5FL6A 5CACA 1ZFQA 1I9QA 5SZ3A 2EU3A 5G0CA 4Q83A 1CAZA 4YGJA 5EIJA 1IF6A 3M40A 5JGSB 1IF8A 4KP8A 2CBEA 4KP5A 1FLJA 1G1DA 1IF4A 1CAYA 1UGDA 3DCWA 3HS4A 3V3IB 2FNNA 4K13A 1I8ZA 3NI5A 4K1QA 4FIKA 1UGEA 4M2UA 3M5SA 4CNXA 3MNUA 3KOKA 2WD2A 2FNMA 4QIZA 2F14A 4E5QA 1UGAA 3P5AA 1FR4A 1RJ5A 5A6HA 4R59A 3S97A 2NMXA 3DC9A 2WEOA 4ZX1A 3MNJA 1RZAA 4MDMA 4Q7VA 4MO8A 4YXUA 1JD0A 1OKLA 3KONA 5LMDA 3QYKA 4Q08A 4ZX0A 3JXFA 4QJPA 5FDIA 2HFWA 3DV7A 3M04A 1Z97A 3FW3A 3R16A 2NXSA 4DZ7A 3IBIA 1CAOA 1RJ6A 1HEDA 4ITOA 3U47A 4JSAA 3RZ7A 3M96A 1CVAA 1CVCA 1FQMA 1G3ZA 3RLDA 2NN7A 4MDGA 4ZWZA 3F8EA 3LXEA 3T83A 2POUA 4ILXA 4XE1A 3UYQA 1UGBA 3KKXA 4JS6A 1FR7A 1TE3X 2FOQA 5DSPA 2FMGA 5DSRA 4E3HA 4HT0A 5FLTA 5L6KA 2NXTA 3FFPX 4QSJA 3RZ1B 4Z1NA 2HL4A 5JEPB 1BN4A 4Q7SA 1LG6A 3DD8A 3MZCA 1G53A 5FNMA 5DSLA 4YGKA 5EHEA 5BRVA 3U7CA 1FQNA 2CBCA 5SZ0A 3SBIA 1H9NA 3RYXB 4Q9YA 4QJOA 1FSQA 4FPTA 4ITPA 3V5GA 3HKUA 3RJ7A 3SBHA 5BYIA 2FOUA 5FDCA 12CAA 5HPJA 1RZBA 5CA2A 5DOHA 1YO2A 4Z1JA 5EH7A 4G0CA 3DA2A 3OKUA 1MUAA 2ABEA 2EZ7A 2CBAA 3MDZA 3B1BA 5FLSA 3HKNA 4WUQA 2X7UA 1AVNA 4HEWA 4FVNA 1CAMA 4CACA 1OKNA 4BF6A 2O4ZA 3OILA 4Q49A 5G01A 5DRSA 4Z1EA 3DCCA 1DMXA 2CBBA 3M5EA 3T84A 1CAIA 2WEHA 4RFCA 3MNKA 1IF7A 4Q0LA 4CQ0A 4E3GA 1FQLA 3RZ8A 4QSIA 1CNHA 3UYNA 3VBDA 1HCAA 3D93A 3DVCA 2H15A 5JESB 4FVOA 3M2ZA 4QSAA 1DMYA 3MHIA 3RG4A 3K2FA 4QY3A 3BETA 1DCAA 2ZNCA 3N2PA 3KIGA 3U3AX 3N0NA 2X7SA 4Q81A 8CA2A 1YDAA 4HT2A 4WW6A 4YX4A 3R17B 4BCWA 3RYJB 3FE4A 1CAJA 1CVBA 2NWZA 4KUVA 2NWYA 4YHAA 2Q1BA 5FLOA 1XEVA 4M2RA 4FRCA 4QJWA 5FLRA 1Z9YA 3DCSA 1UGGA 3M5TA 1CVEA 3TVNX 6CA2A 4XIWA 2POVA 3S76A 2POWA 4Q90A 5IPZA 4KUWA 4MLTA 5SZ5A 2IT4A 1CNYA 4Y0JA 3RG3A 4JSSA 1CNBA 3K7KA 3P3JA 4WL4A 5E28A 3BL1A 5JEHB 1F2WA 2ILIA 4RH2A 2FW4A 5FNKA 1I9OA 5FNLA 4E9OX 5AMDA 1HCBA 4E3FA 3M67A 2NN1A 4QSBA 1AZMA 1EOUA 4PXXA 2NNOA 3PYKA 1ZFKA 4Z0QA 4YWPA 3RZ0B 2NNSA 4YGFA 3JXHC 4RIUA 2EU2A 5FL5A 1TEUX 1YDCA 2CBDA 2NWPA 3OYQA 1TG9A 2FOYA 3MMFA 2NXRA 1BNTA 4CNWA 2NNVA 4XFWA 5BRUA 1CNKA 1TTMA 3K34A 3OIKA 3V3JA 3F7UA 4QJXA 4E3DA 1CNGA 3DVDA 1BNQA 4N0XB 2AW1A 3IBLA 1IF5A 4UOVA 4WR7A 3S73B 2X7TA 2AX2A 3M2XA 1BCDA 1CVDA 3M1JA 4JSWA 4RUZA 1CCUA 4KUYA 3S74B 1CNCA 2HKKA 3SAXA 3IBUA 3OIMA 5DSIA 3P4VA 1H9QA 2WD3A 3GZ0A 3D8WA 1URTA 4C3TA 4Q87A 1TH9A 5CLUA 1MOOA 3PO6A 1BN3A 1G4JA 1CANA 3RGEA 1CIMA 1CNWA 4KNJA 4KNNA 4RIVA 4Q99A 3MHLA 1ZH9A 4TWLA 5JEGB 5DVXA 4ZAOA 1CNXA 3IBNA 5C8IA 1KWRA 5J8ZA 4MTYA 5SZ2A 1A42A 3HFPA 1KOQA 3S72B 4RFDA 1HEAA 1G52A 3M14A 1XQ0A 5EKMA 5AMGA 2NWOA 4L5UA 2FOVA 4RUYA 5G0BA 2QOAA 2NNGA 3D9ZA 3Q31A 1CINA 4HBAA 1I9LA 5SZ4A 3KWAA 3MHCA 1YO0A 1ZSBA 5JGTB 4QTLA 4ZWIA 1CILA 3EFTA 4LHIA 1TEQX 4QK1A 3RYVB 4IDRX 4Q7PA 4WUPA 1CNIA 1ZSCA 3ML2A 1G45A 3CAJA 3DD0A 1HECA 3IEOA 4GL1X 5E2NA 5BRWA 2QP6A 4K0TA 5A25A 3S8XA 3HKTA 3V2JA 5JG3B 5EKHA 1BZMA 1HUHA 2FMZA 3CZVA 1KOPA 3C7PA 1J9WA 1XEGA 4YGNA 1THKA 3P55A 3KLDB 4KNIA 4ZWXA 1CCSA 5DSQA 1OQ5A 5E2RA 3V2MA 2CA2A 5E2KA 1V9IC 2VVBX 4JSZA 3T82A 5DSOA 2HNCA 3MHMA 3MHOA 4XIXA 5DSKA 5EH5A 3DVBA 2HOCA 4E49A 4FU5A 5EHWA 3T85A 4R5BA 1I9NA 3BL0A 5SZ7A 3M98A 5E2SA 4BF1A 2HD6A 1KEQA 3NJ9A 4E4AA 4RN4A 3F4XA 1YO1A 5FNIA 3P44A 3W6IA 1CALA 1ZSAA 1IF9A 4HF3A 3RYZA 3MNAA 2VVAX 3F7BA 1CA3A 4Q6DA 4Q8YA 4QJ0A 2OSMA 4CA2A 1BNUA 5BNLA 1OKMA 4K0SA 1BNMA 4RUXA 1V9EA 1XPZA 5SZ1A 1BN1A 1BNNA 4X5SA 4Q09A 1LGDA 3MNIA 4LP6A 1CAHA 3HLJA 5DSMA 3U45X 3L14A 1AM6A 1BV3A 4HEZA 4G7AA 5G03A 4LU3A 5SZ6A 3DBUA 3S77B 5EOIA 4Q8ZA 5FL4A 4PZHA 1CVHA 1G6VA 1CCTA 5AMLA 3S78B 3W6HA 3OYSA 1CRAA 1CA2A 1G48A 3D0NA 3RZ5A 1RZDA 3NB5A 3SAPA 4YXOA 3V7XA 2OSFA 1TB0X 4MDLA 3HKQA 1I9MA 1JV0A 5DSJA 4M2VA 4QEFA 4KAPA 5L3OA 3B4FA 4L5VA 3D92A 4PYYA 1CNJA 4FL7A 4ETQC 3MNHA 5FLPA 3S71B 3MWOA 5EH8A 4PYXA 1FSNA 5FNHA 2GEHA 1G0FA 5DSNA 4MLXA 1BNWA 1G54A 4TWMA 3M1QA 5FLQA 1Y7WA 4HEYA 1CRMA 3N3JA 5JQTA 5FNJA 4QK2A 3RYYA 3IAIA 1CZMA 1RAYA 1I91A 3T5UA 3T5ZA 4M2WA 4ZWYA 4COQA 3OKVA 4QJMA 4Q07A 3CYUA 4CNVA 1G4OA 3DC3A 1I9PA 1LG5A 4KV0A 4Z1KA 1Z93A 1CVFA 1RZCA 3M1WA 4Q8XA 4DZ9A 2WEGA 3CA2A 3P58A 3S9TA 3DAZA 1CAKA 2W2JA 3ZNCA 4CNRA 4YYTA 1JCZA 1BNVA 3IGPA 3OY0A 3ZP9A 3EFIA 3P5LA 5EKJA 1TG3A 3V3GB 5JG5B 5CJFA 4IWZA 2CABA 3M1KA 2H4NA 3M3XA 5EZTX 1YDDA 1G46A 1G0EA 2FOSA 4Q7WA 4PQ7A 5E5RA 1H4NA 3KOIA 5E5UA 1TBTX 3M2YA 1RZEA 1UGFA 4Q6EA 1T9NA 9CA2A 3V3FA 3P3HA 4YVYA 3V3HB 3KS3A 5E2MA 4R5AA 2WEJA 4L5WA 3S75B 4QK3A 1ZGEA 1LUGA 4Q06A 3M2NA 1FSRA 1RAZA 1LZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDV B;  2QO8 A;  3MYQ A;  1I90 A;  4YGL A;  1BIC A;  1HVA A;  1UGC A;  7CA2 A;  3TMJ A;  2FNK A;  1ZE8 A;  3ML5 A;  3TVO X;  3JXG A;  2Q1Q A;  5JQ0 A;  1HUG A;  5DOG A;  2GD8 A;  1HEB A;  4WW8 A;  2Q38 A;  4KNM A;  3N4B A;  4XZ5 A;  1YDB A;  4YXI A;  5EHV A;  4HU1 A;  4K0Z A;  1DCB A;  5FNG A;  3KNE A;  1ZGF A;  4N16 A;  3PJJ A;  4QIY A;  1FQR A;  1ZNC A;  1KWQ A;  4Q78 A;  5FL6 A;  5CAC A;  1ZFQ A;  1I9Q A;  5SZ3 A;  2EU3 A;  5G0C A;  4Q83 A;  1CAZ A;  4YGJ A;  5EIJ A;  1IF6 A;  3M40 A;  5JGS B;  1IF8 A;  4KP8 A;  2CBE A;  4KP5 A;  1FLJ A;  1G1D A;  1IF4 A;  1CAY A;  1UGD A;  3DCW A;  3HS4 A;  3V3I B;  2FNN A;  4K13 A;  1I8Z A;  3NI5 A;  4K1Q A;  4FIK A;  1UGE A;  4M2U A;  3M5S A;  4CNX A;  3MNU A;  3KOK A;  2WD2 A;  2FNM A;  4QIZ A;  2F14 A;  4E5Q A;  1UGA A;  3P5A A;  1FR4 A;  1RJ5 A;  5A6H A;  4R59 A;  3S97 A;  2NMX A;  3DC9 A;  2WEO A;  4ZX1 A;  3MNJ A;  1RZA A;  4MDM A;  4Q7V A;  4MO8 A;  4YXU A;  1JD0 A;  1OKL A;  3KON A;  5LMD A;  3QYK A;  4Q08 A;  4ZX0 A;  3JXF A;  4QJP A;  5FDI A;  2HFW A;  3DV7 A;  3M04 A;  1Z97 A;  3FW3 A;  3R16 A;  2NXS A;  4DZ7 A;  3IBI A;  1CAO A;  1RJ6 A;  1HED A;  4ITO A;  3U47 A;  4JSA A;  3RZ7 A;  3M96 A;  1CVA A;  1CVC A;  1FQM A;  1G3Z A;  3RLD A;  2NN7 A;  4MDG A;  4ZWZ A;  3F8E A;  3LXE A;  3T83 A;  2POU A;  4ILX A;  4XE1 A;  3UYQ A;  1UGB A;  3KKX A;  4JS6 A;  1FR7 A;  1TE3 X;  2FOQ A;  5DSP A;  2FMG A;  5DSR A;  4E3H A;  4HT0 A;  5FLT A;  5L6K A;  2NXT A;  3FFP X;  4QSJ A;  3RZ1 B;  4Z1N A;  2HL4 A;  5JEP B;  1BN4 A;  4Q7S A;  1LG6 A;  3DD8 A;  3MZC A;  1G53 A;  5FNM A;  5DSL A;  4YGK A;  5EHE A;  5BRV A;  3U7C A;  1FQN A;  2CBC A;  5SZ0 A;  3SBI A;  1H9N A;  3RYX B;  4Q9Y A;  4QJO A;  1FSQ A;  4FPT A;  4ITP A;  3V5G A;  3HKU A;  3RJ7 A;  3SBH A;  5BYI A;  2FOU A;  5FDC A;  12CA A;  5HPJ A;  1RZB A;  5CA2 A;  5DOH A;  1YO2 A;  4Z1J A;  5EH7 A;  4G0C A;  3DA2 A;  3OKU A;  1MUA A;  2ABE A;  2EZ7 A;  2CBA A;  3MDZ A;  3B1B A;  5FLS A;  3HKN A;  4WUQ A;  2X7U A;  1AVN A;  4HEW A;  4FVN A;  1CAM A;  4CAC A;  1OKN A;  4BF6 A;  2O4Z A;  3OIL A;  4Q49 A;  5G01 A;  5DRS A;  4Z1E A;  3DCC A;  1DMX A;  2CBB A;  3M5E A;  3T84 A;  1CAI A;  2WEH A;  4RFC A;  3MNK A;  1IF7 A;  4Q0L A;  4CQ0 A;  4E3G A;  1FQL A;  3RZ8 A;  4QSI A;  1CNH A;  3UYN A;  3VBD A;  1HCA A;  3D93 A;  3DVC A;  2H15 A;  5JES B;  4FVO A;  3M2Z A;  4QSA A;  1DMY A;  3MHI A;  3RG4 A;  3K2F A;  4QY3 A;  3BET A;  1DCA A;  2ZNC A;  3N2P A;  3KIG A;  3U3A X;  3N0N A;  2X7S A;  4Q81 A;  8CA2 A;  1YDA A;  4HT2 A;  4WW6 A;  4YX4 A;  3R17 B;  4BCW A;  3RYJ B;  3FE4 A;  1CAJ A;  1CVB A;  2NWZ A;  4KUV A;  2NWY A;  4YHA A;  2Q1B A;  5FLO A;  1XEV A;  4M2R A;  4FRC A;  4QJW A;  5FLR A;  1Z9Y A;  3DCS A;  1UGG A;  3M5T A;  1CVE A;  3TVN X;  6CA2 A;  4XIW A;  2POV A;  3S76 A;  2POW A;  4Q90 A;  5IPZ A;  4KUW A;  4MLT A;  5SZ5 A;  2IT4 A;  1CNY A;  4Y0J A;  3RG3 A;  4JSS A;  1CNB A;  3K7K A;  3P3J A;  4WL4 A;  5E28 A;  3BL1 A;  5JEH B;  1F2W A;  2ILI A;  4RH2 A;  2FW4 A;  5FNK A;  1I9O A;  5FNL A;  4E9O X;  5AMD A;  1HCB A;  4E3F A;  3M67 A;  2NN1 A;  4QSB A;  1AZM A;  1EOU A;  4PXX A;  2NNO A;  3PYK A;  1ZFK A;  4Z0Q A;  4YWP A;  3RZ0 B;  2NNS A;  4YGF A;  3JXH C;  4RIU A;  2EU2 A;  5FL5 A;  1TEU X;  1YDC A;  2CBD A;  2NWP A;  3OYQ A;  1TG9 A;  2FOY A;  3MMF A;  2NXR A;  1BNT A;  4CNW A;  2NNV A;  4XFW A;  5BRU A;  1CNK A;  1TTM A;  3K34 A;  3OIK A;  3V3J A;  3F7U A;  4QJX A;  4E3D A;  1CNG A;  3DVD A;  1BNQ A;  4N0X B;  2AW1 A;  3IBL A;  1IF5 A;  4UOV A;  4WR7 A;  3S73 B;  2X7T A;  2AX2 A;  3M2X A;  1BCD A;  1CVD A;  3M1J A;  4JSW A;  4RUZ A;  1CCU A;  4KUY A;  3S74 B;  1CNC A;  2HKK A;  3SAX A;  3IBU A;  3OIM A;  5DSI A;  3P4V A;  1H9Q A;  2WD3 A;  3GZ0 A;  3D8W A;  1URT A;  4C3T A;  4Q87 A;  1TH9 A;  5CLU A;  1MOO A;  3PO6 A;  1BN3 A;  1G4J A;  1CAN A;  3RGE A;  1CIM A;  1CNW A;  4KNJ A;  4KNN A;  4RIV A;  4Q99 A;  3MHL A;  1ZH9 A;  4TWL A;  5JEG B;  5DVX A;  4ZAO A;  1CNX A;  3IBN A;  5C8I A;  1KWR A;  5J8Z A;  4MTY A;  5SZ2 A;  1A42 A;  3HFP A;  1KOQ A;  3S72 B;  4RFD A;  1HEA A;  1G52 A;  3M14 A;  1XQ0 A;  5EKM A;  5AMG A;  2NWO A;  4L5U A;  2FOV A;  4RUY A;  5G0B A;  2QOA A;  2NNG A;  3D9Z A;  3Q31 A;  1CIN A;  4HBA A;  1I9L A;  5SZ4 A;  3KWA A;  3MHC A;  1YO0 A;  1ZSB A;  5JGT B;  4QTL A;  4ZWI A;  1CIL A;  3EFT A;  4LHI A;  1TEQ X;  4QK1 A;  3RYV B;  4IDR X;  4Q7P A;  4WUP A;  1CNI A;  1ZSC A;  3ML2 A;  1G45 A;  3CAJ A;  3DD0 A;  1HEC A;  3IEO A;  4GL1 X;  5E2N A;  5BRW A;  2QP6 A;  4K0T A;  5A25 A;  3S8X A;  3HKT A;  3V2J A;  5JG3 B;  5EKH A;  1BZM A;  1HUH A;  2FMZ A;  3CZV A;  1KOP A;  3C7P A;  1J9W A;  1XEG A;  4YGN A;  1THK A;  3P55 A;  3KLD B;  4KNI A;  4ZWX A;  1CCS A;  5DSQ A;  1OQ5 A;  5E2R A;  3V2M A;  2CA2 A;  5E2K A;  1V9I C;  2VVB X;  4JSZ A;  3T82 A;  5DSO A;  2HNC A;  3MHM A;  3MHO A;  4XIX A;  5DSK A;  5EH5 A;  3DVB A;  2HOC A;  4E49 A;  4FU5 A;  5EHW A;  3T85 A;  4R5B A;  1I9N A;  3BL0 A;  5SZ7 A;  3M98 A;  5E2S A;  4BF1 A;  2HD6 A;  1KEQ A;  3NJ9 A;  4E4A A;  4RN4 A;  3F4X A;  1YO1 A;  5FNI A;  3P44 A;  3W6I A;  1CAL A;  1ZSA A;  1IF9 A;  4HF3 A;  3RYZ A;  3MNA A;  2VVA X;  3F7B A;  1CA3 A;  4Q6D A;  4Q8Y A;  4QJ0 A;  2OSM A;  4CA2 A;  1BNU A;  5BNL A;  1OKM A;  4K0S A;  1BNM A;  4RUX A;  1V9E A;  1XPZ A;  5SZ1 A;  1BN1 A;  1BNN A;  4X5S A;  4Q09 A;  1LGD A;  3MNI A;  4LP6 A;  1CAH A;  3HLJ A;  5DSM A;  3U45 X;  3L14 A;  1AM6 A;  1BV3 A;  4HEZ A;  4G7A A;  5G03 A;  4LU3 A;  5SZ6 A;  3DBU A;  3S77 B;  5EOI A;  4Q8Z A;  5FL4 A;  4PZH A;  1CVH A;  1G6V A;  1CCT A;  5AML A;  3S78 B;  3W6H A;  3OYS A;  1CRA A;  1CA2 A;  1G48 A;  3D0N A;  3RZ5 A;  1RZD A;  3NB5 A;  3SAP A;  4YXO A;  3V7X A;  2OSF A;  1TB0 X;  4MDL A;  3HKQ A;  1I9M A;  1JV0 A;  5DSJ A;  4M2V A;  4QEF A;  4KAP A;  5L3O A;  3B4F A;  4L5V A;  3D92 A;  4PYY A;  1CNJ A;  4FL7 A;  4ETQ C;  3MNH A;  5FLP A;  3S71 B;  3MWO A;  5EH8 A;  4PYX A;  1FSN A;  5FNH A;  2GEH A;  1G0F A;  5DSN A;  4MLX A;  1BNW A;  1G54 A;  4TWM A;  3M1Q A;  5FLQ A;  1Y7W A;  4HEY A;  1CRM A;  3N3J A;  5JQT A;  5FNJ A;  4QK2 A;  3RYY A;  3IAI A;  1CZM A;  1RAY A;  1I91 A;  3T5U A;  3T5Z A;  4M2W A;  4ZWY A;  4COQ A;  3OKV A;  4QJM A;  4Q07 A;  3CYU A;  4CNV A;  1G4O A;  3DC3 A;  1I9P A;  1LG5 A;  4KV0 A;  4Z1K A;  1Z93 A;  1CVF A;  1RZC A;  3M1W A;  4Q8X A;  4DZ9 A;  2WEG A;  3CA2 A;  3P58 A;  3S9T A;  3DAZ A;  1CAK A;  2W2J A;  3ZNC A;  4CNR A;  4YYT A;  1JCZ A;  1BNV A;  3IGP A;  3OY0 A;  3ZP9 A;  3EFI A;  3P5L A;  5EKJ A;  1TG3 A;  3V3G B;  5JG5 B;  5CJF A;  4IWZ A;  2CAB A;  3M1K A;  2H4N A;  3M3X A;  5EZT X;  1YDD A;  1G46 A;  1G0E A;  2FOS A;  4Q7W A;  4PQ7 A;  5E5R A;  1H4N A;  3KOI A;  5E5U A;  1TBT X;  3M2Y A;  1RZE A;  1UGF A;  4Q6E A;  1T9N A;  9CA2 A;  3V3F A;  3P3H A;  4YVY A;  3V3H B;  3KS3 A;  5E2M A;  4R5A A;  2WEJ A;  4L5W A;  3S75 B;  4QK3 A;  1ZGE A;  1LUG A;  4Q06 A;  3M2N A;  1FSR A;  1RAZ A;  1LZV A; 
#chains in the Genus database with same CATH topology
 5JDV B;  2QO8 A;  3MYQ A;  1I90 A;  4YGL A;  1BIC A;  1HVA A;  1UGC A;  7CA2 A;  3TMJ A;  2FNK A;  1ZE8 A;  3ML5 A;  3TVO X;  3JXG A;  2Q1Q A;  5JQ0 A;  1HUG A;  5DOG A;  2GD8 A;  1HEB A;  4WW8 A;  2Q38 A;  4KNM A;  3N4B A;  4XZ5 A;  1YDB A;  4YXI A;  5EHV A;  4HU1 A;  4K0Z A;  1DCB A;  5FNG A;  3KNE A;  1ZGF A;  4N16 A;  3PJJ A;  4QIY A;  1FQR A;  1ZNC A;  1KWQ A;  4Q78 A;  5FL6 A;  5CAC A;  1ZFQ A;  1I9Q A;  5SZ3 A;  2EU3 A;  5G0C A;  4Q83 A;  1CAZ A;  4YGJ A;  5EIJ A;  1IF6 A;  3M40 A;  5JGS B;  1IF8 A;  4KP8 A;  2CBE A;  4KP5 A;  1FLJ A;  1G1D A;  1IF4 A;  1CAY A;  1UGD A;  3DCW A;  3HS4 A;  3V3I B;  2FNN A;  4K13 A;  1I8Z A;  3NI5 A;  4K1Q A;  4FIK A;  1UGE A;  4M2U A;  3M5S A;  4CNX A;  3MNU A;  3KOK A;  2WD2 A;  2FNM A;  4QIZ A;  2F14 A;  4E5Q A;  1UGA A;  3P5A A;  1FR4 A;  1RJ5 A;  5A6H A;  4R59 A;  3S97 A;  2NMX A;  3DC9 A;  2WEO A;  4ZX1 A;  3MNJ A;  1RZA A;  4MDM A;  4Q7V A;  4MO8 A;  4YXU A;  1JD0 A;  1OKL A;  3KON A;  5LMD A;  3QYK A;  4Q08 A;  4ZX0 A;  3JXF A;  4QJP A;  5FDI A;  2HFW A;  3DV7 A;  3M04 A;  1Z97 A;  3FW3 A;  3R16 A;  2NXS A;  4DZ7 A;  3IBI A;  1CAO A;  1RJ6 A;  1HED A;  4ITO A;  3U47 A;  4JSA A;  3RZ7 A;  3M96 A;  1CVA A;  1CVC A;  1FQM A;  1G3Z A;  3RLD A;  2NN7 A;  4MDG A;  4ZWZ A;  3F8E A;  3LXE A;  3T83 A;  2POU A;  4ILX A;  4XE1 A;  3UYQ A;  1UGB A;  3KKX A;  4JS6 A;  1FR7 A;  1TE3 X;  2FOQ A;  5DSP A;  2FMG A;  5DSR A;  4E3H A;  4HT0 A;  5FLT A;  5L6K A;  2NXT A;  3FFP X;  4QSJ A;  3RZ1 B;  4Z1N A;  2HL4 A;  5JEP B;  1BN4 A;  4Q7S A;  1LG6 A;  3DD8 A;  3MZC A;  1G53 A;  5FNM A;  5DSL A;  4YGK A;  5EHE A;  5BRV A;  3U7C A;  1FQN A;  2CBC A;  5SZ0 A;  3SBI A;  1H9N A;  3RYX B;  4Q9Y A;  4QJO A;  1FSQ A;  4FPT A;  4ITP A;  3V5G A;  3HKU A;  3RJ7 A;  3SBH A;  5BYI A;  2FOU A;  5FDC A;  12CA A;  5HPJ A;  1RZB A;  5CA2 A;  5DOH A;  1YO2 A;  4Z1J A;  5EH7 A;  4G0C A;  3DA2 A;  3OKU A;  1MUA A;  2ABE A;  2EZ7 A;  2CBA A;  3MDZ A;  3B1B A;  5FLS A;  3HKN A;  4WUQ A;  2X7U A;  1AVN A;  4HEW A;  4FVN A;  1CAM A;  4CAC A;  1OKN A;  4BF6 A;  2O4Z A;  3OIL A;  4Q49 A;  5G01 A;  5DRS A;  4Z1E A;  3DCC A;  1DMX A;  2CBB A;  3M5E A;  3T84 A;  1CAI A;  2WEH A;  4RFC A;  3MNK A;  1IF7 A;  4Q0L A;  4CQ0 A;  4E3G A;  1FQL A;  3RZ8 A;  4QSI A;  1CNH A;  3UYN A;  3VBD A;  1HCA A;  3D93 A;  3DVC A;  2H15 A;  5JES B;  4FVO A;  3M2Z A;  4QSA A;  1DMY A;  3MHI A;  3RG4 A;  3K2F A;  4QY3 A;  3BET A;  1DCA A;  2ZNC A;  3N2P A;  3KIG A;  3U3A X;  3N0N A;  2X7S A;  4Q81 A;  8CA2 A;  1YDA A;  4HT2 A;  4WW6 A;  4YX4 A;  3R17 B;  4BCW A;  3RYJ B;  3FE4 A;  1CAJ A;  1CVB A;  2NWZ A;  4KUV A;  2NWY A;  4YHA A;  2Q1B A;  5FLO A;  1XEV A;  4M2R A;  4FRC A;  4QJW A;  5FLR A;  1Z9Y A;  3DCS A;  1UGG A;  3M5T A;  1CVE A;  3TVN X;  6CA2 A;  4XIW A;  2POV A;  3S76 A;  2POW A;  4Q90 A;  5IPZ A;  4KUW A;  4MLT A;  5SZ5 A;  2IT4 A;  1CNY A;  4Y0J A;  3RG3 A;  4JSS A;  1CNB A;  3K7K A;  3P3J A;  4WL4 A;  5E28 A;  3BL1 A;  5JEH B;  1F2W A;  2ILI A;  4RH2 A;  2FW4 A;  5FNK A;  1I9O A;  5FNL A;  4E9O X;  5AMD A;  1HCB A;  4E3F A;  3M67 A;  2NN1 A;  4QSB A;  1AZM A;  1EOU A;  4PXX A;  2NNO A;  3PYK A;  1ZFK A;  4Z0Q A;  4YWP A;  3RZ0 B;  2NNS A;  4YGF A;  3JXH C;  4RIU A;  2EU2 A;  5FL5 A;  1TEU X;  1YDC A;  2CBD A;  2NWP A;  3OYQ A;  1TG9 A;  2FOY A;  3MMF A;  2NXR A;  1BNT A;  4CNW A;  2NNV A;  4XFW A;  5BRU A;  1CNK A;  1TTM A;  3K34 A;  3OIK A;  3V3J A;  3F7U A;  4QJX A;  4E3D A;  1CNG A;  3DVD A;  1BNQ A;  4N0X B;  2AW1 A;  3IBL A;  1IF5 A;  4UOV A;  4WR7 A;  3S73 B;  2X7T A;  2AX2 A;  3M2X A;  1BCD A;  1CVD A;  3M1J A;  4JSW A;  4RUZ A;  1CCU A;  4KUY A;  3S74 B;  1CNC A;  2HKK A;  3SAX A;  3IBU A;  3OIM A;  5DSI A;  3P4V A;  1H9Q A;  2WD3 A;  3GZ0 A;  3D8W A;  1URT A;  4C3T A;  4Q87 A;  1TH9 A;  5CLU A;  1MOO A;  3PO6 A;  1BN3 A;  1G4J A;  1CAN A;  3RGE A;  1CIM A;  1CNW A;  4KNJ A;  4KNN A;  4RIV A;  4Q99 A;  3MHL A;  1ZH9 A;  4TWL A;  5JEG B;  5DVX A;  4ZAO A;  1CNX A;  3IBN A;  5C8I A;  1KWR A;  5J8Z A;  4MTY A;  5SZ2 A;  1A42 A;  3HFP A;  1KOQ A;  3S72 B;  4RFD A;  1HEA A;  1G52 A;  3M14 A;  1XQ0 A;  5EKM A;  5AMG A;  2NWO A;  4L5U A;  2FOV A;  4RUY A;  5G0B A;  2QOA A;  2NNG A;  3D9Z A;  3Q31 A;  1CIN A;  4HBA A;  1I9L A;  5SZ4 A;  3KWA A;  3MHC A;  1YO0 A;  1ZSB A;  5JGT B;  4QTL A;  4ZWI A;  1CIL A;  3EFT A;  4LHI A;  1TEQ X;  4QK1 A;  3RYV B;  4IDR X;  4Q7P A;  4WUP A;  1CNI A;  1ZSC A;  3ML2 A;  1G45 A;  3CAJ A;  3DD0 A;  1HEC A;  3IEO A;  4GL1 X;  5E2N A;  5BRW A;  2QP6 A;  4K0T A;  5A25 A;  3S8X A;  3HKT A;  3V2J A;  5JG3 B;  5EKH A;  1BZM A;  1HUH A;  2FMZ A;  3CZV A;  1KOP A;  3C7P A;  1J9W A;  1XEG A;  4YGN A;  1THK A;  3P55 A;  3KLD B;  4KNI A;  4ZWX A;  1CCS A;  5DSQ A;  1OQ5 A;  5E2R A;  3V2M A;  2CA2 A;  5E2K A;  1V9I C;  2VVB X;  4JSZ A;  3T82 A;  5DSO A;  2HNC A;  3MHM A;  3MHO A;  4XIX A;  5DSK A;  5EH5 A;  3DVB A;  2HOC A;  4E49 A;  4FU5 A;  5EHW A;  3T85 A;  4R5B A;  1I9N A;  3BL0 A;  5SZ7 A;  3M98 A;  5E2S A;  4BF1 A;  2HD6 A;  1KEQ A;  3NJ9 A;  4E4A A;  4RN4 A;  3F4X A;  1YO1 A;  5FNI A;  3P44 A;  3W6I A;  1CAL A;  1ZSA A;  1IF9 A;  4HF3 A;  3RYZ A;  3MNA A;  2VVA X;  3F7B A;  1CA3 A;  4Q6D A;  4Q8Y A;  4QJ0 A;  2OSM A;  4CA2 A;  1BNU A;  5BNL A;  1OKM A;  4K0S A;  1BNM A;  4RUX A;  1V9E A;  1XPZ A;  5SZ1 A;  1BN1 A;  1BNN A;  4X5S A;  4Q09 A;  1LGD A;  3MNI A;  4LP6 A;  1CAH A;  3HLJ A;  5DSM A;  3U45 X;  3L14 A;  1AM6 A;  1BV3 A;  4HEZ A;  4G7A A;  5G03 A;  4LU3 A;  5SZ6 A;  3DBU A;  3S77 B;  5EOI A;  4Q8Z A;  5FL4 A;  4PZH A;  1CVH A;  1G6V A;  1CCT A;  5AML A;  3S78 B;  3W6H A;  3OYS A;  1CRA A;  1CA2 A;  1G48 A;  3D0N A;  3RZ5 A;  1RZD A;  3NB5 A;  3SAP A;  4YXO A;  3V7X A;  2OSF A;  1TB0 X;  4MDL A;  3HKQ A;  1I9M A;  1JV0 A;  5DSJ A;  4M2V A;  4QEF A;  4KAP A;  5L3O A;  3B4F A;  4L5V A;  3D92 A;  4PYY A;  1CNJ A;  4FL7 A;  4ETQ C;  3MNH A;  5FLP A;  3S71 B;  3MWO A;  5EH8 A;  4PYX A;  1FSN A;  5FNH A;  2GEH A;  1G0F A;  5DSN A;  4MLX A;  1BNW A;  1G54 A;  4TWM A;  3M1Q A;  5FLQ A;  1Y7W A;  4HEY A;  1CRM A;  3N3J A;  5JQT A;  5FNJ A;  4QK2 A;  3RYY A;  3IAI A;  1CZM A;  1RAY A;  1I91 A;  3T5U A;  3T5Z A;  4M2W A;  4ZWY A;  4COQ A;  3OKV A;  4QJM A;  4Q07 A;  3CYU A;  4CNV A;  1G4O A;  3DC3 A;  1I9P A;  1LG5 A;  4KV0 A;  4Z1K A;  1Z93 A;  1CVF A;  1RZC A;  3M1W A;  4Q8X A;  4DZ9 A;  2WEG A;  3CA2 A;  3P58 A;  3S9T A;  3DAZ A;  1CAK A;  2W2J A;  3ZNC A;  4CNR A;  4YYT A;  1JCZ A;  1BNV A;  3IGP A;  3OY0 A;  3ZP9 A;  3EFI A;  3P5L A;  5EKJ A;  1TG3 A;  3V3G B;  5JG5 B;  5CJF A;  4IWZ A;  2CAB A;  3M1K A;  2H4N A;  3M3X A;  5EZT X;  1YDD A;  1G46 A;  1G0E A;  2FOS A;  4Q7W A;  4PQ7 A;  5E5R A;  1H4N A;  3KOI A;  5E5U A;  1TBT X;  3M2Y A;  1RZE A;  1UGF A;  4Q6E A;  1T9N A;  9CA2 A;  3V3F A;  3P3H A;  4YVY A;  3V3H B;  3KS3 A;  5E2M A;  4R5A A;  2WEJ A;  4L5W A;  3S75 B;  4QK3 A;  1ZGE A;  1LUG A;  4Q06 A;  3M2N A;  1FSR A;  1RAZ A;  1LZV A; 
#chains in the Genus database with same CATH homology
 5JDV B;  2QO8 A;  3MYQ A;  1I90 A;  4YGL A;  1BIC A;  1HVA A;  1UGC A;  7CA2 A;  3TMJ A;  2FNK A;  1ZE8 A;  3ML5 A;  3TVO X;  3JXG A;  2Q1Q A;  5JQ0 A;  1HUG A;  5DOG A;  2GD8 A;  1HEB A;  4WW8 A;  2Q38 A;  4KNM A;  3N4B A;  4XZ5 A;  1YDB A;  4YXI A;  5EHV A;  4HU1 A;  4K0Z A;  1DCB A;  5FNG A;  3KNE A;  1ZGF A;  4N16 A;  3PJJ A;  4QIY A;  1FQR A;  1ZNC A;  1KWQ A;  4Q78 A;  5FL6 A;  5CAC A;  1ZFQ A;  1I9Q A;  5SZ3 A;  2EU3 A;  5G0C A;  4Q83 A;  1CAZ A;  4YGJ A;  5EIJ A;  1IF6 A;  3M40 A;  5JGS B;  1IF8 A;  4KP8 A;  2CBE A;  4KP5 A;  1FLJ A;  1G1D A;  1IF4 A;  1CAY A;  1UGD A;  3DCW A;  3HS4 A;  3V3I B;  2FNN A;  4K13 A;  1I8Z A;  3NI5 A;  4K1Q A;  4FIK A;  1UGE A;  4M2U A;  3M5S A;  4CNX A;  3MNU A;  3KOK A;  2WD2 A;  2FNM A;  4QIZ A;  2F14 A;  4E5Q A;  1UGA A;  3P5A A;  1FR4 A;  1RJ5 A;  5A6H A;  4R59 A;  3S97 A;  2NMX A;  3DC9 A;  2WEO A;  4ZX1 A;  3MNJ A;  1RZA A;  4MDM A;  4Q7V A;  4MO8 A;  4YXU A;  1JD0 A;  1OKL A;  3KON A;  5LMD A;  3QYK A;  4Q08 A;  4ZX0 A;  3JXF A;  4QJP A;  5FDI A;  2HFW A;  3DV7 A;  3M04 A;  1Z97 A;  3FW3 A;  3R16 A;  2NXS A;  4DZ7 A;  3IBI A;  1CAO A;  1RJ6 A;  1HED A;  4ITO A;  3U47 A;  4JSA A;  3RZ7 A;  3M96 A;  1CVA A;  1CVC A;  1FQM A;  1G3Z A;  3RLD A;  2NN7 A;  4MDG A;  4ZWZ A;  3F8E A;  3LXE A;  3T83 A;  2POU A;  4ILX A;  4XE1 A;  3UYQ A;  1UGB A;  3KKX A;  4JS6 A;  1FR7 A;  1TE3 X;  2FOQ A;  5DSP A;  2FMG A;  5DSR A;  4E3H A;  4HT0 A;  5FLT A;  5L6K A;  2NXT A;  3FFP X;  4QSJ A;  3RZ1 B;  4Z1N A;  2HL4 A;  5JEP B;  1BN4 A;  4Q7S A;  1LG6 A;  3DD8 A;  3MZC A;  1G53 A;  5FNM A;  5DSL A;  4YGK A;  5EHE A;  5BRV A;  3U7C A;  1FQN A;  2CBC A;  5SZ0 A;  3SBI A;  1H9N A;  3RYX B;  4Q9Y A;  4QJO A;  1FSQ A;  4FPT A;  4ITP A;  3V5G A;  3HKU A;  3RJ7 A;  3SBH A;  5BYI A;  2FOU A;  5FDC A;  12CA A;  5HPJ A;  1RZB A;  5CA2 A;  5DOH A;  1YO2 A;  4Z1J A;  5EH7 A;  4G0C A;  3DA2 A;  3OKU A;  1MUA A;  2ABE A;  2EZ7 A;  2CBA A;  3MDZ A;  3B1B A;  5FLS A;  3HKN A;  4WUQ A;  2X7U A;  1AVN A;  4HEW A;  4FVN A;  1CAM A;  4CAC A;  1OKN A;  4BF6 A;  2O4Z A;  3OIL A;  4Q49 A;  5G01 A;  5DRS A;  4Z1E A;  3DCC A;  1DMX A;  2CBB A;  3M5E A;  3T84 A;  1CAI A;  2WEH A;  4RFC A;  3MNK A;  1IF7 A;  4Q0L A;  4CQ0 A;  4E3G A;  1FQL A;  3RZ8 A;  4QSI A;  1CNH A;  3UYN A;  3VBD A;  1HCA A;  3D93 A;  3DVC A;  2H15 A;  5JES B;  4FVO A;  3M2Z A;  4QSA A;  1DMY A;  3MHI A;  3RG4 A;  3K2F A;  4QY3 A;  3BET A;  1DCA A;  2ZNC A;  3N2P A;  3KIG A;  3U3A X;  3N0N A;  2X7S A;  4Q81 A;  8CA2 A;  1YDA A;  4HT2 A;  4WW6 A;  4YX4 A;  3R17 B;  4BCW A;  3RYJ B;  3FE4 A;  1CAJ A;  1CVB A;  2NWZ A;  4KUV A;  2NWY A;  4YHA A;  2Q1B A;  5FLO A;  1XEV A;  4M2R A;  4FRC A;  4QJW A;  5FLR A;  1Z9Y A;  3DCS A;  1UGG A;  3M5T A;  1CVE A;  3TVN X;  6CA2 A;  4XIW A;  2POV A;  3S76 A;  2POW A;  4Q90 A;  5IPZ A;  4KUW A;  4MLT A;  5SZ5 A;  2IT4 A;  1CNY A;  4Y0J A;  3RG3 A;  4JSS A;  1CNB A;  3K7K A;  3P3J A;  4WL4 A;  5E28 A;  3BL1 A;  5JEH B;  1F2W A;  2ILI A;  4RH2 A;  2FW4 A;  5FNK A;  1I9O A;  5FNL A;  4E9O X;  5AMD A;  1HCB A;  4E3F A;  3M67 A;  2NN1 A;  4QSB A;  1AZM A;  1EOU A;  4PXX A;  2NNO A;  3PYK A;  1ZFK A;  4Z0Q A;  4YWP A;  3RZ0 B;  2NNS A;  4YGF A;  3JXH C;  4RIU A;  2EU2 A;  5FL5 A;  1TEU X;  1YDC A;  2CBD A;  2NWP A;  3OYQ A;  1TG9 A;  2FOY A;  3MMF A;  2NXR A;  1BNT A;  4CNW A;  2NNV A;  4XFW A;  5BRU A;  1CNK A;  1TTM A;  3K34 A;  3OIK A;  3V3J A;  3F7U A;  4QJX A;  4E3D A;  1CNG A;  3DVD A;  1BNQ A;  4N0X B;  2AW1 A;  3IBL A;  1IF5 A;  4UOV A;  4WR7 A;  3S73 B;  2X7T A;  2AX2 A;  3M2X A;  1BCD A;  1CVD A;  3M1J A;  4JSW A;  4RUZ A;  1CCU A;  4KUY A;  3S74 B;  1CNC A;  2HKK A;  3SAX A;  3IBU A;  3OIM A;  5DSI A;  3P4V A;  1H9Q A;  2WD3 A;  3GZ0 A;  3D8W A;  1URT A;  4C3T A;  4Q87 A;  1TH9 A;  5CLU A;  1MOO A;  3PO6 A;  1BN3 A;  1G4J A;  1CAN A;  3RGE A;  1CIM A;  1CNW A;  4KNJ A;  4KNN A;  4RIV A;  4Q99 A;  3MHL A;  1ZH9 A;  4TWL A;  5JEG B;  5DVX A;  4ZAO A;  1CNX A;  3IBN A;  5C8I A;  1KWR A;  5J8Z A;  4MTY A;  5SZ2 A;  1A42 A;  3HFP A;  1KOQ A;  3S72 B;  4RFD A;  1HEA A;  1G52 A;  3M14 A;  1XQ0 A;  5EKM A;  5AMG A;  2NWO A;  4L5U A;  2FOV A;  4RUY A;  5G0B A;  2QOA A;  2NNG A;  3D9Z A;  3Q31 A;  1CIN A;  4HBA A;  1I9L A;  5SZ4 A;  3KWA A;  3MHC A;  1YO0 A;  1ZSB A;  5JGT B;  4QTL A;  4ZWI A;  1CIL A;  3EFT A;  4LHI A;  1TEQ X;  4QK1 A;  3RYV B;  4IDR X;  4Q7P A;  4WUP A;  1CNI A;  1ZSC A;  3ML2 A;  1G45 A;  3CAJ A;  3DD0 A;  1HEC A;  3IEO A;  4GL1 X;  5E2N A;  5BRW A;  2QP6 A;  4K0T A;  5A25 A;  3S8X A;  3HKT A;  3V2J A;  5JG3 B;  5EKH A;  1BZM A;  1HUH A;  2FMZ A;  3CZV A;  1KOP A;  3C7P A;  1J9W A;  1XEG A;  4YGN A;  1THK A;  3P55 A;  3KLD B;  4KNI A;  4ZWX A;  1CCS A;  5DSQ A;  1OQ5 A;  5E2R A;  3V2M A;  2CA2 A;  5E2K A;  1V9I C;  2VVB X;  4JSZ A;  3T82 A;  5DSO A;  2HNC A;  3MHM A;  3MHO A;  4XIX A;  5DSK A;  5EH5 A;  3DVB A;  2HOC A;  4E49 A;  4FU5 A;  5EHW A;  3T85 A;  4R5B A;  1I9N A;  3BL0 A;  5SZ7 A;  3M98 A;  5E2S A;  4BF1 A;  2HD6 A;  1KEQ A;  3NJ9 A;  4E4A A;  4RN4 A;  3F4X A;  1YO1 A;  5FNI A;  3P44 A;  3W6I A;  1CAL A;  1ZSA A;  1IF9 A;  4HF3 A;  3RYZ A;  3MNA A;  2VVA X;  3F7B A;  1CA3 A;  4Q6D A;  4Q8Y A;  4QJ0 A;  2OSM A;  4CA2 A;  1BNU A;  5BNL A;  1OKM A;  4K0S A;  1BNM A;  4RUX A;  1V9E A;  1XPZ A;  5SZ1 A;  1BN1 A;  1BNN A;  4X5S A;  4Q09 A;  1LGD A;  3MNI A;  4LP6 A;  1CAH A;  3HLJ A;  5DSM A;  3U45 X;  3L14 A;  1AM6 A;  1BV3 A;  4HEZ A;  4G7A A;  5G03 A;  4LU3 A;  5SZ6 A;  3DBU A;  3S77 B;  5EOI A;  4Q8Z A;  5FL4 A;  4PZH A;  1CVH A;  1G6V A;  1CCT A;  5AML A;  3S78 B;  3W6H A;  3OYS A;  1CRA A;  1CA2 A;  1G48 A;  3D0N A;  3RZ5 A;  1RZD A;  3NB5 A;  3SAP A;  4YXO A;  3V7X A;  2OSF A;  1TB0 X;  4MDL A;  3HKQ A;  1I9M A;  1JV0 A;  5DSJ A;  4M2V A;  4QEF A;  4KAP A;  5L3O A;  3B4F A;  4L5V A;  3D92 A;  4PYY A;  1CNJ A;  4FL7 A;  4ETQ C;  3MNH A;  5FLP A;  3S71 B;  3MWO A;  5EH8 A;  4PYX A;  1FSN A;  5FNH A;  2GEH A;  1G0F A;  5DSN A;  4MLX A;  1BNW A;  1G54 A;  4TWM A;  3M1Q A;  5FLQ A;  1Y7W A;  4HEY A;  1CRM A;  3N3J A;  5JQT A;  5FNJ A;  4QK2 A;  3RYY A;  3IAI A;  1CZM A;  1RAY A;  1I91 A;  3T5U A;  3T5Z A;  4M2W A;  4ZWY A;  4COQ A;  3OKV A;  4QJM A;  4Q07 A;  3CYU A;  4CNV A;  1G4O A;  3DC3 A;  1I9P A;  1LG5 A;  4KV0 A;  4Z1K A;  1Z93 A;  1CVF A;  1RZC A;  3M1W A;  4Q8X A;  4DZ9 A;  2WEG A;  3CA2 A;  3P58 A;  3S9T A;  3DAZ A;  1CAK A;  2W2J A;  3ZNC A;  4CNR A;  4YYT A;  1JCZ A;  1BNV A;  3IGP A;  3OY0 A;  3ZP9 A;  3EFI A;  3P5L A;  5EKJ A;  1TG3 A;  3V3G B;  5JG5 B;  5CJF A;  4IWZ A;  2CAB A;  3M1K A;  2H4N A;  3M3X A;  5EZT X;  1YDD A;  1G46 A;  1G0E A;  2FOS A;  4Q7W A;  4PQ7 A;  5E5R A;  1H4N A;  3KOI A;  5E5U A;  1TBT X;  3M2Y A;  1RZE A;  1UGF A;  4Q6E A;  1T9N A;  9CA2 A;  3V3F A;  3P3H A;  4YVY A;  3V3H B;  3KS3 A;  5E2M A;  4R5A A;  2WEJ A;  4L5W A;  3S75 B;  4QK3 A;  1ZGE A;  1LUG A;  4Q06 A;  3M2N A;  1FSR A;  1RAZ A;  1LZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...