3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
3UO0A 3NKQA 1KH9A 2W5RA 4FDIA 1AJCA 4GTXA 5IJSA 3TG0A 4UORA 4NWJA 5DLWA 5LQQA 4CXSA 3NVLA 3Q3QA 1ALKA 1KHKA 3A52A 1P49A 4LREA 1O99A 4LQYA 5GOVA 3DPCA 1KH4A 3MK2A 2ZKTA 4GTZA 3UN3A 4N7TA 1ANIA 1AJAA 4KJGA 3DYCA 4MHXA 3B5QA 3BDFA 4GTWA 1N2KA 1SHNA 3WAXA 5L0KA 5C66A 2IFYA 1URAA 2W5WA 3CMRA 3M7VA 1O98A 4GTYA 3ED4A 3BDGB 2QZUA 2IUCA 4CXUA 5DLTA 2XR9A 1ELXA 3WBHA 5L0BA 1ALIA 1HQAA 1K7HA 4LRBA 1EW8A 2W5XA 4MIVA 3M8ZA 5K4PA 4LRCA 1N2LA 1ALJA 3TWZA 2GA3A 4ZG6A 5LIAA 5EGEA 4CYSA 3TX0A 1AUKA 3MK0A 5GRRA 1E33P 4LRFA 5HRTA 3WAYA 1AJBA 4UPIA 4YR1A 1ALHA 1SHQA 2W5QA 1HDHA 5AJ9A 3NKNA 1KHJA 1Y6VA 4CYRA 4ZG7A 3NKRA 1B8JA 1ED9A 3T00A 3NKMA 4LRAA 1EW2A 5L0EA 3IGYB 4ZG9A 3T01A 2GSNA 2G9YA 3IDDA 4UOOA 1URBA 4ZGAA 1E1ZP 4KJDA 2X98A 2W5VA 3UNYA 2GSOA 1EQJA 3IGZB 5IJQA 5KXAA 1EW9A 1KHLA 1KH7A 1Y7AA 1AJDA 4KAVA 5EGHA 3MK1A 4UPKA 5TJ3A 1ZEFA 1E2SP 5DLVA 3BDHA 3UN5A 2W5SA 3OT9A 1EI6A 4LRDA 4LR9A 4FDJA 4KM4A 1ANJA 3UN2A 4NWXA 1ZEBA 2W8DA 1E3CP 1FSUA 4CXKA 2IUCB 1ED8A 4UOPA 2RH6A 2GLQA 1ZEDA 4KAYA 4MY4A 4UPHA 4UPLA 1HJKA 2W5TA 1ELZA 3T02A 1EJJA 4LR7A 3SZZA 2VQRA 2W8SA 4QAXA 3SZYA 3WAWA 1KH5A 5LRMA 3BDGA 3NKOA 3NKPA 4LR2A 3M8WA 2GSUA 3M8YA 2D1GA 1KHNA 3E2DA 2XRGA 2ANHA 3KD8A 4LR8A 4TN0A 3WAVA 1ELYA 5INHA 5LRNA 3LXQA 4B56A
chains in the Genus database with same CATH superfamily
3UO0A 2CQ3A 1QDUB 2JEGA 5D4OA 3HD2A 4OJ1A 3PX6A 3PO5A 3IS9B 3QMQA 3BKTA 1DTTB 3QPIA 4UORA 4O3QA 3DOKB 3OSPA 1RGVA 5GMKa 1S1TA 2QL9B 1GH8A 2LYVA 3DLBA 2JVOA 5AXNA 2E5JA 4OYZA 2KVIA 1M90T 2MSSA 2NYHA 4IKAA 3KLEB 4IRDA 3E8OA 3T6JA 4J9RA 2APOA 4ZDNA 3CCJS 2CPZA 3S8SA 4ZVFA 2BJ8A 5MLCV 3PIOQ 3EYZA 1T05A 3CC7S 4E0DA 1X4FA 4X64F 4LBHA 3MFIA 4GC6A 3POTA 4HH0A 1F3VA 1U0HB 3MEEA 4OIXA 4OL8A 4HR2A 5D3GA 2BQRA 2GAHC 3HMJG 2V68A 2VG7B 4G1QA 3IA0A 3UCZP 4YOEA 1XJWB 5KFEA 4H4OB 1KP6A 2D3ZA 2PEHA 3ED4A 5KFVA 2N82B 1O5JA 4X4SA 1EQMA 4M63A 2WW8A 3SV4A 4ZJLA 4NA3A 3PW7A 1FNOA 4JV0A 1YK9A 5KFZA 3TVYA 4TXSA 3OFGA 4A8YA 4USIA 1ZS6A 4NLVA 1HW9A 3TW0A 2J7WA 3NCQA 3ILJA 1ZPWX 5AXKA 2Y9HA 4O44A 2XS7A 3CJTA 3J7A1 3IBCB 4ZVTB 3M8PB 4M5DA 4A8WA 6AT1B 5EHHA 2ADCA 2DR7A 2MKIA 3AA9A 4D3GA 2BE9B 3DLEB 4FPRA 4EI2A 2W7OA 5FJ4A 4C4WA 3FRZA 2HW3A 3IBWA 2IM0A 5J2PA 2CJXB 3RB6A 2CZVC 1E33P 1Q8BA 3D1QA 1PBAA 3M32B 4NLXA 2A1BA 4RW4B 4CO1A 2RHQB 4DL7A 4CLPA 2ASJA 3EICA 1JLFB 1FJCA 1IM4A 3ZZPA 2M8HA 3J7YU 3RAMA 2ZJQQ 4ZPTR 2DXEA 5H9EJ 1FNMA 3W2VB 5ETLA 2CKWA 2HQCA 3OTOJ 1GMWA 1JJHA 2V2ZA 5B09A 3GIKA 2VPWB 2VFVA 2D1CA 2MLXA 2XG8A 2J8SA 1V3ZA 4ZPAA 2PFDA 4KC5A 3KLFA 1SV5A 5ETNA 3H4DA 2I1RA 1FRJA 1SJRA 2IM2A 3GCXP 3MURP 3NNHA 4MIBA 4RNOA 3VGSA 2AZ1A 2JJ4D 3DN9A 2YNIB 2Z8QA 4QOTA 4AT1B 2UUCJ 2QFJA 4ES3A 3P45B 1NB7A 1WACA 2OMOA 1YI2S 3L3CA 1S1UB 1Y4ZB 4QU7A 1SB6A 2EG1A 5D4PA 2K3IA 4ZPWR 3PYEA 3GJQB 2FHMA 2V67A 4FVMA 4I2PB 2ZHAA 4OZ0A 5FDLA 1MN9A 5IZHA 3R5CA 3Q23A 3AY0A 2DGWA 3WHIA 4DXLA 1TKTB 1ZM2A 4DG1B 3Q89A 3O5TB 3TEGA 4QR0A 2W7PA 2IUCB 3GU0A 5DQIA 4UPHA 2JX2A 4DWIA 3M8SA 2IBOA 5DG8A 2HWTA 2X1FA 2VDHA 3JYTA 4U7CA 3M2UA 2Z58B 2BE2A 3FZ2A 1AA1B 3DDNA 1XQIA 1GNKA 3M2VB 1EZZB 1R6YA 2Q1LA 3M4XA 2UU9J 3VHQA 2FPHX 1FFWB 4OYXA 3M8WA 5CD4H 2D1GA 1A7GE 2HBQB 3MD3A 1FXLA 4LR8A 4RKUC 5KTQA 2C2EA 2XMJA 3GIJA 1BQXA 4OYIA 3Q22A 3RAXA 3A3PB 2B4VA 5IXUA 4RUAA 4O0NA 5K14A 5LSOA 4DV1F 4KIAA 3TANA 1KH9A 2LEPA 1DY3A 3I5BA 4WK3A 2EC0A 1N54B 2DCUB 4X4RA 2BBEA 5KG0A 4IH7A 4NWJA 1U25A 4FNHA 3W8GA 3ZTRA 5HROB 5THWA 2BJ9A 3NGDA 2CQ1A 1K47A 1GMVA 3LP2A 2PIIA 4DQRA 1Z2LA 2V9KA 3KHGA 4AQYJ 2MQMA 5I3UB 3HKWA 1W2BR 4LQYA 4WIIA 5A0YB 5FD1A 1KQGB 2CWKA 3AD7C 3ENVA 3UQSA 5KFFA 4ZLLA 3JXOA 4DR7F 1UFKA 1KR4A 2BYCA 3GLJA 3MEDB 2RKIA 3N79A 3ONQA 1JLBA 3OQ2A 3PYGA 2KFYA 4Q8FA 1AW0A 1ANIA 4GKKF 1WORA 2BOAA 2F9DA 1EJ7L 2AJFE 2QMUB 2OFGX 4X84A 3C2PA 1N2KA 2AGPA 1WF0A 4DFPA 2KRRA 3NOCA 3HM9A 1FESA 2J6UA 4TU7A 2RH3A 4LF9F 3A13A 2HS0A 1O98A 5HATA 2CJYB 3CSKA 1JXLA 4RNNA 4G6VB 4Q7AA 2XB2D 3H98A 4TKTA 4Z7YA 3HCXA 3M8RA 1SC4B 1SJQA 4WE1A 3NGRA 5M2PA 1QJHA 5H9FK 3CCQS 5HP1A 3MECA 4RU9A 1BXNA 2O67A 4CLKA 1KEKA 2RU3A 3PRVA 3ZTQA 3TUJC 3QGGA 4C11A 1ZTWA 4FYWB 3MM5A 2E5GA 2B3TB 2VKZG 1URNA 3PRDA 1Q0NA 2I2YA 3B4DA 3HFKA 5KFGA 1K1QA 3NBPB 2YKAA 4ED1A 2V63A 2OPQA 2RIJA 2XS5A 1V3RA 2CQ4A 2QLBB 3MXHP 2K1RB 2J9DE 3D9BA 3FKBA 1WNEA 2RD5C 4WFXA 3KDOA 2BW7A 2A0FB 3BGOP 3LOUA 1CEZA 2W5QA 4NA2A 4B9MA 4C0BA 1H98A 4QYZK 4MKVA 1Y6VA 2XMTA 3ETOA 4ZG7A 3DYAA 3MWBA 1M5PC 4OX9J 1V6HA 3KDNA 5LOQA 2J9EA 4V1Ak 2AD9A 1HQEB 4USVA 4AXIA 4I2QB 1RBLA 4Y0FA 2WONB 1HNWJ 1NZAA 1RTDB 2UUAF 4OV1A 1RT2A 2ROEA 4ZVSB 2KRBA 1AFJA 2OI2A 3DHXA 3R3TA 4EWTA 3V4IA 5IC6B 1VRUA 4DCJB 2ZC3A 1IBKF 3CIMA 3GR0A 3UNYA 4H4MB 4NCGA 3PV8A 2F9JA 1RTHB 3JSRA 4NLTA 2E9TA 1L3KA 4GMKA 1ULRA 3HVWA 1N8RT 1RWPB 4ERDA 4PRFA 2YH1A 5HQLA 1Y7AA 2R2SA 1MU2B 4F8RA 3CJ2A 3DOMB 1TUGB 5JUMA 2R7SA 2MKSA 3FBFA 3KLIB 2LP4A 6FD1A 4IH6A 4IFVB 4LSNB 5L39A 1EB0A 4HTIA 1ROFA 4ECRA 2NZ4A 5K4PA 3OR2B 3BSOA 3V6DB 1XR5A 3EXCX 4R8UB 2AWZA 4X4TA 4DSLA 2VD3A 4DPOA 5T7LB 2EEYA 4QW8A 1Q86T 3CVKA 4B3MF 1SQEA 3AJ1A 3D6TB 3OPKA 2YKOA 4K4ZA 2HHXA 2V0NA 4CLYA 4DFKA 3K8WA 4X2BA 1HD0A 1HKAA 5GAGU 4DR5F 5D15A 5DRKA 1VRTA 2HZCA 2VBZA 2Y3YA 4OI1A 3MR3A 2EBEA 2FVRA 5IV3A 2KL8A 4O3NA 4ZIVA 4WIQA 3AAWB 3GIMA 2LU1A 4OI2A 4HT5A 1FFSB 2ILZA 3VCDA 2VQFJ 1WC4A 3EGWB 2YBVA 2MMYA 1RA6A 3M9MB 1SKRA 4YR0A 5KG2A 1SJ3P 2XHWA 3IXQA 4F67A 1RTZA 2BRLA 1IKWB 1OPIA 2KI2A 4O3SA 4I4BA 3MCMA 3NKQA 4B56A 2W24A 1GK8A 1RT5B 4K5SA 2HAIA 2R4FA 5DM6Q 1Z1ZA 2AYMA 5LSRA 3QO9A 3CCRS 3R1HA 4DV7J 3BDEA 4WYWA 3SQGA 1TVRB 2EI5A 2Q43A 4EU0A 1XNQF 2RVJA 1DQ8A 2VL1A 2YWEA 3PR5B 4C8KA 1YSJA 3I56S 4URGA 5T41A 1GTHA 4C3MA 2J5AA 3DRPB 2CZ9A 3MCNA 4MK9A 4PAAA 1GXUA 1LNQA 1YJTA 3HHLD 1OY9A 2XMAA 1KNZA 1VIOA 2KFZA 2DNPA 1B7YB 4QWCA 1GEHA 2C2DA 2UVWA 2NPIA 3BB5A 4N7TA 5D77A 2KH9A 3DYCA 3R5DA 2RRAA 3MUVP 4GTWA 4B08A 2WK4A 3TOQA 4TU9A 1MSWD 3WAXA 4ZVHA 2DRBA 5J2NA 1RISA 5D0GA 3SFUA 4EO8A 4EGLA 1FK9B 2H9ZA 3KLGB 1H6KX 3CB4A 2WB1D 3SQOP 2K8GA 2M4MA 1NDLA 3CJ8A 3IWLA 5B0FA 4FS2A 3DLHA 3M1VA 2CNOB 2X1GA 3VAGA 1S9GB 1UJ6A 3NAHA 1HI8A 1R3NA 2NLWA 3ILOA 4HDGA 1M1GA 1X60A 1VLOA 3DRSA 4QYRA 4NE9C 1S1XA 1G3OA 2R9LA 3GG0A 3IM8A 4B02A 3CCLS 1K8AT 4DSEA 1TZ0A 1JWWA 4EUVA 1NH8A 1AUKA 2HG4A 5HO4A 3LW5C 4OI6A 5GAEI 3BZQA 2A6MA 1T9XA 2N4DA 1CLFA 4KO0A 1EAYC 1LW2B 2F8HA 5IC4B 4N8NA 4ECUA 3R6GB 3W1YC 7FD1A 3CDWA 1GMUA 4KGMA 3BDPA 1N52B 4O3RA 3FJ2A 3D1HA 3GONA 4O3OA 1RT1A 2Q6BA 3IR5B 3IAM9 1FJGJ 1T3NA 4DR2F 4C8LA 1T9WA 2VG5B 3VQSA 4K4WA 3NGKA 3FBEA 1F0XA 4OHWA 3SSQA 3SCJE 4DFJA 2ZWOA 1TKXB 3ET6B 3PHTA 4F26A 3BGLA 4K4SA 1LWFB 4UUWA 1RACB 4PQAA 2VBWA 3N6MA 2XULA 3CCUS 4NLUA 4DV3J 2IM1A 4KGKA 1VJQA 3IGZB 1R0BG 4J9KA 3HSDA 4J9LA 4KB7A 2FHKA 2ZNYA 3TR5A 3TZWA 4ZVEA 1JIHA 3CDUA 1MG7A 1ZEFA 4DR7J 2ZH1A 4F0HA 4IH5A 3UN5A 2MLYA 3R5BA 3WX4A 3J81Y 2F63A 1Y3KA 3QT5A 2AGQA 3M30A 2V4JA 1EI6A 2XHCA 3DXBA 3RRGA 3OSNA 1YHQS 4ZN3A 3OXGA 3N4WA 3VV2B 3CCZA 1O51A 4DV5J 2E9ZA 3KJQB 1N0VC 3GJTB 2YKQA 1QSSA 2HMIB 2CJAA 3NWGA 3Q8UA 5KG7A 2L9WA 4CT8A 2KM8C 4UTGA 1VC0A 3OL9A 1VBZA 3VTIA 2EG2A 4NOHA 2GW8A 2YNHB 3BGUA 3MTKA 1FXDA 4X4UA 3LH2S 3FEZA 2VUGA 4WP3A 1T03B 2J7UA 3HSZA 1C0UB 4LBIA 4NYOA 4M1KA 3BDGA 3NKPA 3DLGA 1JLAA 3H2LA 1FX4A 4PG7A 4CLFA 1HNVB 2IVMA 4AFFA 5B0BA 5DQHA 2BJDA 4B3RJ 3QSYB 4NEYA 1U8SA 2EK6A 4DUTA 1ZOTA 2C3PA 3MDFA 2WVFA 4OZ3A 1LWCA 1A9NB 2V8PA 6FDRA 2IJNA 4M94A 3DRXA 2W5RA 3BYPA 4FDIA 3MR2A 4KFBA 4LSZB 4DV0F 4B3SJ 1C0TB 3TG0A 4N41A 4ZCLA 3ZZ0A 1R31A 3LO3A 4M5LA 5CQGA 4WCEQ 2KG0A 3HP6A 2R2TA 3THVA 2RRBA 3KG4A 4F4YA 1UA1A 2VFUA 1NJWA 4DSFA 5KFUA 3VAIA 2O3DA 1H38A 3OL8A 1O99A 2UUTA 1E6VB 4RUHA 5J2QB 4YDDB 4J9NA 1D9DA 3D3CJ 3HFVA 4A8OA 3C8YA 2I0XA 4I1TA 2DPIA 5I4MA 3OFEA 2C3YA 3U1MA 4JI8J 2M7SA 4DR4J 1G7CB 2N7YA 2RUSA 3H7HB 4J9QA 1IKYB 5GAGI 4ED3A 1NHUA 2R7VA 5A76A 1YZ6A 3ZZZA 4IQMA 4EZ9A 1L3SA 4F02A 4CXKA 1RTJB 2E1AA 1BHNA 1DQ9A 5E5NA 1JLAB 1X8DA 4DU8A 3GV7B 4ZVOB 2B51A 3BDGB 1NKCA 1CC8A 1V5IB 3EXYA 3IWXA 2XY5A 3AXKA 1XNQJ 2YNHA 4KAIA 3ZO7A 1Q5YA 2GO9A 1ZM4A 4ZPBA 1HQAA 5HQMA 2B0GA 2AX0A 2FQQB 2B4PA 3L9ZA 4FF3A 4ECWA 1Q95G 2OUGA 3QQCD 4YS2A 2QSFA 2OH2A 2UXCF 3Q2TC 2XO6A 4IQXA 1S6QA 1SVDA 1VQ6S 4X65F 4DV6F 3CULA 2V4JB 2BRKA 2V8DA 1X7VA 3H2VE 3CTRA 3NRBA 1H7WA 1MW7A 4TLQA 3TUPA 4PXBA 2VH7A 4TNOA 1CJTB 3MHYA 5A6WA 4PUOB 2J76E 2HVIA 5DG9A 3EX7B 2UUCF 2QYGA 1YG0A 3BN7A 5SUHA 2FVCA 1WOSA 3MAQA 1N48A 3IG1B 3I6PA 4JI2J 3DKDA 4JP8A 2IJRA 2YPZA 1N6QA 4U96A 4CH7A 2CNKB 5LMUF 2CQCA 1ITPA 1RDRA 1XK8A 2CPYA 4L76A 3T00A 3NKMA 3IGYB 2X51A 1R8HA 2DH8A 1N88A 3PY8A 4MK7A 1TKXA 5CHCB 2ZVSA 1EETB 3JAMU 2E66A 4A8MP 3CCMS 1TFYA 2WRMA 3BJYA 4ECVA 3HZEA 2VG5A 4OYBA 5T14A 2X98A 4ANEA 3G82A 3CNQP 4ZN1A 2GSOA 3OW2R 1DAXA 2YKNB 4G1PA 4K50A 2YWWA 3KK3A 2VG6B 3VALA 2E1RA 3T6BA 1N56A 2GO8A 2FJXA 3QIDA 1U7LA 4FF1A 1LW0A 3F73A 3BV8A 2V4RA 1IQTA 2W5SA 3QT7A 4U7UD 5DQGA 1NNDA 3C16B 1LWEB 2ATCB 3CW2C 1ZEBA 1FRHA 1LXNA 2DY1A 4A4JA 1OQ6A 2GGPA 1E3CP 1RU1A 3P4UB 1WEYA 2KT5A 5HANA 2RH6A 4WFAQ 1S79A 1N36F 2Q6CA 1S1XB 2QV6A 4PXCA 4CLWA 2JLEA 1F9EB 3QATA 5ETMA 2ERRA 2KFNA 5F8NA 3T02A 1NPKA 1WHVA 1ZA1B 3CWJA 1BMQB 3MZIA 5E3PA 4F2SA 1SKSA 2VA3A 3GG1A 1Q8KA 4ED6A 1N33F 3HD1A 4BDPA 1IQZA 4HKQA 2HQFA 3WAVA 4NPOA 2DGTA 4OHZA 5KOWA 1NKEA 4PKDB 1MWZA 4JI4F 3ILIA 1RBOB 4AL5A 5J2NB 2ZC4A 5INHA 4LF2A 1U8WA 2ZH3A 2HK3A 2LXUA 2XO7A 9ATCB 2HHTA 3CCES 1WELA 2FZGB 2XTJP 2PMWA 2GMLA 2V8HA 2E1MC 4ED5A 3G8SA 1WKJA 1RT4A 1WWHA 1X0PA 1JJ4A 1KHVA 4ILLA 1LKZA 5LQQA 3A8KA 2IDEA 1S72S 4UQTA 2VC0A 4KYZA 1KHKA 1S49A 3W5YA 1KHWA 3N28A 1TKZA 2F1FA 3NNAA 4PZVA 2BOPA 4Y00A 5GOVA 1TVRA 4QPTA 2W9AA 4EEYA 3SQGB 2ZKTA 2JEFA 4CO2A 3P6YC 3UN3A 3QO9B 1HI0P 1BQNA 2PN6A 3QJLA 4KV8A 1RT5A 1TK5A 2UXDF 3BYRA 3C6TA 3I82A 3D2WA 2MQLA 2KN4A 4F4WA 5L0KA 2F40A 4FXVA 2E5LF 1EQJA 1L3TA 2RE1A 2R8JA 2FHJD 4ZITA 3IP0A 3CT9A 5DGBA 2K7KA 5IT9U 3I4PA 3H25A 2MKCA 4DHVA 2P9EA 3MEGB 2EBGA 2CVEA 2YNGA 4YUDA 5IS2A 1OMSA 4WZMA 3ZZRA 3KTQA 4DMZA 2IFXA 1VRTB 3EM1A 1R8AA 4CNZA 4KHPJ 2R2UA 2VDIA 1R0AA 1DURA 1N5TA 4CM0A 1JXEA 1YQHA 2PI4A 2P8IA 3O1LA 2DIUA 2NUUG 2MXYA 2XWXA 2CJQA 2ABYA 2RILA 2ZZMA 3A3NB 4J9UE 2AEJA 2CJ9A 2W01A 3A12A 2O01C 3P5TL 4R8UA 1NM2A 1T9UA 4NCAA 3QJPA 3KJVA 2ZH6A 3BN4A 4O4GB 4CYSA 1YRXA 2I5JA 2RT3A 3GJSB 3R1LA 2CZ4A 4IFVA 1DRZA 1TUWA 2HQDA 3GSIA 3KLIA 5A2QY 5HMXA 1RI7A 2DGVA 4C8MA 1S9FA 2KZZA 2DHGA 3QLHA 3LAKA 3V81A 2C28A 4LF8J 4KKOA 3UDLA 2ZH7A 2JHEA 1SKUB 1SHQA 2AX1A 2FC8A 3H0PA 3M6XA 1VK8A 1OO0B 1FDDA 1RHUB 3MPWA 1QSLA 2CADA 3W60A 1XEZA 4B17A 4DR1J 4ECYA 1RHKB 2B6AB 2HNYA 1ED9A 2DEJA 3R2CJ 4NLQA 2NSCA 2XGQA 4DV7F 1W25A 2CG4A 2AIRB 3GFXA 3L09A 2WONA 4QR1A 4LF9J 3R7NB 1VMBA 2YWGA 2CAJA 4J90A 1HBOB 1HQ2A 3DYAB 2GQQA 3S7RA 5IV4A 4CH0S 1CULA 2COLA 4W4MA 3W64A 1YRUA 2DK2A 2MLZA 4WYLA 4F25A 2E1CA 2GCFA 4UY85 1NRKA 2Z4PA 1AJDA 1Y5LB 1TMMA 2GIQA 5B0CA 2HNZB 3GIRA 5KFJA 2EPIA 3R5GA 3OVAA 2G9OA 1BY9A 3B6BA 1T9VA 1URRA 3MAAB 3BKUA 3WIUA 5DG7A 2AJ4A 4KPCA 3SIPB 1FFGB 3NXZA 4L3NA 2W1BA 3BR9A 3F56A 2ZD1A 5HVFA 1KOHA 2DHAA 1OIAA 3CCWA 2CFXA 4RUCA 4C11B 4B3MJ 2W2NP 1VQ9S 1HLWA 4DR5J 2GFFA 3B78A 1XMQF 3V6JA 2POKA 5HN0A 3CXCR 4P72A 4NEZA 2J9DA 2W8SA 2Y1RI 2QLJB 3TNVA 2IAJB 3K57A 4PQUB 4MKBA 5LRMA 4L73A 4WXOA 2E5HA 5KFXA 4YN3B 1S57A 3LALA 5HL7Q 4P71A 2FJVA 3NKOA 3QJJA 2DHSA 5K8PA 3T3FA 3W2WA 1UMJA 3ITHA 1FKPA 3IGVA 5HVGA 4BWMA 4XO0A 2EFPA 2MZSA 2BABA 4Y2AA 5JXSA 1B70B 3H20A 4ATNA 3OVSA 3OUYB 2HGLA 1OPZA 4OX6A 4JB8B 4DS5A 2I9SA 2QL5B 1B7FA 1N0UA 1JLBB 2HIYA 3FSYA 4NXNF 2HHVA 3MEDA 3M2RB 4Q2MA 4NLSA 2QE5A 1T0TV 2B8PA 2RNEA 4ICLB 4DJBA 1QSYA 3UD4P 1A6LA 1X4HA 2G13A 1FHTA 3FEXB 2BJ7A 4HTJA 4ZJQA 4RW6A 2D7SA 2OGUA 2CQPA 2AF6A 4R25A 4DPXA 1HNXJ 2M8DB 4LF6F 1CJUA 4LIWA 4RW6B 2E9RX 3WX8A 2VC1A 1Z4UA 4F0MA 3MM6A 3TAPA 5HROA 1VQLS 3MK2A 4DL3A 2VFRA 2ZUAA 2LVWA 1QD1A 2WVCA 2EWHA 3JTOA 4DCPB 2B7CB 2PDAA 3W8PA 4NRTA 3CO0P 2QMWA 3BDFA 4FF4A 2HS3A 5SZTA 3VVTA 4X66J 4TVAB 5B0AA 4P73A 1FKPB 3CMRA 3P96A 3W2WB 1S7HA 4PPDA 2H4YB 3RUBL 5DDOC 2EVZA 3KHLA 3RRHA 1OSDA 1U2FA 3D54A 3W66A 4B3OA 4JV5F 5E41A 3CD6S 3KLHB 4L72B 4FN5A 3W9HA 4NRUA 4USTA 4RNMA 5ETKA 4FBTA 4JI3F 1K0VA 3NKNA 3NGSA 2LA4A 4JBCA 1K7HA 4NZ6A 4XPEA 3H5UA 3BF4A 1ZETA 1XNRJ 1AJBA 3X3UA 2LDIA 4NXMF 1FJGF 3PJWA 1NK6A 1M5VC 2AJQA 2MZQA 1RAHB 1CVJA 3S6EA 4DN0A 1FNXH 2B9YA 4PWDB 4IRCA 5FDLB 2Y1JA 1ZTTA 2CYYA 4P52A 2XLIA 3VWSA 5KFTA 2IPOB 2IYIA 1TU0B 3AXMA 3LGNA 4FYXB 2RQCA 3J81U 2QA4S 3HPOA 1WTBA 1U1OA 1S1UA 4B3TF 5HRTA 2I38A 3AFGA 1AJAA 3GFZA 3CC4S 1HW8A 1B0TA 3K89A 3JSMB 2BJ3A 3ZNJ1 5JVHQ 1CULB 1X9MA 1XERA 3NKRA 4XPCA 1SL1A 1C4AA 3K58A 3IAS9 1PSDA 4OQJA 5ETVA 1CSJA 4FP9A 4PG4A 5J1PA 4A46A 3W61A 3JSMA 1Q8LA 1TV6B 1H72C 3KFWX 4MJKA 2V8VA 3KLFB 3IRWP 1I94F 4WZQA 4QJVA 2AKWB 4YR2A 4DV1J 3DU5A 3BM7A 5KG4A 3PJ9A 2B6AA 2HNYB 1IN0A 2BXJA 3PDNA 3VR1A 2VOOA 3PW0A 1WOOA 5E0OA 2NPFA 4QIVA 4HHHA 4OMFG 3W2VA 4PWDA 4JI5F 4B9LA 1KHLA 1AUDA 3EDQB 1YGYA 2U2FA 3CDBA 4KKOB 2EFQA 4USKA 5GMDA 1IBLF 5KT4A 3AOBA 3CMES 4Y34A 3GJRB 4DR4F 5BR8J 2LEAA 4ITSA 4CO5A 4Y2IA 2NQPA 4YB6A 3FBCA 2QT7A 3TJ8A 5DLGA 2DR6A 3KJVB 3AD9C 1PO6A 1RCXB 3KKFA 4NA1A 3ZC4A 2C3MA 3G6VA 3G71S 1D0EA 1FJEB 3D0HE 2IRUA 5D0RA 5IWAJ 1XTZA 3KLHA 3W5ZA 1N5QA 3MCSA 2CXEA 2D3OR 1ZEDA 3AOAA 4B3OB 1XC9A 1QE1A 2Z56B 4CZCA 1R0AB 2CRLA 2MKJA 1GTEA 1M5SA 2H3EB 1S1VA 3L7UA 1U2CA 5BJRA 2N3LA 2WVEA 4WBFA 5HI7A 2XMMA 3SCKE 1VQNS 3AD8C 1V9OA 5F8MA 4DZ6A 1QAYA 1E6YA 1HNIA 1U09A 1WJ9A 2BKOA 2DGXA 2V2VA 3ENQA 2R8GA 1KVIA 2XGPA 1ELYA 3AHPA 2KJVA 2QA2A 3MM6B 1KVJA 5LRNA 1CJUB 3LANA 3NEKA 1PIEA 3GPAA 3PVXA 4DV3F 4KV8B 1T8EA 4NXMJ 2R8KA 4L3KA 1TK0A 1FRKA 4LF6J 3FGVA 3QBCA 1X9SA 1T05B 1KRPA 1HD1A 5IJSA 4ICLA 1LXJA 3AQPA 2FJAB 2XEXA 1KOOA 1RKIA 4FXWA 4BWJA 3TEHB 1TKZB 1AROP 3H2UB 2ACMA 3SDEB 4YB7A 1TK8A 2XCAA 4GO5X 1HPZB 3OHBA 2ZOMA 3DOKA 2FDNA 1IUJA 3OUYA 3EPGA 3VQTA 4HYKA 4MIAA 2DHHA 3ITHB 2FGOA 2DGOA 2KXFA 3EWGA 1UVNA 3UPFA 1WDTA 1D8YA 1UKUA 2OEMA 3C46A 4MHXA 2F5GA 3BPSP 2FB0A 3WQPA 1RT6B 1SUQA 3QRRA 3AQOA 2ZZTA 4USMA 3PX0A 2RAQA 2FGCA 4LFCJ 1RAGB 1X4CA 2HYIB 1HMVA 1N33J 1KTVA 1NK9A 2WHOA 1RAFB 3HFZB 4Z7CA 4K4YA 1I6JA 1SIWB 4DL0C 3CC2S 3RB4A 2CQIA 1ELXA 1RWUA 4ECTA 2IC3B 3L95X 3FVYA 1GX5A 1JLGA 2YTCA 4IFYB 3Q8SB 2A3JA 1DFDA 3FCWA 3MAAA 2WOMA 3S1TA 3EZOA 3CJ4A 2FVSA 1Y5NB 1ALJA 1SJ1A 4OI4A 3U1LA 1FA0A 1F2HA 1FE4A 3C16A 1GX6A 3UVJB 5GRRA 4I7FA 1DHMA 2G1DA 3B54A 2XYHB 2HVEA 1HBOA 4LRFA 2YQ3A 3T1YF 1Y0HA 2HPUA 3RBDA 1FVSA 1XR6A 1ZAWA 2PI5A 1WTFA 1LW0B 2HLUA 3AODA 3BGRA 4OI3A 3KK2A 2FY8A 4G65A 2J6TA 4KH0B 2YH0A 3RBEA 2RS2A 3RAQA 2VG6A 2G0JA 4UOCA 4XAKA 3IGNA 4CYRA 3UDCA 5KFSA 2QO3A 3HVAA 2KXHA 4OZ5A 1UPPA 2XQCA 2AMCB 5LSLA 1N34J 4UOFA 3HT0A 4LRAA 1EETA 3Q2SC 3T1AA 1MNEA 2KT2A 4FNIA 2D9PA 3SCIE 3PKMA 1JLQB 4F7VA 3N0VA 1S1WA 1L3UA 4C8OA 1FWKA 3OLAA 3W9IA 1WHWA 1X0FA 2JC1A 2WSEC 3OTBA 2HIQA 3CJ5A 2I5JB 1KKHA 1P9YA 1OYDA 2NXUA 3LTOA 4HL9A 4I64A 1PJ7A 4OLOA 1YBUA 2MQOA 5I3QA 2FJWA 5IJQA 1CS4B 4YQWA 5TJ3A 5DLFA 2SXLA 2QSWA 2BVZA 1GT8A 4WTOB 5CXTA 2ZH8A 2P5VA 4PUOA 4C8ZA 4NLYA 2UXDJ 4NLOA 1BD6A 2XYPB 3MPUB 4DCOB 4ZIWA 2HFUA 2W4CA 1PILA 2BANA 3IRXB 4KGZB 4B9NA 1LFWA 1PG5B 1HA1A 1RLCL 1AB8A 2IDLA 2YNGB 3D68A 3LUYA 1FI4A 3WBHA 1BWVA 1SJFA 2C2RA 1X9WA 2NZCA 2NR0A 3Q83A 1RAIB 4P7TA 2NREA 4OV6A 1R8CA 2W4PA 5GVQA 3OTDA 4ZP8A 5DZ6A 2GJ2A 4NYPA 2QTWA 4DX6A 1FEEA 3V5RA 3FSXA 1QUVA 1AT1B 2DGUA 4QCLA 2JLGA 4MT1A 4JV1A 2GSUA 3DGPA 4DUYJ 5HLFA 1DZ5A 4JI5J 1KHNA 4K4TA 2UZAA 3KK1A 2MB0B 3PO4A 4ELVA 3VF0B 4GTZA 5KG6A 2KKHA 4N76A 1Q78A 2QG9B 3QFHA 4B9UA 1GQEA 2GVDB 3WC0A 4WF9Q 2KU7A 2R7UA 3NLCA 3IO1A 1PC5A 2IJFA 1LEOA 3LA0A 2HRTA 4TYBA 3QT8A 1ZA2B 5A8WB 1I5OB 3NGTA 1SI9A 3VAHA 1RT4B 5DLWA 3RW7A 1E6VA 3AB2B 3Q3QA 5KFRA 4ZLNA 1X4GA 2HHWA 2DRDA 4M5MA 1WC6A 1NK7A 1FEHA 1VOMA 4TU8A 4B3TJ 5F8LA 2ASYA 2LFVA 2A2CA 2RHSB 4WU2A 4Z2XA 4ZMMA 2UV8A 5AJ3F 4IUFA 1WKKA 2YWHA 4AXJA 2BE7D 2EW9A 4IOAQ 4M8LA 4KFBB 1NHKL 3OR1A 4P2XA 3KXDA 1JMTA 3OLBA 1OS5A 2LCWA 3O3LA 2XNRA 2RS8A 2VJVA 4ES1A 4J9VA 4IG3B 2GA7A 2ZDOA 4KHRA 5A8RB 3D5MA 5M2UA 2AW0A 4ID5B 1KLMB 3VGVA 5L38A 1HNVA 3PACA 3ULHA 3M7VA 1F9FA 3C14A 4MMOA 3T5JA 3D28A 3H42A 1SCJB 4RLEA 4LF5J 2DGQA 4F4KA 1XNRF 1C0UA 4NLRA 4CXUA 5KFAA 1RUSA 2MZTA 1YLXA 4DL4A 1IR2A 1T03A 3NS6A 2FJDB 2GIFA 5EX3A 2XR9A 4QWEA 1LWEA 2VB6A 1FRLA 1T02A 1YJVA 2WCXA 2VBYA 5GAHI 2CPDA 4P10A 4ZS6A 3F41A 5G4DA 3OTOF 2P6SA 2HMIA 1K0TA 2V4QA 4FF2A 1U1RA 4YY3J 1UJ5A 5E3RA 4RWWA 5C24A 3PX4A 4F2RA 2PSZA 1RWWB 1P1LA 4QPXA 5RUBA 3TX0A 3KK3B 2F4VJ 3BQ0A 5K8OA 2DT9A 3CJ3A 4F3OA 2K7JA 3G82B 3IMQJ 4NL5A 4JI8F 2P6TA 1YZ7A 5DETA 2F7VA 4LQ9A 2J8AA 1H0HB 2IRXA 5JVGQ 2JEIA 1X5PA 1EIYB 2LXFA 1X4EA 3HULA 2DCLA 1C4CA 3FBBA 4OZJA 4QU6A 3MOZA 1RAAB 2LLZA 1J5EJ 2CQDA 3MR5A 4A8FA 3G6ES 2P2CB 4DI6A 3J7YI 2FLNA 2DNQA 3GCWP 2J0QD 4EBEA 1LWFA 2XMWA 2WB4A 4Q45A 3BSCA 3ET6A 3EGVA 4ED7A 2GSNA 3T01A 2ALYB 2LQ9A 2YXLA 4YEAA 3TJ9A 2HZVA 1CJTA 4MK8A 1I1GA 2E5IA 4C8NA 1NJZA 1KN6A 1RK8A 2X1AA 1HIYA 5H1SV 4M5JA 3RBXA 1WEZA 2HLTA 1PJ6A 3HKZD 3LPYA 1Q16B 1S6QB 1MMNA 1MMDA 1VYAA 4LUBA 3ZFVA 2NSBA 4NI2A 1PKUA 7FDRA 3X1LB 4QYZJ 1RU2A 3UCGA 4KO0B 2Y1LB 2ZH2A 1E2SP 1REVA 2E7XA 4WKYA 2V94A 1U6FA 3MFHA 1TQLA 3GP9A 4OX7A 4ED0A 3M9OB 3MD1A 3R5JB 4BC9A 2CPFA 4A48A 2C3UA 3DRYA 5E3QA 1V5VA 3KYLA 1ANJA 3UN2A 2GQCA 4U95A 5K20B 1VR6A 4H4KC 1ED8A 1WC1A 2EK1A 4CNYA 5E3CA 1U49A 4LMZA 4X4PA 1RWOB 3T9ZA 4NLGA 2B56A 1HBMA 1S10A 1RTJA 3DRSB 3NS7B 1U4BA 1T9YA 4U67Q 2YPYA 3TJAA 4ED8A 3SZZA 3MI7X 1X4BA 5A8RA 3K5MA 2VQRA 2J0SD 3K5OA 3OFFA 1IKYA 4Y6IA 5KT5A 1SC1B 1D9FA 5ETTA 2WVBA 4DX8H 3M1VB 1KH5A 1YX2A 4D3HA 3NP5A 1H74A 4CH1A 2M70A 4ETZA 4NMXA 3M8YA 2HQ3A 3KLGA 5KT7A 4OJ3A 2ANHA 2F65A 5J2QA 5L9XA 4P6QA 3S01A 4X65J 4DV6J 1ZZFA 1AFIA 4LF4F 4ZVQB 1EQ0A 2HFZA 4BBYA 3U02A 2OTJS 4MY4A 1X4AA 4MFBB 5DDQC 3CCSS 4DLEA 2XCPA 1RZMA 3GMGA 4YY3F 2GX8A 4ID8A 1UETA 4J9OA 1Q82T 3SSRA 1GFWB 1NSQA 2OP5A 4UOGA 3E3XA 4XDDA 3D0IE 4GVBA 1JNZB 1RADB 4AUKA 5HMYA 1M1KT 4CYUB 3R5AA 3MR6A 4CM2A 3AB4B 1UZDA 3D6HB 2AGOA 1N34F 1LWCB 2JZ5A 2N3OA 2N4CA 5AE3A 3LWLA 3DPCA 1R8PA 1ZAVA 2XS2A 1D3WA 3DLKB 1JJCB 3DGPB 4NWBA 2C2OB 4RO0A 5BYQA 1ZM3A 4C3LA 1FKOA 2KM8B 1HWLA 4OZ1A 4LF7J 1QUPA 1WF2A 4E2FB 1N32F 3DNCA 4KQZA 3Q0AA 2DR8A 2ZVIA 3DXSX 1Q53A 3E51A 3ICLA 3LGMA 1RB0A 5LJ5Y 5CD4A 1URAA 2DNRA 2C2NA 2QGFB 4CIOA 1CC7A 4CLLA 4ZHRA 4F4AA 4HI2A 1U1KA 5FIIA 5U47A 4HLBA 2GIRA 1UEUA 3I87A 1EARA 3Q8PB 3QRPA 3DOLB 2EFNA 3FQLA 2JH3A 4DV5F 3AOCA 2IBKA 4C97A 4CDIA 4W92B 1YJUA 3LQVA 1EW8A 2W5XA 4MIVA 3M30B 2LEBA 3SV3A 4EZ6A 1PJ5A 3NMRA 2M3DA 1NJYA 4YB1P 3TWZA 2F8EX 1MN7A 4PEOA 4PG5A 3OR2A 1S12A 3D7SB 4XK8C 3CD7A 2VKRA 5D6GA 1O0PA 1TUVA 3Q8QB 3HT3A 1T3OA 1SL0A 5AE2A 2XYGB 3GV5B 4P2SA 5KG3A 1JLQA 4ELUA 2CIMA 3PTWA 4Z37A 1ZZNA 5L0EA 4YHHF 1VBKA 4H4MA 4NCGB 3CIZA 5C2GA 3PW5A 3I0SA 5IT9Y 2D74B 1RT1B 2KYZA 4Q43A 2VV5A 2HFNA 1DBDA 3QWUA 1Y10A 2MSTA 2QYCA 3BO4A 5L1KA 4BHQA 2YY3A 2KG1A 2FHOB 5LMNF 4ZG9A 1BQMB 3JAMY 2G9YA 1DTQB 1LW2A 3GR1A 3BGRB 4K7QA 3KG0A 1NDCA 2RDDA 1VDHA 3MPVA 4DUZJ 2W5VA 1UFWA 1KTQA 3KMSA 3QGIA 3R7BB 1WG4A 3MR7A 4CLZA 8ATCB 3QZ7A 3AA8A 1W2IA 2UVUA 2MQQA 4N5SA 1KWMA 3O6QA 2DNLA 2R7RA 1HNZF 3CJSA 2FJEB 2JVRA 3L4BC 2DXFA 2BDPA 4X4QA 4KHMA 5KFCA 3BKFA 2WBRA 5IT0A 2OPQB 4DSJA 2HBRB 1U1PA 2AJ0A 3IM9A 4FDJA 1OSCA 4A8QA 4B9TA 1IJFB 2HFVA 2AJ2A 4OYWA 5J2MA 2DR5A 2KJWA 1S9GA 2V34A 1Y9OA 2FLOA 3W7BA 3J7AN 1FSUA 4J91A 3PW2A 2DKOB 2BQUA 1HMVB 2UUWA 1XR7A 1U1NA 1HJKA 3BEGB 2V69A 5HP1B 1IWAA 1FK9A 2V8GA 3I32A 4PYAA 5HBMB 3DM2A 4FS1A 2Y0SD 1RT6A 2V9WA 1LK5A 1SPBP 1YTYA 1KFSA 1TELA 1NJXA 1NU4A 1YVFA 2UXBF 1EKRA 2PFFB 4IR1A 4TYAA 4LR2A 2PMHA 1U24A 3JSYA 1SXLA 3KD8A 1VBXA 4ZCMA 4KTQA 2OIHA 3M6UA 3DRPA 4IO1A 1VGYA 3LXQA 1HPZA 1WC0A 5CAAA 3FMBA 3SDEA 3CF5Q 1Z2ZA 3KJNB 3LAMA 2ROPA 1BUXA 4NASA 2E7VA 5LL6d 3T5HA 3QAUA 2RKIB 3M9NB 2YQ0A 2E44A 3F44A 1AJCA 3TUZC 4DQQA 1B99A 2VICA 2W2PP 2XNQA 5A0YA 4N56A 1XMOJ 3G6XA 4KGXB 5EGEA 1DARA 2CQBA 1B64A 1XMOF 3T19A 2CWXA 2WBMA 4LREA 1ELOA 4FYVB 4DV2J 2WSFC 3B8HA 1RA7A 2CUYA 3DHWC 2QEXS 3ADAC 1E6YB 1HNIB 4ZVRB 1TL5A 4FVCA 2W25A 2Z2YB 3KJFB 3GB0A 1OQ3A 3HDSA 5KT3A 3IWNC 2ZM6J 4F4ZA 2HNDA 3GWCA 1HARA 3VZIA 2ADBA 4L6V3 5K14B 3GFYA 3I96A 2Y1IA 2YWKA 1RWMB 1S1VB 4I68A 4DPYA 4Y2CA 1IXKA 3V4MA 1QE1B 2HZAA 3Q86A 4GTYA 5ADZA 1F6TA 3AH6A 4B9SA 2QZUA 1U2RA 3KG1A 2O66A 5GADI 1SIZA 3VAKA 2H51B 3T5KA 2C42A 2BE2B 3V6DA 3M2UB 3ELHA 2GJIA 2AYEA 3OTEA 4OZ2A 1HNWF 1ALIA 4E98A 1VQ4S 4C3KA 5C7PA 4ZCKA 4DQSA 2W4DA 1EX8A 1KS2A 1UP1A 1NCLA 2AZ3A 3DOMA 4MYUA 3WZ0A 4QW9A 4ZLPA 1TKTA 4ILMA 3D6FB 4I69A 2ACYA 3MK0A 3SEOA 4I2PA 3UDEA 3AJ2A 2DNZA 1M0SA 1RCOB 2CNNB 2HRYA 1VRUB 4HI1A 5F0UA 5HK4A 3ZZYA 2AQ4A 2UU9F 3NWRA 3Q8YA 2OKQA 1X31C 2OSRA 1FO1A 3TUIC 3IC1A 1FCAA 2PA8D 3O44A 5F8IA 4YFUA 1IJEB 1TV6A 4J9PA 1S77D 2KZMA 1ALHA 2ZNZA 5KOXA 3K17A 2AEFA 3H5SA 4ZVUB 1NK5A 4DPWA 2CNLB 4M5KA 4XDCA 3CJQA 3I9ZA 1F5AA 1EW2A 3QWPA 3AJDA 1ZM9A 3LGHA 3EPIA 1S0MA 2FIUA 2RDJA 3HK2A 3FDSA 4ZVPB 4NMLA 2MQPA 3QFWA 2IMWP 4HEA9 4NLDA 2HWIA 2K1RA 2CPXA 4Q5VA 1Y3JA 2M2BA 4NXNJ 1FERA 3NBPA 1NDKA 2YQ1A 1UTAA 4CCHA 1RWNB 3MK1A 4AE5A 2OTLS 3MM5B 5F8GA 4UPKA 5DLVA 3EZ5A 1NB2A 4RW4A 3TA1A 3JTPA 3M32A 2G2OA 3WC2A 3RTVA 2D3UA 5IQ6A 4G1IA 5C25B 1J5OB 2UP1A 4KM4A 4HHJA 2DTJA 1UJ4A 1RHQB 2ILYA 3G8TA 3HHLC 2GC8A 3THTA 4Y2MA 2GLQA 1T94A 4QQBA 4O44B 1Y00A 4V19J 4UPLA 5L1LA 3FK4A 4I67A 1EJJA 1FRIA 1HHQA 2XMKA 2GNKA 3NAIA 3LP0B 3RBZA 3LPEA 4MKYA 1U6BA 1J5EF 4N77A 1H2TZ 4WXWA 3TRGA 2HHHF 1P8GA 2XRGA 4H4OA 3TARA 4YR1A 4G1QB 1NH7A 1F3FA 1VQSA 3IN5A 2MY7A 2F4VF 3BO2A 4DX7A 5AJ3J 3RR7A 1UFLA 4CI0B 3H4BA 2NXNA 4LFAJ 3POTB 1G2EA 2G0CA 3CCVS 2OD6A 2HVHA 3BSAA 2DD8S 3W9JA 4GTXA 2XLKA 1U0SA 2L48A 4HHUA 3M2RA 3BQ2A 3CPWR 4WKRA 1N5SA 2KB2A 3BS9A 3EVOA 3I4HX 2X3DA 3K59A 1UWAA 3JS9A 2F8MA 2IIHA 4R0JA 2QRRA 4CRJA 5HVHA 2NCKL 1YBTA 4DL6A 4KJIA 2DISA 2H4WB 4O3PA 2L41A 2OPPA 1N32J 4QIFA 4S0MA 5E33A 3IS9A 1RXOB 2J7KA 5KFNA 4OYAA 5H9EK 3NL0A 2DR9A 5HJYA 5A2QU 4JOUA 4URSA 3FEYB 4PQUA 3B5QA 2IAJA 2QJ3A 2MYFA 2ZWPA 4CLTA 4GKKJ 3RR8A 1MROB 3HO1A 3DC2A 3JYTB 2FTRA 3MPYA 1D8ZA 3UWTA 1FD2A 4IO9Q 3R7SB 3Q8VA 1FVQA 1CJVA 1VLYA 2RQKA 3TQEA 4FBUA 4ECXA 2EFOA 1ZH5A 2IUCA 3IBFB 5LXRA 1VQOS 4DG1A 5EWGA 2ZD1B 5K9FA 4K4VA 2BMBA 4B9VA 5CYMB 3E2EA 1WC3A 3CD0A 1XN9A 5B08A 2W2OP 1PCAA 3ISZA 1RWXB 4LFAF 1HQUA 2JNJA 3OL6A 2GHWA 1IM6A 4OZLA 2HNZA 4IRKA 2GA3A 1VJWA 5LIAA 4RW8B 3QRQA 3H40A 2EXUA 2IY5B 2KXNB 2BUNA 3UW1A 2BQ3A 2MGZB 1QAJA 2LU2A 1NXIA 2YKMA 3T41A 2YNIA 1R6VA 2UVRA 2CQ2A 2HHPA 2BKPA 4O4RA 3EVMA 3MUTP 1YITS 1KQSR 3BGFA 1H7XA 4UUXA 4ANDA 1K9MT 4USUA 7AT1B 4P9SA 2B5JA 2MJNA 3W3SA 3SCLE 1NZ8A 4ECSA 2WZ1A 4MTPA 4K59A 5LXYA 3NNCA 5CH7B 1Q79A 3M8QB 3PYFA 2IVFB 2RB7A 5K8NA 3IFEA 4H54A 5KFBA 1P9QC 3DGVA 3KUEA 3N01A 2RUGA 1KSPA 2JFDA 3KUHA 2A10A 3MMCB 1N5YA 4V19X 3NOGA 2W2MP 1IVZA 3QLHB 3V81B 4C0OC 3FCHA 2YKPA 3HVRA 5F3ZA 1E1ZP 1FRMA 1RP5A 4ZA1A 2M88A 3T9NA 2ZUGA 3C6UA 4FDFA 2KVQE 1MWQA 2B4OA 4KBIA 1IR0A 1ICEB 1NSPA 4OYMA 3BQ1A 4O4GA 3DLEA 1CQMA 1YBAA 4ZP7A 4USHA 4JI1F 1C1BA 1KH7A 4U8YA 1JKHA 2L3MA 3M8PA 3OV7A 2HHUA 3BDHA 2AV5A 2FYXA 3FUYA 4PYDA 4MH8A 2UUAJ 4Q44A 2D3O1 4PWWA 2D9OA 2WVDA 3M6VA 4NWXA 4I0WA 2PE8A 3G6YA 2AP6A 1KONA 2XC9A 2OJ3A 3MEGA 1WG5A 3HHEA 3SXLA 3KMQA 1HWIA 1FWPA 2AHOB 2C2KB 3VZHA 5A8KA 5KFWA 2VG7A 1TL1A 3L7PA 1LOUA 3U7JA 3DLLQ 2VF3A 3V6KA 2ASLA 1NUEA 1KC8T 3C6TB 3GFHA 1U0HA 3MEEB 2CDRB 1B0VA 3M6WA 4IYQA 4DR6J 1RABB 1EHWA 3RG6A 3MUMP 1BQNB 3EMTA 1D9AA 3DCAA 3EZUA 2W2QP 2G0IA 4LVOP 4UF4A 5KFYA 3N9UC 4DU7A 2V2KA 2VPXB 4NLWA 4RJVA 1T9TA 1QAXA 1YRTA 2DNOA 1J27A 3K2YA 1AZSB 1RHJB 2HK2A 5FLXY 1RTIA 4ENOA 5C5JA 4QWDA 3JQKA 2H5JB 2F4FA 3KLEA 3SZ2A 3GILA 1NMEB 3ZZTA 1B4SA 2UVVA 1S1TB 1SBRA 3RYLA 4DBQA 1D09B 2HAFA 2JWNA 5F41A 4DS4A 3TAQA 4DV2F 3R8YA 4HDHA 2J0XA 3GIIA 2QA1A 1VC5A 3MTJA 4W98A 2Q66A 2XLJA 3LP1A 4L75A 4P75A 3N5BA 1VQYA 1ALKA 5F3TA 1P49A 3LP1B 1VQPS 5ETQA 2GJFA 2XWYA 3I5CA 3CD5A 4A8XA 2CJKA 1PGZA 1QVGR 1S6UA 4DR3F 1WG1A 1VS3A 2Q79A 3H8YA 3P5BP 3C66A 2YNFA 4LFCF 1FRXA 5EDWA 4LF7F 4KJGA 1RT7B 1WSVA 2ZKUA 2I8EA 2HSEB 1RTIB 2M0GB 3QSIA 2C2MB 2ZBPA 2DNMA 4ZOSA 3UR0A 4DV4J 4A8SA 3TYTA 2B7BB 4X64J 4GVLA 2H5EA 2W5WA 2RF2A 3TP2A 4OJHA 5DM7Q 5E2QA 3HJFA 2B9XA 4EBDA 4Y3CA 1KQKA 3M05A 1XMBA 4QIGA 3U27A 2VQEJ 2OPRB 1RHRB 3OHAA 2GGPB 4MAKA 4RW9B 1S6PA 4R5PA 3I55S 1TL1B 1TP7A 1VI7A 3H90A 8AT1B 1QLNA 5EX0A 2GV1A 2HBYB 2QZ8A 3E01A 4WFBQ 4LRBA 4QWBA 2H1YA 4C7QA 3M8ZA 5LT5A 2DXDA 2N7CA 1X5SA 3K0JA 2ZJRQ 1IBMJ 1QTMA 2RJZA 2KDOA 1YJWS 3SYZA 2CQHA 2KO1A 4LSLA 4URQU 2W9CB 5ITHA 3EGZA 1G4CA 2MZ1A 3UD5A 2L9DA 2YKNA 3HVTB 4WK1A 2R8IA 2UUBF 4EO6A 1YJ9S 5M2RA 2DO0A 4Y65A 2NXJA 2XZTB 3H5YA 3JB9k 1JLEB 5KFOA 2FLLA 4IOCQ 3N6LA 1FT8A 1FTRA 1C1BB 3PHEA 3BH7B 3GYXB 3I0RA 4FKXA 5DO2A 4N47A 3HHKA 4ILRA 4AYBD 1L5UA 2BM1A 3C19A 4EBCA 2OPSA 1N6QB 1HNXF 3ISNC 4JI6F 1Y7PA 4FKYA 2QLXA 5LMNJ 1S4FA 3IG1A 5J1NA 4JI7J 1S0OA 4MYTA 3HLUA 2CPJA 3MMCA 4PG8A 3ILLA 4EYIB 4UOOA 1NO8A 4KJDA 1S97A 3I9V9 2B8QA 2B4UA 4M5NA 1VQ8S 2KTQA 2Q3PA 1T11A 4USWA 1WKLA 3HF5A 5CYQA 2VFTA 3QGHA 2E5LJ 3BPDA 2B5JB 1HWKA 1G6BA 1TL3A 3MM7A 4ZKAA 2PMZD 1JK9B 3BO3A 1JB0C 4EK2A 2J6SA 1OY8A 5F8JA 2JSXA 3EUNA 1P1TA 1S59A 2CPHA 4OI0A 2CVIA 1VISA 2RQ4A 4OJGA 3PEHA 5L8RC 5JMNA 5CYJA 1RHMB 5GADU 3HHLB 3GQCA 1IKVB 2LMIA 2MDAA 4LR9A 2WAQD 4FZVA 4RX6A 3KUGA 4RW8A 2GQ2A 3KHRA 5KFPA 3CJKA 5C42B 5IFMA 2QX0A 1X5TA 1O6XA 2QL7B 3HI9A 1AYEA 1JLCB 1HBUA 4RPFA 4WFNQ 5GAEU 2V5HG 1VQ5S 1HFEL 4OHYA 2IMOA 1UEVA 5I42B 1F9HA 1UVIA 5CYMA 1WC5A 2Z0GA 5CZVA 5D0EA 4WWSA 4DF4A 1LQ9A 3PZPA 2ZEJA 1ZAXA 4K8RA 1PBUA 4TQRA 2R7OA 3EJMA 2EFVA 2CPEA 1FDNA 1CJVB 2NUHA 1NBEB 1S99A 5B7WA 5KFKA 4GKJF 4K0KJ 2MKYA 4TN0A 1K73T 1C2PA 1C1CB 2HBZB 2VBXA 4F3QA 2M9KA 5KG1A 3CE8A 1O8BA 4HACA 3UNGC 4DUZF 3GE9A 4TY8B 4ZPCA 2R7XA 4K2XA 4J9SA 1HI1A 1IBMF 2K3KA 2U1AA 3VAJA 2PA3A 2HWHA 4DL5A 2OPPB 2B9EA 1C0TA 3ZTPA 2PD1A 9RUBA 1SL2A 3G8QA 2XZWA 3LF0A 2XMVA 2LQ8A 3VAFA 1KDNA 4OHXA 4ELTA 1S6OA 4JYAF 2CPIA 2VZ9A 4QR2A 4FYYB 3OJSA 1FWLA 2E1PA 1FDBA 2MHNA 4J37A 3UFCX 2BKNA 2FVPA 3RW6A 2V50A 1LWXA 1Q4RA 2NS1B 3DLGB 2IYGA 4USJC 2Z57B 3OJUA 4X66F 3DDKA 4AD6A 1SHNA 1Y11A 4IG0B 1S9EB 5F0WA 5ETSA 3DMJA 4CTAA 4J7CA 1MWYA 3MOJB 3MMBB 4I6YA 2ATLA 2LECA 2HURA 1OWXA 1WUUA 1XWLA 2B9WA 2QMXA 4OX8A 4OX9F 2Z2LA 3LP0A 1HWJA 3KOAA 4M5HA 4FYDA 2EFGA 1GMWD 3UE2A 2FLPA 4JV2A 2FD2A 3ZNUA 2XI3A 1WD6A 1RTDA 2MZRA 3FFIA 3BR8A 3K8VA 2ZH5A 1U45A 4RWXA 3ISND 4QBUA 5IQQA 5MAOA 1HHTP 2FY1A 2HHSA 2AEMA 4IDKA 4UQGA 3D66A 4KR0B 2G1HA 1QY7A 2GHVC 5C25A 2DO4A 1J5OA 1SH3A 4U7UK 2ZITA 1NK0A 3V2UC 2DY9A 1WF1A 2RMLA 4WFYA 3MMAA 2JFKA 2P9GA 2R42A 2LXIA 4DUYF 4B3RF 1CJKA 1EP4B 2IM3A 2ZE2B 1H3DA 2X1BA 3B4MA 3C15B 1R27B 4PABA 4ANCA 3UD3P 2CQGA 2OSQA 1YJNS 3J7ZT 5AJ9A 4OYPA 2PEBA 1Q7YT 3A8IA 3EGNA 4PG6A 5A6PA 1TR0A 1SJ4P 4JUZA 1UZHA 4HT7A 4C2MA 5B0GA 1NSAA 1U1MA 4ZPDA 5L1IA 4JI0J 1MMLA 3IDDA 4RW7A 4IOBA 5D78A 2FZKB 3D1OA 1J2VA 5EGYA 3BSNA 2MJUA 5GAHU 2DPJA 1PC4A 1Q1KA 2JL9A 2BJEA 3DRRA 3RRKA 4CLUA 3P49B 3D4JA 1QAIA 1EW9A 3OXFA 3CCTA 3GYGA 2W8KA 2B43A 3MPDA 4KAVA 3OFHA 4KH1B 1YDLA 1QTNB 2E29A 1KFDA 2HVZA 2MQNA 2O1PA 2HVDA 2JLFA 3MMJA 5LM7E 3TAMA 5CABA 5CCMA 3CUNA 5DJBA 3OT9A 4NZ7A 4LIRA 1VRQC 4LRDA 4RBVA 2WTFA 2VU5A 2BEFA 2XBPA 1IKXA 3P3DA 3H5XA 2R7TA 4MKAA 2CG8A 4C0HA 2HFOA 2VIHA 1N4LA 3QAEA 4KSEB 3CDEA 3NCRA 3OL7A 4Q2LA 2LA6A 4UOPA 3R97A 2O5DA 4FPIA 1ELZA 3MM8B 3TZXA 2VJUA 2YVSA 2QIFA 3CDAA 3I31A 1PAUB 5L46A 3PW4A 4UY8T 1BC6A 3AT1B 3WBZA 2G4BA 3IR7B 2ZH9A 3SZYA 2QC3A 3WAWA 2IA0A 4DQPA 1LK7A 2BM0A 1VIXA 4YB5A 4UOHA 3HSJA 4RZRA 3T1YJ 1CG2A 4RU2A 4IR9A 4G3IA 2VASA 2GVZB 3OD2A 4Q0BA 5K8MA 5HQ8A 1UEKA 1HYSB 3QYYA 4C6AA 3QIPB 1NJIT 1AXQA 2CQ0A 3R27A 3MM9B 4RBTA 5J1EB 5KT2A 2ZZNA 1RJJA 1JQGA 2OD4A 2HNDB 4LQ3A 3NG8A 4C98A 2JRSA 1M5KC 3MCOA 3VAMA 4YDXA 3TQ1A 1VC6A 2Z30B 5DZ7A 3EE3A 3TO8A 1RE1B 2IVYA 3TA2A 5D8HB 3VGTA 5G0RB 3PR4A 3TVZA 3NVLA 1RWVB 2DYAA 2P9CA 2D41A 1EKSA 5KFIA 4F36A 3K7RA 5IT4A 1RYRA 1Q7LB 4LF5F 2DNGA 3NKYA 3CMAS 4LBPA 3QT6A 1W26A 5HSPA 1IKWA 2L08A 5I3PA 3QZ8A 4DLGA 5G0RA 1SKWA 5EUHA 2IRYA 3CO9A 5HAOA 2L9NA 4LF1A 5KFLA 3A8EA 2BW2A 5KAKA 5EWFA 1YJRA 3FMWA 4M5GA 4HVZA 4M95A 1UVJA 1B3TA 3DI6B 2A6OA 2FUG9 4XTTA 5H9FJ 5BR8F 5DGAA 3W65A 2QN6B 2G2YA 1U02A 1BGXT 1R0CB 3FRYA 2OEJA 1VCTA 3PFOA 3PYDA 5E7OB 5BYSA 5J1EA 5FLXU 1T7PA 4JI1J 2MHEA 2IFYA 1PYOB 2UV8G 5AXLA 3N5FA 2UXCJ 4WP8A 4X4VA 3A3OB 3TZYA 1HBNA 3ETMA 4GO7X 2HGMA 4K2JA 1FDAA 3K5PA 2GS8A 5T7LA 2VFSA 1KQFB 3HX9A 1VHFA 4X62F 1NK4A 3DM2B 5HBMA 1RAOA 4DDFA 3A1YG 4U8VA 1TL7B 3G2XA 3V6HA 2Z2ZA 4CLSA 2RRNA 3F0NA 2JC0A 3MM8A 4LSNA 2MEWA 4LRCA 5E3AA 1UCNA 1VQ7S 2AJ1A 2MY8A 1MU2A 1S7IA 3BBFA 1QM9A 5J2MB 1FJ7A 4ZVGA 3THPA 1JXVA 1IKXB 1SC3B 1RAEB 3P8BB 1RTHA 4O0IA 4ES2A 1FKAF 1F2GA 2RQMA 2ZOFA 3JSBA 1HHSA 4M5IA 3V4IB 2GHPA 2AYBA 2YWFA 3G86A 1UWBB 1RT2B 3TX8A 5KFHA 3K5LA 3WAYA 4I2QA 2ZBQA 4EFAC 1HQEA 1HDHA 4LJMA 3I5AA 3DRRB 4AL7A 4C9DA 2V6AA 2H54B 2JOQA 5B0DA 1NDPA 1R8BA 5C66A 1QVFR 4NCBA 1YJ7A 1DTQA 1BWEA 1BQMA 5D4NA 1CPZA 2H48B 4YR3A 4NX9A 5ETOA 1UWBA 4X4OA 2BR0A 1VHIA 4KHPF 3SSSA 1U26A 3FC9A 4DR2J 4ECZA 2C22A 8RUCA 4A8KA 4PXEA 1YWXA 2WSCC 3I0SB 3QGPA 1TTHB 3OBIA 3OTCA 4TN2A 4CQ1A 2XM3A 1IBLJ 3NGUA 4LF8F 3HZGA 5KFMA 4L74A 1H73A 5F9NA 4F4XA 2ZE2A 3C15A 4F3MA 1HL6A 3LWMA 2NXCA 4OZNA 3G87A 4EMDA 2LQJA 3CGIA 3ENAA 3MGJA 3MMAB 4P7VA 3ZTSA 3D67A 4ZCIA 1T95A 4LT6A 5C2CA 4WFZA 2DNHA 4DR6F 3MECB 2R2RA 1VQKS 1FTCA 1WSRA 4WE1B 2GMJA 1TL7A 3NY0A 3PM9A 4IDKB 5L1JA 4RNHA 2A18A 2ZJPQ 2W8DA 4F50A 1P6TA 3QNWB 4KAYA 2HGNA 2KT3A 1SQGA 1HBNB 2W5TA 4NLPA 4I6WA 2I6WA 2HHQA 2DBBA 3J80U 2K2PA 2DGSA 1B0PA 3R9LA 4J9MA 3DOLA 1N5VA 3JTNA 1NHVA 1BLUA 2HFSA 5F8HA 3RB0A 2FVQA 4ZP6A 4ZHRB 3ZZOA 2LQ5A 4I6AA 2BACA 3DI6A 2H5IB 3PEJA 1IBCB 2E7WA 3CJ0A 4O23A 2VA2A 1S9EA 3G96A 2MKKA 2XI2A 3FZBA 2UUBJ 5I3UA 5ETPA 4DPUA 4K4XA 4KT0C 3T1HF 5KXAA 1FKOB 2H65B 3LP2B 4RNFA 3DLKA 2GZOA 4XIUA 2XY6A 2FC9A 1Q8IA 2ASDA 2D69A 4ZLJA 1SH2A 1S76D 2XSFA 3PIPQ 4PXDA 5DDRC 3KWMA 4YHHJ 3B82A 1BE4A 2OEKA 2HKEA 3A52A 4CYUA 4TLRA 4DOZA 3MM9A 4LFBJ 3EVWA 4GVBB 4NZ0A 5KT6A 4A47A 3BH6B 3QIPA 3HSGA 2VODA 4I56A 1HYSA 1KH4A 2VONA 2EC2A 2GVZA 4Q0BB 2VPYB 4DQIA 4Q8EA 2DH7A 4MFBA 2ZH4A 2JEJA 3R2DJ 1TAUA 4DV4F 2RSQA 1UW9A 3J81j 4UZCA 1NSKL 1ACMB 1F5BA 3FCVA 4DZDA 2DEIA 4WJBA 3M2VA 5HMZA 3TZZA 4K5RA 2OHDA 1R43A 3PG9A 4PR6A 5D4LA 5CA5A 3J7Z5 2DH9A 1HWUA 2R3VA 1IWGA 1GAOA 4H4KA 3PFEA 3KNGA 5DDPC 2YX4A 1NAQA 2M5YA 3PXGa 1WHYA 4ALZA 2VQFF 1IBKJ 3OVBA 1KVKA 2OFHX 1UAWA 2FZCB 1ZPVA 1KBRA 4P2MA 3BREA 4KPYA 5I42A 1M5OC 1HBMB 3NS5A 2VOPA 2ZHBA 1N2LA 3O2IA 2ZDPA 4HH1A 2XY7A 2BZ2A 2YX1A 5C42A 3TAMB 4DR1F 1UA0A 4ZG6A 4DV0J 1R7IA 4B3SF 4X4NA 4CP5A 3G9CA 1F60B 3US5A 1JX4A 3RZAA 2MPUA 3TI0A 1XBWA 4ED2A 4PPZA 2QLWA 1NEEA 2GMHA 4N8OA 4C8YA 4DSKA 4Y2KA 1REVB 4UZBA 2MZJA 4RW7B 4ZPVR 1SV5B 4NI2B 1TL3B 3PNIA 2WW4A 1SQFA 2ZHOA 4PCQA 5CYQB 4JI0F 5ETRA 5JJBA 1F1BB 1KHJA 1WHXA 3A8JA 3G4SS 2PO4A 1UVMA 4X62J 1FXRA 1WI8A 2VPZB 3VVUA 3W63A 2LDYA 2DB1A 1CBKA 3N6NA 2KHDA 2BJ1A 2DIVA 3FQKA 1U6ZA 4DL2A 1CJKB 1EP4A 1JLFA 1X5OA 1H2VZ 4ZP9A 4ZK7M 4C48A 4PWUA 3T1HJ 5J2PB 1G1XA 1GXTA 2F3JA 4WPAA 3I0RB 3ZTOA 3W62A 3FNNA 4QIWD 4U6PA 4TQSA 1OJ4A 1VBYA 4UT4A 3RU0A 4JI4J 4M5DB 1JLEA 3FFIB 3JQMA 1SC6A 1FX2A 1I51B 3HVTA 1RBAA 1I94J 1LFPA 2K06A 1K1SA 1RWKB 1WOPA 3PJXA 5C24B 5L9NA 2W9CA 2NXEA 5BXIA 1IR1A 1P27B 2C2ZB 4OFZA 4F0KA 3K5NA 3HJVA 2X3GA 2VHGA 5IWAF 2BA9A 1NPRA 2RU9A 1TAQA 2ZBRA 3MMBA 4TY9A 3E01B 4LR7A 4E8UA 4JI3J 4CTAB 4CT9A 4BS2A 3DMJB 3VGUA 2CA9A 5D3GB 2Y0BB 1S6PB 1MLAA 2GAGC 4IG0A 4KGVB 4RW9A 4R5PB 5LJ3Y 2AU0A 1RAJA 5GMEA 5HMWA 2LQBA 2EKYA 1Q81T 1PYSB 4RBUA 1FD8A 1PAEX 2FHJA 3C14B 2QLFB 1Y5IB 2C1EB 2RF2B 1VFJA 1KLMA 4ID5A 4YMEA 4KE5A 3ZXWA 5CZXA 1WEXA 4IG3A 2OLWA 1TKDA 1S0NA 4WU3A 3BBBA 1FE0A 1I3OB 2X7IA 4RR5A 3UCUP 1RT7A 4ECQA 3D6MB 4R0EA 4ETXA 3OR1B 1VK3A 2ZM6F 1JNRB 2YNFB 3NCPA 4OLPA 1XMQJ 1KLNA 2OMLA 3TA0A 1UL3A 4ZJOA 1DTTA 2DRAA 1TL4A 3R6LB 2JDJA 3W5XA 1YKWA 2G2ZA 4CXSA 3NMAA 3SI8A 2OO4A 5IOLA 2DNNA 2XZDB 4TY8A 4JV5J 1B8JA 3SFGA 5K5MA 4U9RA 4HACB 2V2QA 4YP3A 3O8WA 1C1CA 1UPMB 2ZFHA 5AT1B 4DFMA 3C3LA 1R89A 1REGX 5A8WA 4DN9A 3MAHA 1RLDA 1RQ0A 5B0EA 2R7WA 3DLJA 4WTYA 1NPPA 1DLOA 1OY6A 1H2UX 2GVDA 1GXLA 4DPTA 2HQIA 4QIEA 3WDOA 2HS4A 3HXMA 5D0HA 1U1LA 3D3BJ 1U48A 1AZSA 3EDRB 4K4UA 4QAXA 2MQ8A 1HNZJ 2ZBCA 3J80Y 3CJRA 3PRBA 1L3VA 1UVLA 3KK1B 2DNKA 2J0WA 3GYNA 1NLKL 5HLFB 2DNYA 2HRUA 1V3SA 1ZYQA 4CWBA 1HBUB 1JLCA 3ENWA 4OHVA 3KLVA 1S0VA 2HQGA 4NYZA 3T5LA 2LKZA 3CJKB 1SH0A 1NK8A 3U1NA 1NKBA 1TFWA 1FF2A 5DLTA 2HEKA 3GSDA 5EWEA 2IA6A 5L0BA 1IKVA 3HHLA 1XIQA 5A8KB 1A0OB 1M5HA 2J9CA 2ZBIA 2W7AA 4QZVB 2Y8WA 5DS7A 4AL6A 1RT3A 5EGHA 3KNAA 4BC7A 1CQNA 1S48A 2R7QA 1TMJA 1ZBTA 2NYIA 4GRSA 2DVIA 3TVKA 1X4DA 2PGCA 3MM7B 1S5ZA 2BANB 3IRXA 3KHHA 2ALZA 3MF5A 1F5CA 1Q5VA 3Q24A 1U47A 1RKJA 3DFEA 4OYOA 2Z2MA 3IR6B 2OAUA 2W9BA 1D1UA 4LF4J 4UW2A 4WP9A 2QFIA 2R8HA 2BX6A 2DHXA 3CEDA 1U1QA 5IM0B 2A2DA 2HHHJ 1JKHB 1S4EA 1CS4A 3PKYA 1APSA 4UPIA 2EKNA 2AT1B 2PT0A 4GC7A 1VQMS 3JQJA 4KY3A 1KD1T 2XSJB 4DF8A 4MIWA 5AE1A 2KYXA 3C6UB 1HR0J 2OPSB 4LVNP 3GV8B 3BBCA 4BLGA 4AQYF 2DJWA 2XSJA 1S1WB 1N36J 3A4TA 2ROGA 4FXDA 3FSIA 5LMUJ 1N5YB 4CO0A 4QWAA 2AYGA 3ZZUA 3RB3A 1URBA 4ZGAA 2IHR1 3H59A 5IM0A 4P2FA 1AUSL 4CO4A 1DQAA 4RUBA 2MKHA 5KFQA 1YIJS 3M8QA 1M1HA 4J5OA 3PCOB 2W9BB 1RYSA 2QA4G 4LSLB 1DJ0A 4DEZA 4W90B 3KK2B 2ZOGA 1LV5A 2CJBA 4ED4A 1WDDA 1RSCA 4P74A 2PC6A 1JJ2R 1RT3B 4DSIA 2UXBJ 2YKMB 5BYRA 4I7FB 4LFBF 5KFDA 2MGZA 4JYAJ 1UVKA 5CCLA 3SMZA 4BCAA 3UVJA 3UR3C 3Q8RB 4DR3J 2Y8YA 4CO3A 5F9LA 2OPRA 4KRWA 3L7OA 4RL1A 2KHCA 4EYHB 2WOMB 4JI6J 4JI7F 1HQUB 3GTYX 1W7WA 5HJXA 2FJBB 1K44A 1JLGB 4IFYA 3CMQA 3RGIA 3WIVA 3HHDA 4F04B 2MTLA 3SBMA 2IC3A 2VQEF 2DITA 5EN1A 3GZ7A 1PYTA 2CDQA 2W8LA 1UW4A 3UDVA 4JI2F 3OXLA 2C3OA 2M52A 5AXMA 1HR0F 2BV3A 3DDIA 3MEKA 4Y28C 1OYEA 1DLOB 4GKJJ 4K0KF 5KG5A 3D0GE 3RJMB 3E2DA 4ER8A 2XMUA 4DX5A 2YX7A 2RDIA 2OELA 3HHNB 1MROA 1SUQB 1WI6A 3DU6A 3UI3A
chains in the Genus database with same CATH topology
3UO0A 3NKQA 1KH9A 2W5RA 4FDIA 1AJCA 4GTXA 5IJSA 3TG0A 4UORA 4NWJA 5DLWA 5LQQA 4CXSA 3NVLA 3Q3QA 1ALKA 1KHKA 3A52A 1P49A 4LREA 1O99A 4LQYA 5GOVA 3DPCA 1KH4A 3MK2A 2ZKTA 4GTZA 3UN3A 4N7TA 1ANIA 1AJAA 4KJGA 3DYCA 4MHXA 3B5QA 3BDFA 4GTWA 1N2KA 1SHNA 3WAXA 5L0KA 5C66A 2IFYA 1URAA 2W5WA 3CMRA 3M7VA 1O98A 4GTYA 3ED4A 3BDGB 2QZUA 2IUCA 4CXUA 5DLTA 2XR9A 1ELXA 3WBHA 5L0BA 1ALIA 1HQAA 1K7HA 4LRBA 1EW8A 2W5XA 4MIVA 3M8ZA 5K4PA 4LRCA 1N2LA 1ALJA 3TWZA 2GA3A 4ZG6A 5LIAA 5EGEA 4CYSA 3TX0A 1AUKA 3MK0A 5GRRA 1E33P 4LRFA 5HRTA 3WAYA 1AJBA 4UPIA 4YR1A 1ALHA 1SHQA 2W5QA 1HDHA 5AJ9A 3NKNA 1KHJA 1Y6VA 4CYRA 4ZG7A 3NKRA 1B8JA 1ED9A 3T00A 3NKMA 4LRAA 1EW2A 5L0EA 3IGYB 4ZG9A 3T01A 2GSNA 2G9YA 3IDDA 4UOOA 1URBA 4ZGAA 1E1ZP 4KJDA 2X98A 2W5VA 3UNYA 2GSOA 1EQJA 3IGZB 5IJQA 5KXAA 1EW9A 1KHLA 1KH7A 1Y7AA 1AJDA 4KAVA 5EGHA 3MK1A 4UPKA 5TJ3A 1ZEFA 1E2SP 5DLVA 3BDHA 3UN5A 2W5SA 3OT9A 1EI6A 4LRDA 4LR9A 4FDJA 4KM4A 1ANJA 3UN2A 4NWXA 1ZEBA 2W8DA 1E3CP 1FSUA 4CXKA 2IUCB 1ED8A 4UOPA 2RH6A 2GLQA 1ZEDA 4KAYA 4MY4A 4UPHA 4UPLA 1HJKA 2W5TA 1ELZA 3T02A 1EJJA 4LR7A 3SZZA 2VQRA 2W8SA 4QAXA 3SZYA 3WAWA 1KH5A 5LRMA 3BDGA 3NKOA 3NKPA 4LR2A 3M8WA 2GSUA 3M8YA 2D1GA 1KHNA 3E2DA 2XRGA 2ANHA 3KD8A 4LR8A 4TN0A 3WAVA 1ELYA 5INHA 5LRNA 3LXQA 4B56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO0 A;  3NKQ A;  1KH9 A;  2W5R A;  4FDI A;  1AJC A;  4GTX A;  5IJS A;  3TG0 A;  4UOR A;  4NWJ A;  5DLW A;  5LQQ A;  4CXS A;  3NVL A;  3Q3Q A;  1ALK A;  1KHK A;  3A52 A;  1P49 A;  4LRE A;  1O99 A;  4LQY A;  5GOV A;  3DPC A;  1KH4 A;  3MK2 A;  2ZKT A;  4GTZ A;  3UN3 A;  4N7T A;  1ANI A;  1AJA A;  4KJG A;  3DYC A;  4MHX A;  3B5Q A;  3BDF A;  4GTW A;  1N2K A;  1SHN A;  3WAX A;  5L0K A;  5C66 A;  2IFY A;  1URA A;  2W5W A;  3CMR A;  3M7V A;  1O98 A;  4GTY A;  3ED4 A;  3BDG B;  2QZU A;  2IUC A;  4CXU A;  5DLT A;  2XR9 A;  1ELX A;  3WBH A;  5L0B A;  1ALI A;  1HQA A;  1K7H A;  4LRB A;  1EW8 A;  2W5X A;  4MIV A;  3M8Z A;  5K4P A;  4LRC A;  1N2L A;  1ALJ A;  3TWZ A;  2GA3 A;  4ZG6 A;  5LIA A;  5EGE A;  4CYS A;  3TX0 A;  1AUK A;  3MK0 A;  5GRR A;  1E33 P;  4LRF A;  5HRT A;  3WAY A;  1AJB A;  4UPI A;  4YR1 A;  1ALH A;  1SHQ A;  2W5Q A;  1HDH A;  5AJ9 A;  3NKN A;  1KHJ A;  1Y6V A;  4CYR A;  4ZG7 A;  3NKR A;  1B8J A;  1ED9 A;  3T00 A;  3NKM A;  4LRA A;  1EW2 A;  5L0E A;  3IGY B;  4ZG9 A;  3T01 A;  2GSN A;  2G9Y A;  3IDD A;  4UOO A;  1URB A;  4ZGA A;  1E1Z P;  4KJD A;  2X98 A;  2W5V A;  3UNY A;  2GSO A;  1EQJ A;  3IGZ B;  5IJQ A;  5KXA A;  1EW9 A;  1KHL A;  1KH7 A;  1Y7A A;  1AJD A;  4KAV A;  5EGH A;  3MK1 A;  4UPK A;  5TJ3 A;  1ZEF A;  1E2S P;  5DLV A;  3BDH A;  3UN5 A;  2W5S A;  3OT9 A;  1EI6 A;  4LRD A;  4LR9 A;  4FDJ A;  4KM4 A;  1ANJ A;  3UN2 A;  4NWX A;  1ZEB A;  2W8D A;  1E3C P;  1FSU A;  4CXK A;  2IUC B;  1ED8 A;  4UOP A;  2RH6 A;  2GLQ A;  1ZED A;  4KAY A;  4MY4 A;  4UPH A;  4UPL A;  1HJK A;  2W5T A;  1ELZ A;  3T02 A;  1EJJ A;  4LR7 A;  3SZZ A;  2VQR A;  2W8S A;  4QAX A;  3SZY A;  3WAW A;  1KH5 A;  5LRM A;  3BDG A;  3NKO A;  3NKP A;  4LR2 A;  3M8W A;  2GSU A;  3M8Y A;  2D1G A;  1KHN A;  3E2D A;  2XRG A;  2ANH A;  3KD8 A;  4LR8 A;  4TN0 A;  3WAV A;  1ELY A;  5INH A;  5LRN A;  3LXQ A;  4B56 A; 
#chains in the Genus database with same CATH topology
 3UO0 A;  2CQ3 A;  1QDU B;  2JEG A;  5D4O A;  3HD2 A;  4OJ1 A;  3PX6 A;  3PO5 A;  3IS9 B;  3QMQ A;  3BKT A;  1DTT B;  3QPI A;  4UOR A;  4O3Q A;  3DOK B;  3OSP A;  1RGV A;  5GMK a;  1S1T A;  2QL9 B;  1GH8 A;  2LYV A;  3DLB A;  2JVO A;  5AXN A;  2E5J A;  4OYZ A;  2KVI A;  1M90 T;  2MSS A;  2NYH A;  4IKA A;  3KLE B;  4IRD A;  3E8O A;  3T6J A;  4J9R A;  2APO A;  4ZDN A;  3CCJ S;  2CPZ A;  3S8S A;  4ZVF A;  2BJ8 A;  5MLC V;  3PIO Q;  3EYZ A;  1T05 A;  3CC7 S;  4E0D A;  1X4F A;  4X64 F;  4LBH A;  3MFI A;  4GC6 A;  3POT A;  4HH0 A;  1F3V A;  1U0H B;  3MEE A;  4OIX A;  4OL8 A;  4HR2 A;  5D3G A;  2BQR A;  2GAH C;  3HMJ G;  2V68 A;  2VG7 B;  4G1Q A;  3IA0 A;  3UCZ P;  4YOE A;  1XJW B;  5KFE A;  4H4O B;  1KP6 A;  2D3Z A;  2PEH A;  3ED4 A;  5KFV A;  2N82 B;  1O5J A;  4X4S A;  1EQM A;  4M63 A;  2WW8 A;  3SV4 A;  4ZJL A;  4NA3 A;  3PW7 A;  1FNO A;  4JV0 A;  1YK9 A;  5KFZ A;  3TVY A;  4TXS A;  3OFG A;  4A8Y A;  4USI A;  1ZS6 A;  4NLV A;  1HW9 A;  3TW0 A;  2J7W A;  3NCQ A;  3ILJ A;  1ZPW X;  5AXK A;  2Y9H A;  4O44 A;  2XS7 A;  3CJT A;  3J7A 1;  3IBC B;  4ZVT B;  3M8P B;  4M5D A;  4A8W A;  6AT1 B;  5EHH A;  2ADC A;  2DR7 A;  2MKI A;  3AA9 A;  4D3G A;  2BE9 B;  3DLE B;  4FPR A;  4EI2 A;  2W7O A;  5FJ4 A;  4C4W A;  3FRZ A;  2HW3 A;  3IBW A;  2IM0 A;  5J2P A;  2CJX B;  3RB6 A;  2CZV C;  1E33 P;  1Q8B A;  3D1Q A;  1PBA A;  3M32 B;  4NLX A;  2A1B A;  4RW4 B;  4CO1 A;  2RHQ B;  4DL7 A;  4CLP A;  2ASJ A;  3EIC A;  1JLF B;  1FJC A;  1IM4 A;  3ZZP A;  2M8H A;  3J7Y U;  3RAM A;  2ZJQ Q;  4ZPT R;  2DXE A;  5H9E J;  1FNM A;  3W2V B;  5ETL A;  2CKW A;  2HQC A;  3OTO J;  1GMW A;  1JJH A;  2V2Z A;  5B09 A;  3GIK A;  2VPW B;  2VFV A;  2D1C A;  2MLX A;  2XG8 A;  2J8S A;  1V3Z A;  4ZPA A;  2PFD A;  4KC5 A;  3KLF A;  1SV5 A;  5ETN A;  3H4D A;  2I1R A;  1FRJ A;  1SJR A;  2IM2 A;  3GCX P;  3MUR P;  3NNH A;  4MIB A;  4RNO A;  3VGS A;  2AZ1 A;  2JJ4 D;  3DN9 A;  2YNI B;  2Z8Q A;  4QOT A;  4AT1 B;  2UUC J;  2QFJ A;  4ES3 A;  3P45 B;  1NB7 A;  1WAC A;  2OMO A;  1YI2 S;  3L3C A;  1S1U B;  1Y4Z B;  4QU7 A;  1SB6 A;  2EG1 A;  5D4P A;  2K3I A;  4ZPW R;  3PYE A;  3GJQ B;  2FHM A;  2V67 A;  4FVM A;  4I2P B;  2ZHA A;  4OZ0 A;  5FDL A;  1MN9 A;  5IZH A;  3R5C A;  3Q23 A;  3AY0 A;  2DGW A;  3WHI A;  4DXL A;  1TKT B;  1ZM2 A;  4DG1 B;  3Q89 A;  3O5T B;  3TEG A;  4QR0 A;  2W7P A;  2IUC B;  3GU0 A;  5DQI A;  4UPH A;  2JX2 A;  4DWI A;  3M8S A;  2IBO A;  5DG8 A;  2HWT A;  2X1F A;  2VDH A;  3JYT A;  4U7C A;  3M2U A;  2Z58 B;  2BE2 A;  3FZ2 A;  1AA1 B;  3DDN A;  1XQI A;  1GNK A;  3M2V B;  1EZZ B;  1R6Y A;  2Q1L A;  3M4X A;  2UU9 J;  3VHQ A;  2FPH X;  1FFW B;  4OYX A;  3M8W A;  5CD4 H;  2D1G A;  1A7G E;  2HBQ B;  3MD3 A;  1FXL A;  4LR8 A;  4RKU C;  5KTQ A;  2C2E A;  2XMJ A;  3GIJ A;  1BQX A;  4OYI A;  3Q22 A;  3RAX A;  3A3P B;  2B4V A;  5IXU A;  4RUA A;  4O0N A;  5K14 A;  5LSO A;  4DV1 F;  4KIA A;  3TAN A;  1KH9 A;  2LEP A;  1DY3 A;  3I5B A;  4WK3 A;  2EC0 A;  1N54 B;  2DCU B;  4X4R A;  2BBE A;  5KG0 A;  4IH7 A;  4NWJ A;  1U25 A;  4FNH A;  3W8G A;  3ZTR A;  5HRO B;  5THW A;  2BJ9 A;  3NGD A;  2CQ1 A;  1K47 A;  1GMV A;  3LP2 A;  2PII A;  4DQR A;  1Z2L A;  2V9K A;  3KHG A;  4AQY J;  2MQM A;  5I3U B;  3HKW A;  1W2B R;  4LQY A;  4WII A;  5A0Y B;  5FD1 A;  1KQG B;  2CWK A;  3AD7 C;  3ENV A;  3UQS A;  5KFF A;  4ZLL A;  3JXO A;  4DR7 F;  1UFK A;  1KR4 A;  2BYC A;  3GLJ A;  3MED B;  2RKI A;  3N79 A;  3ONQ A;  1JLB A;  3OQ2 A;  3PYG A;  2KFY A;  4Q8F A;  1AW0 A;  1ANI A;  4GKK F;  1WOR A;  2BOA A;  2F9D A;  1EJ7 L;  2AJF E;  2QMU B;  2OFG X;  4X84 A;  3C2P A;  1N2K A;  2AGP A;  1WF0 A;  4DFP A;  2KRR A;  3NOC A;  3HM9 A;  1FES A;  2J6U A;  4TU7 A;  2RH3 A;  4LF9 F;  3A13 A;  2HS0 A;  1O98 A;  5HAT A;  2CJY B;  3CSK A;  1JXL A;  4RNN A;  4G6V B;  4Q7A A;  2XB2 D;  3H98 A;  4TKT A;  4Z7Y A;  3HCX A;  3M8R A;  1SC4 B;  1SJQ A;  4WE1 A;  3NGR A;  5M2P A;  1QJH A;  5H9F K;  3CCQ S;  5HP1 A;  3MEC A;  4RU9 A;  1BXN A;  2O67 A;  4CLK A;  1KEK A;  2RU3 A;  3PRV A;  3ZTQ A;  3TUJ C;  3QGG A;  4C11 A;  1ZTW A;  4FYW B;  3MM5 A;  2E5G A;  2B3T B;  2VKZ G;  1URN A;  3PRD A;  1Q0N A;  2I2Y A;  3B4D A;  3HFK A;  5KFG A;  1K1Q A;  3NBP B;  2YKA A;  4ED1 A;  2V63 A;  2OPQ A;  2RIJ A;  2XS5 A;  1V3R A;  2CQ4 A;  2QLB B;  3MXH P;  2K1R B;  2J9D E;  3D9B A;  3FKB A;  1WNE A;  2RD5 C;  4WFX A;  3KDO A;  2BW7 A;  2A0F B;  3BGO P;  3LOU A;  1CEZ A;  2W5Q A;  4NA2 A;  4B9M A;  4C0B A;  1H98 A;  4QYZ K;  4MKV A;  1Y6V A;  2XMT A;  3ETO A;  4ZG7 A;  3DYA A;  3MWB A;  1M5P C;  4OX9 J;  1V6H A;  3KDN A;  5LOQ A;  2J9E A;  4V1A k;  2AD9 A;  1HQE B;  4USV A;  4AXI A;  4I2Q B;  1RBL A;  4Y0F A;  2WON B;  1HNW J;  1NZA A;  1RTD B;  2UUA F;  4OV1 A;  1RT2 A;  2ROE A;  4ZVS B;  2KRB A;  1AFJ A;  2OI2 A;  3DHX A;  3R3T A;  4EWT A;  3V4I A;  5IC6 B;  1VRU A;  4DCJ B;  2ZC3 A;  1IBK F;  3CIM A;  3GR0 A;  3UNY A;  4H4M B;  4NCG A;  3PV8 A;  2F9J A;  1RTH B;  3JSR A;  4NLT A;  2E9T A;  1L3K A;  4GMK A;  1ULR A;  3HVW A;  1N8R T;  1RWP B;  4ERD A;  4PRF A;  2YH1 A;  5HQL A;  1Y7A A;  2R2S A;  1MU2 B;  4F8R A;  3CJ2 A;  3DOM B;  1TUG B;  5JUM A;  2R7S A;  2MKS A;  3FBF A;  3KLI B;  2LP4 A;  6FD1 A;  4IH6 A;  4IFV B;  4LSN B;  5L39 A;  1EB0 A;  4HTI A;  1ROF A;  4ECR A;  2NZ4 A;  5K4P A;  3OR2 B;  3BSO A;  3V6D B;  1XR5 A;  3EXC X;  4R8U B;  2AWZ A;  4X4T A;  4DSL A;  2VD3 A;  4DPO A;  5T7L B;  2EEY A;  4QW8 A;  1Q86 T;  3CVK A;  4B3M F;  1SQE A;  3AJ1 A;  3D6T B;  3OPK A;  2YKO A;  4K4Z A;  2HHX A;  2V0N A;  4CLY A;  4DFK A;  3K8W A;  4X2B A;  1HD0 A;  1HKA A;  5GAG U;  4DR5 F;  5D15 A;  5DRK A;  1VRT A;  2HZC A;  2VBZ A;  2Y3Y A;  4OI1 A;  3MR3 A;  2EBE A;  2FVR A;  5IV3 A;  2KL8 A;  4O3N A;  4ZIV A;  4WIQ A;  3AAW B;  3GIM A;  2LU1 A;  4OI2 A;  4HT5 A;  1FFS B;  2ILZ A;  3VCD A;  2VQF J;  1WC4 A;  3EGW B;  2YBV A;  2MMY A;  1RA6 A;  3M9M B;  1SKR A;  4YR0 A;  5KG2 A;  1SJ3 P;  2XHW A;  3IXQ A;  4F67 A;  1RTZ A;  2BRL A;  1IKW B;  1OPI A;  2KI2 A;  4O3S A;  4I4B A;  3MCM A;  3NKQ A;  4B56 A;  2W24 A;  1GK8 A;  1RT5 B;  4K5S A;  2HAI A;  2R4F A;  5DM6 Q;  1Z1Z A;  2AYM A;  5LSR A;  3QO9 A;  3CCR S;  3R1H A;  4DV7 J;  3BDE A;  4WYW A;  3SQG A;  1TVR B;  2EI5 A;  2Q43 A;  4EU0 A;  1XNQ F;  2RVJ A;  1DQ8 A;  2VL1 A;  2YWE A;  3PR5 B;  4C8K A;  1YSJ A;  3I56 S;  4URG A;  5T41 A;  1GTH A;  4C3M A;  2J5A A;  3DRP B;  2CZ9 A;  3MCN A;  4MK9 A;  4PAA A;  1GXU A;  1LNQ A;  1YJT A;  3HHL D;  1OY9 A;  2XMA A;  1KNZ A;  1VIO A;  2KFZ A;  2DNP A;  1B7Y B;  4QWC A;  1GEH A;  2C2D A;  2UVW A;  2NPI A;  3BB5 A;  4N7T A;  5D77 A;  2KH9 A;  3DYC A;  3R5D A;  2RRA A;  3MUV P;  4GTW A;  4B08 A;  2WK4 A;  3TOQ A;  4TU9 A;  1MSW D;  3WAX A;  4ZVH A;  2DRB A;  5J2N A;  1RIS A;  5D0G A;  3SFU A;  4EO8 A;  4EGL A;  1FK9 B;  2H9Z A;  3KLG B;  1H6K X;  3CB4 A;  2WB1 D;  3SQO P;  2K8G A;  2M4M A;  1NDL A;  3CJ8 A;  3IWL A;  5B0F A;  4FS2 A;  3DLH A;  3M1V A;  2CNO B;  2X1G A;  3VAG A;  1S9G B;  1UJ6 A;  3NAH A;  1HI8 A;  1R3N A;  2NLW A;  3ILO A;  4HDG A;  1M1G A;  1X60 A;  1VLO A;  3DRS A;  4QYR A;  4NE9 C;  1S1X A;  1G3O A;  2R9L A;  3GG0 A;  3IM8 A;  4B02 A;  3CCL S;  1K8A T;  4DSE A;  1TZ0 A;  1JWW A;  4EUV A;  1NH8 A;  1AUK A;  2HG4 A;  5HO4 A;  3LW5 C;  4OI6 A;  5GAE I;  3BZQ A;  2A6M A;  1T9X A;  2N4D A;  1CLF A;  4KO0 A;  1EAY C;  1LW2 B;  2F8H A;  5IC4 B;  4N8N A;  4ECU A;  3R6G B;  3W1Y C;  7FD1 A;  3CDW A;  1GMU A;  4KGM A;  3BDP A;  1N52 B;  4O3R A;  3FJ2 A;  3D1H A;  3GON A;  4O3O A;  1RT1 A;  2Q6B A;  3IR5 B;  3IAM 9;  1FJG J;  1T3N A;  4DR2 F;  4C8L A;  1T9W A;  2VG5 B;  3VQS A;  4K4W A;  3NGK A;  3FBE A;  1F0X A;  4OHW A;  3SSQ A;  3SCJ E;  4DFJ A;  2ZWO A;  1TKX B;  3ET6 B;  3PHT A;  4F26 A;  3BGL A;  4K4S A;  1LWF B;  4UUW A;  1RAC B;  4PQA A;  2VBW A;  3N6M A;  2XUL A;  3CCU S;  4NLU A;  4DV3 J;  2IM1 A;  4KGK A;  1VJQ A;  3IGZ B;  1R0B G;  4J9K A;  3HSD A;  4J9L A;  4KB7 A;  2FHK A;  2ZNY A;  3TR5 A;  3TZW A;  4ZVE A;  1JIH A;  3CDU A;  1MG7 A;  1ZEF A;  4DR7 J;  2ZH1 A;  4F0H A;  4IH5 A;  3UN5 A;  2MLY A;  3R5B A;  3WX4 A;  3J81 Y;  2F63 A;  1Y3K A;  3QT5 A;  2AGQ A;  3M30 A;  2V4J A;  1EI6 A;  2XHC A;  3DXB A;  3RRG A;  3OSN A;  1YHQ S;  4ZN3 A;  3OXG A;  3N4W A;  3VV2 B;  3CCZ A;  1O51 A;  4DV5 J;  2E9Z A;  3KJQ B;  1N0V C;  3GJT B;  2YKQ A;  1QSS A;  2HMI B;  2CJA A;  3NWG A;  3Q8U A;  5KG7 A;  2L9W A;  4CT8 A;  2KM8 C;  4UTG A;  1VC0 A;  3OL9 A;  1VBZ A;  3VTI A;  2EG2 A;  4NOH A;  2GW8 A;  2YNH B;  3BGU A;  3MTK A;  1FXD A;  4X4U A;  3LH2 S;  3FEZ A;  2VUG A;  4WP3 A;  1T03 B;  2J7U A;  3HSZ A;  1C0U B;  4LBI A;  4NYO A;  4M1K A;  3BDG A;  3NKP A;  3DLG A;  1JLA A;  3H2L A;  1FX4 A;  4PG7 A;  4CLF A;  1HNV B;  2IVM A;  4AFF A;  5B0B A;  5DQH A;  2BJD A;  4B3R J;  3QSY B;  4NEY A;  1U8S A;  2EK6 A;  4DUT A;  1ZOT A;  2C3P A;  3MDF A;  2WVF A;  4OZ3 A;  1LWC A;  1A9N B;  2V8P A;  6FDR A;  2IJN A;  4M94 A;  3DRX A;  2W5R A;  3BYP A;  4FDI A;  3MR2 A;  4KFB A;  4LSZ B;  4DV0 F;  4B3S J;  1C0T B;  3TG0 A;  4N41 A;  4ZCL A;  3ZZ0 A;  1R31 A;  3LO3 A;  4M5L A;  5CQG A;  4WCE Q;  2KG0 A;  3HP6 A;  2R2T A;  3THV A;  2RRB A;  3KG4 A;  4F4Y A;  1UA1 A;  2VFU A;  1NJW A;  4DSF A;  5KFU A;  3VAI A;  2O3D A;  1H38 A;  3OL8 A;  1O99 A;  2UUT A;  1E6V B;  4RUH A;  5J2Q B;  4YDD B;  4J9N A;  1D9D A;  3D3C J;  3HFV A;  4A8O A;  3C8Y A;  2I0X A;  4I1T A;  2DPI A;  5I4M A;  3OFE A;  2C3Y A;  3U1M A;  4JI8 J;  2M7S A;  4DR4 J;  1G7C B;  2N7Y A;  2RUS A;  3H7H B;  4J9Q A;  1IKY B;  5GAG I;  4ED3 A;  1NHU A;  2R7V A;  5A76 A;  1YZ6 A;  3ZZZ A;  4IQM A;  4EZ9 A;  1L3S A;  4F02 A;  4CXK A;  1RTJ B;  2E1A A;  1BHN A;  1DQ9 A;  5E5N A;  1JLA B;  1X8D A;  4DU8 A;  3GV7 B;  4ZVO B;  2B51 A;  3BDG B;  1NKC A;  1CC8 A;  1V5I B;  3EXY A;  3IWX A;  2XY5 A;  3AXK A;  1XNQ J;  2YNH A;  4KAI A;  3ZO7 A;  1Q5Y A;  2GO9 A;  1ZM4 A;  4ZPB A;  1HQA A;  5HQM A;  2B0G A;  2AX0 A;  2FQQ B;  2B4P A;  3L9Z A;  4FF3 A;  4ECW A;  1Q95 G;  2OUG A;  3QQC D;  4YS2 A;  2QSF A;  2OH2 A;  2UXC F;  3Q2T C;  2XO6 A;  4IQX A;  1S6Q A;  1SVD A;  1VQ6 S;  4X65 F;  4DV6 F;  3CUL A;  2V4J B;  2BRK A;  2V8D A;  1X7V A;  3H2V E;  3CTR A;  3NRB A;  1H7W A;  1MW7 A;  4TLQ A;  3TUP A;  4PXB A;  2VH7 A;  4TNO A;  1CJT B;  3MHY A;  5A6W A;  4PUO B;  2J76 E;  2HVI A;  5DG9 A;  3EX7 B;  2UUC F;  2QYG A;  1YG0 A;  3BN7 A;  5SUH A;  2FVC A;  1WOS A;  3MAQ A;  1N48 A;  3IG1 B;  3I6P A;  4JI2 J;  3DKD A;  4JP8 A;  2IJR A;  2YPZ A;  1N6Q A;  4U96 A;  4CH7 A;  2CNK B;  5LMU F;  2CQC A;  1ITP A;  1RDR A;  1XK8 A;  2CPY A;  4L76 A;  3T00 A;  3NKM A;  3IGY B;  2X51 A;  1R8H A;  2DH8 A;  1N88 A;  3PY8 A;  4MK7 A;  1TKX A;  5CHC B;  2ZVS A;  1EET B;  3JAM U;  2E66 A;  4A8M P;  3CCM S;  1TFY A;  2WRM A;  3BJY A;  4ECV A;  3HZE A;  2VG5 A;  4OYB A;  5T14 A;  2X98 A;  4ANE A;  3G82 A;  3CNQ P;  4ZN1 A;  2GSO A;  3OW2 R;  1DAX A;  2YKN B;  4G1P A;  4K50 A;  2YWW A;  3KK3 A;  2VG6 B;  3VAL A;  2E1R A;  3T6B A;  1N56 A;  2GO8 A;  2FJX A;  3QID A;  1U7L A;  4FF1 A;  1LW0 A;  3F73 A;  3BV8 A;  2V4R A;  1IQT A;  2W5S A;  3QT7 A;  4U7U D;  5DQG A;  1NND A;  3C16 B;  1LWE B;  2ATC B;  3CW2 C;  1ZEB A;  1FRH A;  1LXN A;  2DY1 A;  4A4J A;  1OQ6 A;  2GGP A;  1E3C P;  1RU1 A;  3P4U B;  1WEY A;  2KT5 A;  5HAN A;  2RH6 A;  4WFA Q;  1S79 A;  1N36 F;  2Q6C A;  1S1X B;  2QV6 A;  4PXC A;  4CLW A;  2JLE A;  1F9E B;  3QAT A;  5ETM A;  2ERR A;  2KFN A;  5F8N A;  3T02 A;  1NPK A;  1WHV A;  1ZA1 B;  3CWJ A;  1BMQ B;  3MZI A;  5E3P A;  4F2S A;  1SKS A;  2VA3 A;  3GG1 A;  1Q8K A;  4ED6 A;  1N33 F;  3HD1 A;  4BDP A;  1IQZ A;  4HKQ A;  2HQF A;  3WAV A;  4NPO A;  2DGT A;  4OHZ A;  5KOW A;  1NKE A;  4PKD B;  1MWZ A;  4JI4 F;  3ILI A;  1RBO B;  4AL5 A;  5J2N B;  2ZC4 A;  5INH A;  4LF2 A;  1U8W A;  2ZH3 A;  2HK3 A;  2LXU A;  2XO7 A;  9ATC B;  2HHT A;  3CCE S;  1WEL A;  2FZG B;  2XTJ P;  2PMW A;  2GML A;  2V8H A;  2E1M C;  4ED5 A;  3G8S A;  1WKJ A;  1RT4 A;  1WWH A;  1X0P A;  1JJ4 A;  1KHV A;  4ILL A;  1LKZ A;  5LQQ A;  3A8K A;  2IDE A;  1S72 S;  4UQT A;  2VC0 A;  4KYZ A;  1KHK A;  1S49 A;  3W5Y A;  1KHW A;  3N28 A;  1TKZ A;  2F1F A;  3NNA A;  4PZV A;  2BOP A;  4Y00 A;  5GOV A;  1TVR A;  4QPT A;  2W9A A;  4EEY A;  3SQG B;  2ZKT A;  2JEF A;  4CO2 A;  3P6Y C;  3UN3 A;  3QO9 B;  1HI0 P;  1BQN A;  2PN6 A;  3QJL A;  4KV8 A;  1RT5 A;  1TK5 A;  2UXD F;  3BYR A;  3C6T A;  3I82 A;  3D2W A;  2MQL A;  2KN4 A;  4F4W A;  5L0K A;  2F40 A;  4FXV A;  2E5L F;  1EQJ A;  1L3T A;  2RE1 A;  2R8J A;  2FHJ D;  4ZIT A;  3IP0 A;  3CT9 A;  5DGB A;  2K7K A;  5IT9 U;  3I4P A;  3H25 A;  2MKC A;  4DHV A;  2P9E A;  3MEG B;  2EBG A;  2CVE A;  2YNG A;  4YUD A;  5IS2 A;  1OMS A;  4WZM A;  3ZZR A;  3KTQ A;  4DMZ A;  2IFX A;  1VRT B;  3EM1 A;  1R8A A;  4CNZ A;  4KHP J;  2R2U A;  2VDI A;  1R0A A;  1DUR A;  1N5T A;  4CM0 A;  1JXE A;  1YQH A;  2PI4 A;  2P8I A;  3O1L A;  2DIU A;  2NUU G;  2MXY A;  2XWX A;  2CJQ A;  2ABY A;  2RIL A;  2ZZM A;  3A3N B;  4J9U E;  2AEJ A;  2CJ9 A;  2W01 A;  3A12 A;  2O01 C;  3P5T L;  4R8U A;  1NM2 A;  1T9U A;  4NCA A;  3QJP A;  3KJV A;  2ZH6 A;  3BN4 A;  4O4G B;  4CYS A;  1YRX A;  2I5J A;  2RT3 A;  3GJS B;  3R1L A;  2CZ4 A;  4IFV A;  1DRZ A;  1TUW A;  2HQD A;  3GSI A;  3KLI A;  5A2Q Y;  5HMX A;  1RI7 A;  2DGV A;  4C8M A;  1S9F A;  2KZZ A;  2DHG A;  3QLH A;  3LAK A;  3V81 A;  2C28 A;  4LF8 J;  4KKO A;  3UDL A;  2ZH7 A;  2JHE A;  1SKU B;  1SHQ A;  2AX1 A;  2FC8 A;  3H0P A;  3M6X A;  1VK8 A;  1OO0 B;  1FDD A;  1RHU B;  3MPW A;  1QSL A;  2CAD A;  3W60 A;  1XEZ A;  4B17 A;  4DR1 J;  4ECY A;  1RHK B;  2B6A B;  2HNY A;  1ED9 A;  2DEJ A;  3R2C J;  4NLQ A;  2NSC A;  2XGQ A;  4DV7 F;  1W25 A;  2CG4 A;  2AIR B;  3GFX A;  3L09 A;  2WON A;  4QR1 A;  4LF9 J;  3R7N B;  1VMB A;  2YWG A;  2CAJ A;  4J90 A;  1HBO B;  1HQ2 A;  3DYA B;  2GQQ A;  3S7R A;  5IV4 A;  4CH0 S;  1CUL A;  2COL A;  4W4M A;  3W64 A;  1YRU A;  2DK2 A;  2MLZ A;  4WYL A;  4F25 A;  2E1C A;  2GCF A;  4UY8 5;  1NRK A;  2Z4P A;  1AJD A;  1Y5L B;  1TMM A;  2GIQ A;  5B0C A;  2HNZ B;  3GIR A;  5KFJ A;  2EPI A;  3R5G A;  3OVA A;  2G9O A;  1BY9 A;  3B6B A;  1T9V A;  1URR A;  3MAA B;  3BKU A;  3WIU A;  5DG7 A;  2AJ4 A;  4KPC A;  3SIP B;  1FFG B;  3NXZ A;  4L3N A;  2W1B A;  3BR9 A;  3F56 A;  2ZD1 A;  5HVF A;  1KOH A;  2DHA A;  1OIA A;  3CCW A;  2CFX A;  4RUC A;  4C11 B;  4B3M J;  2W2N P;  1VQ9 S;  1HLW A;  4DR5 J;  2GFF A;  3B78 A;  1XMQ F;  3V6J A;  2POK A;  5HN0 A;  3CXC R;  4P72 A;  4NEZ A;  2J9D A;  2W8S A;  2Y1R I;  2QLJ B;  3TNV A;  2IAJ B;  3K57 A;  4PQU B;  4MKB A;  5LRM A;  4L73 A;  4WXO A;  2E5H A;  5KFX A;  4YN3 B;  1S57 A;  3LAL A;  5HL7 Q;  4P71 A;  2FJV A;  3NKO A;  3QJJ A;  2DHS A;  5K8P A;  3T3F A;  3W2W A;  1UMJ A;  3ITH A;  1FKP A;  3IGV A;  5HVG A;  4BWM A;  4XO0 A;  2EFP A;  2MZS A;  2BAB A;  4Y2A A;  5JXS A;  1B70 B;  3H20 A;  4ATN A;  3OVS A;  3OUY B;  2HGL A;  1OPZ A;  4OX6 A;  4JB8 B;  4DS5 A;  2I9S A;  2QL5 B;  1B7F A;  1N0U A;  1JLB B;  2HIY A;  3FSY A;  4NXN F;  2HHV A;  3MED A;  3M2R B;  4Q2M A;  4NLS A;  2QE5 A;  1T0T V;  2B8P A;  2RNE A;  4ICL B;  4DJB A;  1QSY A;  3UD4 P;  1A6L A;  1X4H A;  2G13 A;  1FHT A;  3FEX B;  2BJ7 A;  4HTJ A;  4ZJQ A;  4RW6 A;  2D7S A;  2OGU A;  2CQP A;  2AF6 A;  4R25 A;  4DPX A;  1HNX J;  2M8D B;  4LF6 F;  1CJU A;  4LIW A;  4RW6 B;  2E9R X;  3WX8 A;  2VC1 A;  1Z4U A;  4F0M A;  3MM6 A;  3TAP A;  5HRO A;  1VQL S;  3MK2 A;  4DL3 A;  2VFR A;  2ZUA A;  2LVW A;  1QD1 A;  2WVC A;  2EWH A;  3JTO A;  4DCP B;  2B7C B;  2PDA A;  3W8P A;  4NRT A;  3CO0 P;  2QMW A;  3BDF A;  4FF4 A;  2HS3 A;  5SZT A;  3VVT A;  4X66 J;  4TVA B;  5B0A A;  4P73 A;  1FKP B;  3CMR A;  3P96 A;  3W2W B;  1S7H A;  4PPD A;  2H4Y B;  3RUB L;  5DDO C;  2EVZ A;  3KHL A;  3RRH A;  1OSD A;  1U2F A;  3D54 A;  3W66 A;  4B3O A;  4JV5 F;  5E41 A;  3CD6 S;  3KLH B;  4L72 B;  4FN5 A;  3W9H A;  4NRU A;  4UST A;  4RNM A;  5ETK A;  4FBT A;  4JI3 F;  1K0V A;  3NKN A;  3NGS A;  2LA4 A;  4JBC A;  1K7H A;  4NZ6 A;  4XPE A;  3H5U A;  3BF4 A;  1ZET A;  1XNR J;  1AJB A;  3X3U A;  2LDI A;  4NXM F;  1FJG F;  3PJW A;  1NK6 A;  1M5V C;  2AJQ A;  2MZQ A;  1RAH B;  1CVJ A;  3S6E A;  4DN0 A;  1FNX H;  2B9Y A;  4PWD B;  4IRC A;  5FDL B;  2Y1J A;  1ZTT A;  2CYY A;  4P52 A;  2XLI A;  3VWS A;  5KFT A;  2IPO B;  2IYI A;  1TU0 B;  3AXM A;  3LGN A;  4FYX B;  2RQC A;  3J81 U;  2QA4 S;  3HPO A;  1WTB A;  1U1O A;  1S1U A;  4B3T F;  5HRT A;  2I38 A;  3AFG A;  1AJA A;  3GFZ A;  3CC4 S;  1HW8 A;  1B0T A;  3K89 A;  3JSM B;  2BJ3 A;  3ZNJ 1;  5JVH Q;  1CUL B;  1X9M A;  1XER A;  3NKR A;  4XPC A;  1SL1 A;  1C4A A;  3K58 A;  3IAS 9;  1PSD A;  4OQJ A;  5ETV A;  1CSJ A;  4FP9 A;  4PG4 A;  5J1P A;  4A46 A;  3W61 A;  3JSM A;  1Q8L A;  1TV6 B;  1H72 C;  3KFW X;  4MJK A;  2V8V A;  3KLF B;  3IRW P;  1I94 F;  4WZQ A;  4QJV A;  2AKW B;  4YR2 A;  4DV1 J;  3DU5 A;  3BM7 A;  5KG4 A;  3PJ9 A;  2B6A A;  2HNY B;  1IN0 A;  2BXJ A;  3PDN A;  3VR1 A;  2VOO A;  3PW0 A;  1WOO A;  5E0O A;  2NPF A;  4QIV A;  4HHH A;  4OMF G;  3W2V A;  4PWD A;  4JI5 F;  4B9L A;  1KHL A;  1AUD A;  3EDQ B;  1YGY A;  2U2F A;  3CDB A;  4KKO B;  2EFQ A;  4USK A;  5GMD A;  1IBL F;  5KT4 A;  3AOB A;  3CME S;  4Y34 A;  3GJR B;  4DR4 F;  5BR8 J;  2LEA A;  4ITS A;  4CO5 A;  4Y2I A;  2NQP A;  4YB6 A;  3FBC A;  2QT7 A;  3TJ8 A;  5DLG A;  2DR6 A;  3KJV B;  3AD9 C;  1PO6 A;  1RCX B;  3KKF A;  4NA1 A;  3ZC4 A;  2C3M A;  3G6V A;  3G71 S;  1D0E A;  1FJE B;  3D0H E;  2IRU A;  5D0R A;  5IWA J;  1XTZ A;  3KLH A;  3W5Z A;  1N5Q A;  3MCS A;  2CXE A;  2D3O R;  1ZED A;  3AOA A;  4B3O B;  1XC9 A;  1QE1 A;  2Z56 B;  4CZC A;  1R0A B;  2CRL A;  2MKJ A;  1GTE A;  1M5S A;  2H3E B;  1S1V A;  3L7U A;  1U2C A;  5BJR A;  2N3L A;  2WVE A;  4WBF A;  5HI7 A;  2XMM A;  3SCK E;  1VQN S;  3AD8 C;  1V9O A;  5F8M A;  4DZ6 A;  1QAY A;  1E6Y A;  1HNI A;  1U09 A;  1WJ9 A;  2BKO A;  2DGX A;  2V2V A;  3ENQ A;  2R8G A;  1KVI A;  2XGP A;  1ELY A;  3AHP A;  2KJV A;  2QA2 A;  3MM6 B;  1KVJ A;  5LRN A;  1CJU B;  3LAN A;  3NEK A;  1PIE A;  3GPA A;  3PVX A;  4DV3 F;  4KV8 B;  1T8E A;  4NXM J;  2R8K A;  4L3K A;  1TK0 A;  1FRK A;  4LF6 J;  3FGV A;  3QBC A;  1X9S A;  1T05 B;  1KRP A;  1HD1 A;  5IJS A;  4ICL A;  1LXJ A;  3AQP A;  2FJA B;  2XEX A;  1KOO A;  1RKI A;  4FXW A;  4BWJ A;  3TEH B;  1TKZ B;  1ARO P;  3H2U B;  2ACM A;  3SDE B;  4YB7 A;  1TK8 A;  2XCA A;  4GO5 X;  1HPZ B;  3OHB A;  2ZOM A;  3DOK A;  2FDN A;  1IUJ A;  3OUY A;  3EPG A;  3VQT A;  4HYK A;  4MIA A;  2DHH A;  3ITH B;  2FGO A;  2DGO A;  2KXF A;  3EWG A;  1UVN A;  3UPF A;  1WDT A;  1D8Y A;  1UKU A;  2OEM A;  3C46 A;  4MHX A;  2F5G A;  3BPS P;  2FB0 A;  3WQP A;  1RT6 B;  1SUQ A;  3QRR A;  3AQO A;  2ZZT A;  4USM A;  3PX0 A;  2RAQ A;  2FGC A;  4LFC J;  1RAG B;  1X4C A;  2HYI B;  1HMV A;  1N33 J;  1KTV A;  1NK9 A;  2WHO A;  1RAF B;  3HFZ B;  4Z7C A;  4K4Y A;  1I6J A;  1SIW B;  4DL0 C;  3CC2 S;  3RB4 A;  2CQI A;  1ELX A;  1RWU A;  4ECT A;  2IC3 B;  3L95 X;  3FVY A;  1GX5 A;  1JLG A;  2YTC A;  4IFY B;  3Q8S B;  2A3J A;  1DFD A;  3FCW A;  3MAA A;  2WOM A;  3S1T A;  3EZO A;  3CJ4 A;  2FVS A;  1Y5N B;  1ALJ A;  1SJ1 A;  4OI4 A;  3U1L A;  1FA0 A;  1F2H A;  1FE4 A;  3C16 A;  1GX6 A;  3UVJ B;  5GRR A;  4I7F A;  1DHM A;  2G1D A;  3B54 A;  2XYH B;  2HVE A;  1HBO A;  4LRF A;  2YQ3 A;  3T1Y F;  1Y0H A;  2HPU A;  3RBD A;  1FVS A;  1XR6 A;  1ZAW A;  2PI5 A;  1WTF A;  1LW0 B;  2HLU A;  3AOD A;  3BGR A;  4OI3 A;  3KK2 A;  2FY8 A;  4G65 A;  2J6T A;  4KH0 B;  2YH0 A;  3RBE A;  2RS2 A;  3RAQ A;  2VG6 A;  2G0J A;  4UOC A;  4XAK A;  3IGN A;  4CYR A;  3UDC A;  5KFS A;  2QO3 A;  3HVA A;  2KXH A;  4OZ5 A;  1UPP A;  2XQC A;  2AMC B;  5LSL A;  1N34 J;  4UOF A;  3HT0 A;  4LRA A;  1EET A;  3Q2S C;  3T1A A;  1MNE A;  2KT2 A;  4FNI A;  2D9P A;  3SCI E;  3PKM A;  1JLQ B;  4F7V A;  3N0V A;  1S1W A;  1L3U A;  4C8O A;  1FWK A;  3OLA A;  3W9I A;  1WHW A;  1X0F A;  2JC1 A;  2WSE C;  3OTB A;  2HIQ A;  3CJ5 A;  2I5J B;  1KKH A;  1P9Y A;  1OYD A;  2NXU A;  3LTO A;  4HL9 A;  4I64 A;  1PJ7 A;  4OLO A;  1YBU A;  2MQO A;  5I3Q A;  2FJW A;  5IJQ A;  1CS4 B;  4YQW A;  5TJ3 A;  5DLF A;  2SXL A;  2QSW A;  2BVZ A;  1GT8 A;  4WTO B;  5CXT A;  2ZH8 A;  2P5V A;  4PUO A;  4C8Z A;  4NLY A;  2UXD J;  4NLO A;  1BD6 A;  2XYP B;  3MPU B;  4DCO B;  4ZIW A;  2HFU A;  2W4C A;  1PIL A;  2BAN A;  3IRX B;  4KGZ B;  4B9N A;  1LFW A;  1PG5 B;  1HA1 A;  1RLC L;  1AB8 A;  2IDL A;  2YNG B;  3D68 A;  3LUY A;  1FI4 A;  3WBH A;  1BWV A;  1SJF A;  2C2R A;  1X9W A;  2NZC A;  2NR0 A;  3Q83 A;  1RAI B;  4P7T A;  2NRE A;  4OV6 A;  1R8C A;  2W4P A;  5GVQ A;  3OTD A;  4ZP8 A;  5DZ6 A;  2GJ2 A;  4NYP A;  2QTW A;  4DX6 A;  1FEE A;  3V5R A;  3FSX A;  1QUV A;  1AT1 B;  2DGU A;  4QCL A;  2JLG A;  4MT1 A;  4JV1 A;  2GSU A;  3DGP A;  4DUY J;  5HLF A;  1DZ5 A;  4JI5 J;  1KHN A;  4K4T A;  2UZA A;  3KK1 A;  2MB0 B;  3PO4 A;  4ELV A;  3VF0 B;  4GTZ A;  5KG6 A;  2KKH A;  4N76 A;  1Q78 A;  2QG9 B;  3QFH A;  4B9U A;  1GQE A;  2GVD B;  3WC0 A;  4WF9 Q;  2KU7 A;  2R7U A;  3NLC A;  3IO1 A;  1PC5 A;  2IJF A;  1LEO A;  3LA0 A;  2HRT A;  4TYB A;  3QT8 A;  1ZA2 B;  5A8W B;  1I5O B;  3NGT A;  1SI9 A;  3VAH A;  1RT4 B;  5DLW A;  3RW7 A;  1E6V A;  3AB2 B;  3Q3Q A;  5KFR A;  4ZLN A;  1X4G A;  2HHW A;  2DRD A;  4M5M A;  1WC6 A;  1NK7 A;  1FEH A;  1VOM A;  4TU8 A;  4B3T J;  5F8L A;  2ASY A;  2LFV A;  2A2C A;  2RHS B;  4WU2 A;  4Z2X A;  4ZMM A;  2UV8 A;  5AJ3 F;  4IUF A;  1WKK A;  2YWH A;  4AXJ A;  2BE7 D;  2EW9 A;  4IOA Q;  4M8L A;  4KFB B;  1NHK L;  3OR1 A;  4P2X A;  3KXD A;  1JMT A;  3OLB A;  1OS5 A;  2LCW A;  3O3L A;  2XNR A;  2RS8 A;  2VJV A;  4ES1 A;  4J9V A;  4IG3 B;  2GA7 A;  2ZDO A;  4KHR A;  5A8R B;  3D5M A;  5M2U A;  2AW0 A;  4ID5 B;  1KLM B;  3VGV A;  5L38 A;  1HNV A;  3PAC A;  3ULH A;  3M7V A;  1F9F A;  3C14 A;  4MMO A;  3T5J A;  3D28 A;  3H42 A;  1SCJ B;  4RLE A;  4LF5 J;  2DGQ A;  4F4K A;  1XNR F;  1C0U A;  4NLR A;  4CXU A;  5KFA A;  1RUS A;  2MZT A;  1YLX A;  4DL4 A;  1IR2 A;  1T03 A;  3NS6 A;  2FJD B;  2GIF A;  5EX3 A;  2XR9 A;  4QWE A;  1LWE A;  2VB6 A;  1FRL A;  1T02 A;  1YJV A;  2WCX A;  2VBY A;  5GAH I;  2CPD A;  4P10 A;  4ZS6 A;  3F41 A;  5G4D A;  3OTO F;  2P6S A;  2HMI A;  1K0T A;  2V4Q A;  4FF2 A;  1U1R A;  4YY3 J;  1UJ5 A;  5E3R A;  4RWW A;  5C24 A;  3PX4 A;  4F2R A;  2PSZ A;  1RWW B;  1P1L A;  4QPX A;  5RUB A;  3TX0 A;  3KK3 B;  2F4V J;  3BQ0 A;  5K8O A;  2DT9 A;  3CJ3 A;  4F3O A;  2K7J A;  3G82 B;  3IMQ J;  4NL5 A;  4JI8 F;  2P6T A;  1YZ7 A;  5DET A;  2F7V A;  4LQ9 A;  2J8A A;  1H0H B;  2IRX A;  5JVG Q;  2JEI A;  1X5P A;  1EIY B;  2LXF A;  1X4E A;  3HUL A;  2DCL A;  1C4C A;  3FBB A;  4OZJ A;  4QU6 A;  3MOZ A;  1RAA B;  2LLZ A;  1J5E J;  2CQD A;  3MR5 A;  4A8F A;  3G6E S;  2P2C B;  4DI6 A;  3J7Y I;  2FLN A;  2DNQ A;  3GCW P;  2J0Q D;  4EBE A;  1LWF A;  2XMW A;  2WB4 A;  4Q45 A;  3BSC A;  3ET6 A;  3EGV A;  4ED7 A;  2GSN A;  3T01 A;  2ALY B;  2LQ9 A;  2YXL A;  4YEA A;  3TJ9 A;  2HZV A;  1CJT A;  4MK8 A;  1I1G A;  2E5I A;  4C8N A;  1NJZ A;  1KN6 A;  1RK8 A;  2X1A A;  1HIY A;  5H1S V;  4M5J A;  3RBX A;  1WEZ A;  2HLT A;  1PJ6 A;  3HKZ D;  3LPY A;  1Q16 B;  1S6Q B;  1MMN A;  1MMD A;  1VYA A;  4LUB A;  3ZFV A;  2NSB A;  4NI2 A;  1PKU A;  7FDR A;  3X1L B;  4QYZ J;  1RU2 A;  3UCG A;  4KO0 B;  2Y1L B;  2ZH2 A;  1E2S P;  1REV A;  2E7X A;  4WKY A;  2V94 A;  1U6F A;  3MFH A;  1TQL A;  3GP9 A;  4OX7 A;  4ED0 A;  3M9O B;  3MD1 A;  3R5J B;  4BC9 A;  2CPF A;  4A48 A;  2C3U A;  3DRY A;  5E3Q A;  1V5V A;  3KYL A;  1ANJ A;  3UN2 A;  2GQC A;  4U95 A;  5K20 B;  1VR6 A;  4H4K C;  1ED8 A;  1WC1 A;  2EK1 A;  4CNY A;  5E3C A;  1U49 A;  4LMZ A;  4X4P A;  1RWO B;  3T9Z A;  4NLG A;  2B56 A;  1HBM A;  1S10 A;  1RTJ A;  3DRS B;  3NS7 B;  1U4B A;  1T9Y A;  4U67 Q;  2YPY A;  3TJA A;  4ED8 A;  3SZZ A;  3MI7 X;  1X4B A;  5A8R A;  3K5M A;  2VQR A;  2J0S D;  3K5O A;  3OFF A;  1IKY A;  4Y6I A;  5KT5 A;  1SC1 B;  1D9F A;  5ETT A;  2WVB A;  4DX8 H;  3M1V B;  1KH5 A;  1YX2 A;  4D3H A;  3NP5 A;  1H74 A;  4CH1 A;  2M70 A;  4ETZ A;  4NMX A;  3M8Y A;  2HQ3 A;  3KLG A;  5KT7 A;  4OJ3 A;  2ANH A;  2F65 A;  5J2Q A;  5L9X A;  4P6Q A;  3S01 A;  4X65 J;  4DV6 J;  1ZZF A;  1AFI A;  4LF4 F;  4ZVQ B;  1EQ0 A;  2HFZ A;  4BBY A;  3U02 A;  2OTJ S;  4MY4 A;  1X4A A;  4MFB B;  5DDQ C;  3CCS S;  4DLE A;  2XCP A;  1RZM A;  3GMG A;  4YY3 F;  2GX8 A;  4ID8 A;  1UET A;  4J9O A;  1Q82 T;  3SSR A;  1GFW B;  1NSQ A;  2OP5 A;  4UOG A;  3E3X A;  4XDD A;  3D0I E;  4GVB A;  1JNZ B;  1RAD B;  4AUK A;  5HMY A;  1M1K T;  4CYU B;  3R5A A;  3MR6 A;  4CM2 A;  3AB4 B;  1UZD A;  3D6H B;  2AGO A;  1N34 F;  1LWC B;  2JZ5 A;  2N3O A;  2N4C A;  5AE3 A;  3LWL A;  3DPC A;  1R8P A;  1ZAV A;  2XS2 A;  1D3W A;  3DLK B;  1JJC B;  3DGP B;  4NWB A;  2C2O B;  4RO0 A;  5BYQ A;  1ZM3 A;  4C3L A;  1FKO A;  2KM8 B;  1HWL A;  4OZ1 A;  4LF7 J;  1QUP A;  1WF2 A;  4E2F B;  1N32 F;  3DNC A;  4KQZ A;  3Q0A A;  2DR8 A;  2ZVI A;  3DXS X;  1Q53 A;  3E51 A;  3ICL A;  3LGM A;  1RB0 A;  5LJ5 Y;  5CD4 A;  1URA A;  2DNR A;  2C2N A;  2QGF B;  4CIO A;  1CC7 A;  4CLL A;  4ZHR A;  4F4A A;  4HI2 A;  1U1K A;  5FII A;  5U47 A;  4HLB A;  2GIR A;  1UEU A;  3I87 A;  1EAR A;  3Q8P B;  3QRP A;  3DOL B;  2EFN A;  3FQL A;  2JH3 A;  4DV5 F;  3AOC A;  2IBK A;  4C97 A;  4CDI A;  4W92 B;  1YJU A;  3LQV A;  1EW8 A;  2W5X A;  4MIV A;  3M30 B;  2LEB A;  3SV3 A;  4EZ6 A;  1PJ5 A;  3NMR A;  2M3D A;  1NJY A;  4YB1 P;  3TWZ A;  2F8E X;  1MN7 A;  4PEO A;  4PG5 A;  3OR2 A;  1S12 A;  3D7S B;  4XK8 C;  3CD7 A;  2VKR A;  5D6G A;  1O0P A;  1TUV A;  3Q8Q B;  3HT3 A;  1T3O A;  1SL0 A;  5AE2 A;  2XYG B;  3GV5 B;  4P2S A;  5KG3 A;  1JLQ A;  4ELU A;  2CIM A;  3PTW A;  4Z37 A;  1ZZN A;  5L0E A;  4YHH F;  1VBK A;  4H4M A;  4NCG B;  3CIZ A;  5C2G A;  3PW5 A;  3I0S A;  5IT9 Y;  2D74 B;  1RT1 B;  2KYZ A;  4Q43 A;  2VV5 A;  2HFN A;  1DBD A;  3QWU A;  1Y10 A;  2MST A;  2QYC A;  3BO4 A;  5L1K A;  4BHQ A;  2YY3 A;  2KG1 A;  2FHO B;  5LMN F;  4ZG9 A;  1BQM B;  3JAM Y;  2G9Y A;  1DTQ B;  1LW2 A;  3GR1 A;  3BGR B;  4K7Q A;  3KG0 A;  1NDC A;  2RDD A;  1VDH A;  3MPV A;  4DUZ J;  2W5V A;  1UFW A;  1KTQ A;  3KMS A;  3QGI A;  3R7B B;  1WG4 A;  3MR7 A;  4CLZ A;  8ATC B;  3QZ7 A;  3AA8 A;  1W2I A;  2UVU A;  2MQQ A;  4N5S A;  1KWM A;  3O6Q A;  2DNL A;  2R7R A;  1HNZ F;  3CJS A;  2FJE B;  2JVR A;  3L4B C;  2DXF A;  2BDP A;  4X4Q A;  4KHM A;  5KFC A;  3BKF A;  2WBR A;  5IT0 A;  2OPQ B;  4DSJ A;  2HBR B;  1U1P A;  2AJ0 A;  3IM9 A;  4FDJ A;  1OSC A;  4A8Q A;  4B9T A;  1IJF B;  2HFV A;  2AJ2 A;  4OYW A;  5J2M A;  2DR5 A;  2KJW A;  1S9G A;  2V34 A;  1Y9O A;  2FLO A;  3W7B A;  3J7A N;  1FSU A;  4J91 A;  3PW2 A;  2DKO B;  2BQU A;  1HMV B;  2UUW A;  1XR7 A;  1U1N A;  1HJK A;  3BEG B;  2V69 A;  5HP1 B;  1IWA A;  1FK9 A;  2V8G A;  3I32 A;  4PYA A;  5HBM B;  3DM2 A;  4FS1 A;  2Y0S D;  1RT6 A;  2V9W A;  1LK5 A;  1SPB P;  1YTY A;  1KFS A;  1TEL A;  1NJX A;  1NU4 A;  1YVF A;  2UXB F;  1EKR A;  2PFF B;  4IR1 A;  4TYA A;  4LR2 A;  2PMH A;  1U24 A;  3JSY A;  1SXL A;  3KD8 A;  1VBX A;  4ZCM A;  4KTQ A;  2OIH A;  3M6U A;  3DRP A;  4IO1 A;  1VGY A;  3LXQ A;  1HPZ A;  1WC0 A;  5CAA A;  3FMB A;  3SDE A;  3CF5 Q;  1Z2Z A;  3KJN B;  3LAM A;  2ROP A;  1BUX A;  4NAS A;  2E7V A;  5LL6 d;  3T5H A;  3QAU A;  2RKI B;  3M9N B;  2YQ0 A;  2E44 A;  3F44 A;  1AJC A;  3TUZ C;  4DQQ A;  1B99 A;  2VIC A;  2W2P P;  2XNQ A;  5A0Y A;  4N56 A;  1XMO J;  3G6X A;  4KGX B;  5EGE A;  1DAR A;  2CQB A;  1B64 A;  1XMO F;  3T19 A;  2CWX A;  2WBM A;  4LRE A;  1ELO A;  4FYV B;  4DV2 J;  2WSF C;  3B8H A;  1RA7 A;  2CUY A;  3DHW C;  2QEX S;  3ADA C;  1E6Y B;  1HNI B;  4ZVR B;  1TL5 A;  4FVC A;  2W25 A;  2Z2Y B;  3KJF B;  3GB0 A;  1OQ3 A;  3HDS A;  5KT3 A;  3IWN C;  2ZM6 J;  4F4Z A;  2HND A;  3GWC A;  1HAR A;  3VZI A;  2ADB A;  4L6V 3;  5K14 B;  3GFY A;  3I96 A;  2Y1I A;  2YWK A;  1RWM B;  1S1V B;  4I68 A;  4DPY A;  4Y2C A;  1IXK A;  3V4M A;  1QE1 B;  2HZA A;  3Q86 A;  4GTY A;  5ADZ A;  1F6T A;  3AH6 A;  4B9S A;  2QZU A;  1U2R A;  3KG1 A;  2O66 A;  5GAD I;  1SIZ A;  3VAK A;  2H51 B;  3T5K A;  2C42 A;  2BE2 B;  3V6D A;  3M2U B;  3ELH A;  2GJI A;  2AYE A;  3OTE A;  4OZ2 A;  1HNW F;  1ALI A;  4E98 A;  1VQ4 S;  4C3K A;  5C7P A;  4ZCK A;  4DQS A;  2W4D A;  1EX8 A;  1KS2 A;  1UP1 A;  1NCL A;  2AZ3 A;  3DOM A;  4MYU A;  3WZ0 A;  4QW9 A;  4ZLP A;  1TKT A;  4ILM A;  3D6F B;  4I69 A;  2ACY A;  3MK0 A;  3SEO A;  4I2P A;  3UDE A;  3AJ2 A;  2DNZ A;  1M0S A;  1RCO B;  2CNN B;  2HRY A;  1VRU B;  4HI1 A;  5F0U A;  5HK4 A;  3ZZY A;  2AQ4 A;  2UU9 F;  3NWR A;  3Q8Y A;  2OKQ A;  1X31 C;  2OSR A;  1FO1 A;  3TUI C;  3IC1 A;  1FCA A;  2PA8 D;  3O44 A;  5F8I A;  4YFU A;  1IJE B;  1TV6 A;  4J9P A;  1S77 D;  2KZM A;  1ALH A;  2ZNZ A;  5KOX A;  3K17 A;  2AEF A;  3H5S A;  4ZVU B;  1NK5 A;  4DPW A;  2CNL B;  4M5K A;  4XDC A;  3CJQ A;  3I9Z A;  1F5A A;  1EW2 A;  3QWP A;  3AJD A;  1ZM9 A;  3LGH A;  3EPI A;  1S0M A;  2FIU A;  2RDJ A;  3HK2 A;  3FDS A;  4ZVP B;  4NML A;  2MQP A;  3QFW A;  2IMW P;  4HEA 9;  4NLD A;  2HWI A;  2K1R A;  2CPX A;  4Q5V A;  1Y3J A;  2M2B A;  4NXN J;  1FER A;  3NBP A;  1NDK A;  2YQ1 A;  1UTA A;  4CCH A;  1RWN B;  3MK1 A;  4AE5 A;  2OTL S;  3MM5 B;  5F8G A;  4UPK A;  5DLV A;  3EZ5 A;  1NB2 A;  4RW4 A;  3TA1 A;  3JTP A;  3M32 A;  2G2O A;  3WC2 A;  3RTV A;  2D3U A;  5IQ6 A;  4G1I A;  5C25 B;  1J5O B;  2UP1 A;  4KM4 A;  4HHJ A;  2DTJ A;  1UJ4 A;  1RHQ B;  2ILY A;  3G8T A;  3HHL C;  2GC8 A;  3THT A;  4Y2M A;  2GLQ A;  1T94 A;  4QQB A;  4O44 B;  1Y00 A;  4V19 J;  4UPL A;  5L1L A;  3FK4 A;  4I67 A;  1EJJ A;  1FRI A;  1HHQ A;  2XMK A;  2GNK A;  3NAI A;  3LP0 B;  3RBZ A;  3LPE A;  4MKY A;  1U6B A;  1J5E F;  4N77 A;  1H2T Z;  4WXW A;  3TRG A;  2HHH F;  1P8G A;  2XRG A;  4H4O A;  3TAR A;  4YR1 A;  4G1Q B;  1NH7 A;  1F3F A;  1VQS A;  3IN5 A;  2MY7 A;  2F4V F;  3BO2 A;  4DX7 A;  5AJ3 J;  3RR7 A;  1UFL A;  4CI0 B;  3H4B A;  2NXN A;  4LFA J;  3POT B;  1G2E A;  2G0C A;  3CCV S;  2OD6 A;  2HVH A;  3BSA A;  2DD8 S;  3W9J A;  4GTX A;  2XLK A;  1U0S A;  2L48 A;  4HHU A;  3M2R A;  3BQ2 A;  3CPW R;  4WKR A;  1N5S A;  2KB2 A;  3BS9 A;  3EVO A;  3I4H X;  2X3D A;  3K59 A;  1UWA A;  3JS9 A;  2F8M A;  2IIH A;  4R0J A;  2QRR A;  4CRJ A;  5HVH A;  2NCK L;  1YBT A;  4DL6 A;  4KJI A;  2DIS A;  2H4W B;  4O3P A;  2L41 A;  2OPP A;  1N32 J;  4QIF A;  4S0M A;  5E33 A;  3IS9 A;  1RXO B;  2J7K A;  5KFN A;  4OYA A;  5H9E K;  3NL0 A;  2DR9 A;  5HJY A;  5A2Q U;  4JOU A;  4URS A;  3FEY B;  4PQU A;  3B5Q A;  2IAJ A;  2QJ3 A;  2MYF A;  2ZWP A;  4CLT A;  4GKK J;  3RR8 A;  1MRO B;  3HO1 A;  3DC2 A;  3JYT B;  2FTR A;  3MPY A;  1D8Z A;  3UWT A;  1FD2 A;  4IO9 Q;  3R7S B;  3Q8V A;  1FVQ A;  1CJV A;  1VLY A;  2RQK A;  3TQE A;  4FBU A;  4ECX A;  2EFO A;  1ZH5 A;  2IUC A;  3IBF B;  5LXR A;  1VQO S;  4DG1 A;  5EWG A;  2ZD1 B;  5K9F A;  4K4V A;  2BMB A;  4B9V A;  5CYM B;  3E2E A;  1WC3 A;  3CD0 A;  1XN9 A;  5B08 A;  2W2O P;  1PCA A;  3ISZ A;  1RWX B;  4LFA F;  1HQU A;  2JNJ A;  3OL6 A;  2GHW A;  1IM6 A;  4OZL A;  2HNZ A;  4IRK A;  2GA3 A;  1VJW A;  5LIA A;  4RW8 B;  3QRQ A;  3H40 A;  2EXU A;  2IY5 B;  2KXN B;  2BUN A;  3UW1 A;  2BQ3 A;  2MGZ B;  1QAJ A;  2LU2 A;  1NXI A;  2YKM A;  3T41 A;  2YNI A;  1R6V A;  2UVR A;  2CQ2 A;  2HHP A;  2BKP A;  4O4R A;  3EVM A;  3MUT P;  1YIT S;  1KQS R;  3BGF A;  1H7X A;  4UUX A;  4AND A;  1K9M T;  4USU A;  7AT1 B;  4P9S A;  2B5J A;  2MJN A;  3W3S A;  3SCL E;  1NZ8 A;  4ECS A;  2WZ1 A;  4MTP A;  4K59 A;  5LXY A;  3NNC A;  5CH7 B;  1Q79 A;  3M8Q B;  3PYF A;  2IVF B;  2RB7 A;  5K8N A;  3IFE A;  4H54 A;  5KFB A;  1P9Q C;  3DGV A;  3KUE A;  3N01 A;  2RUG A;  1KSP A;  2JFD A;  3KUH A;  2A10 A;  3MMC B;  1N5Y A;  4V19 X;  3NOG A;  2W2M P;  1IVZ A;  3QLH B;  3V81 B;  4C0O C;  3FCH A;  2YKP A;  3HVR A;  5F3Z A;  1E1Z P;  1FRM A;  1RP5 A;  4ZA1 A;  2M88 A;  3T9N A;  2ZUG A;  3C6U A;  4FDF A;  2KVQ E;  1MWQ A;  2B4O A;  4KBI A;  1IR0 A;  1ICE B;  1NSP A;  4OYM A;  3BQ1 A;  4O4G A;  3DLE A;  1CQM A;  1YBA A;  4ZP7 A;  4USH A;  4JI1 F;  1C1B A;  1KH7 A;  4U8Y A;  1JKH A;  2L3M A;  3M8P A;  3OV7 A;  2HHU A;  3BDH A;  2AV5 A;  2FYX A;  3FUY A;  4PYD A;  4MH8 A;  2UUA J;  4Q44 A;  2D3O 1;  4PWW A;  2D9O A;  2WVD A;  3M6V A;  4NWX A;  4I0W A;  2PE8 A;  3G6Y A;  2AP6 A;  1KON A;  2XC9 A;  2OJ3 A;  3MEG A;  1WG5 A;  3HHE A;  3SXL A;  3KMQ A;  1HWI A;  1FWP A;  2AHO B;  2C2K B;  3VZH A;  5A8K A;  5KFW A;  2VG7 A;  1TL1 A;  3L7P A;  1LOU A;  3U7J A;  3DLL Q;  2VF3 A;  3V6K A;  2ASL A;  1NUE A;  1KC8 T;  3C6T B;  3GFH A;  1U0H A;  3MEE B;  2CDR B;  1B0V A;  3M6W A;  4IYQ A;  4DR6 J;  1RAB B;  1EHW A;  3RG6 A;  3MUM P;  1BQN B;  3EMT A;  1D9A A;  3DCA A;  3EZU A;  2W2Q P;  2G0I A;  4LVO P;  4UF4 A;  5KFY A;  3N9U C;  4DU7 A;  2V2K A;  2VPX B;  4NLW A;  4RJV A;  1T9T A;  1QAX A;  1YRT A;  2DNO A;  1J27 A;  3K2Y A;  1AZS B;  1RHJ B;  2HK2 A;  5FLX Y;  1RTI A;  4ENO A;  5C5J A;  4QWD A;  3JQK A;  2H5J B;  2F4F A;  3KLE A;  3SZ2 A;  3GIL A;  1NME B;  3ZZT A;  1B4S A;  2UVV A;  1S1T B;  1SBR A;  3RYL A;  4DBQ A;  1D09 B;  2HAF A;  2JWN A;  5F41 A;  4DS4 A;  3TAQ A;  4DV2 F;  3R8Y A;  4HDH A;  2J0X A;  3GII A;  2QA1 A;  1VC5 A;  3MTJ A;  4W98 A;  2Q66 A;  2XLJ A;  3LP1 A;  4L75 A;  4P75 A;  3N5B A;  1VQY A;  1ALK A;  5F3T A;  1P49 A;  3LP1 B;  1VQP S;  5ETQ A;  2GJF A;  2XWY A;  3I5C A;  3CD5 A;  4A8X A;  2CJK A;  1PGZ A;  1QVG R;  1S6U A;  4DR3 F;  1WG1 A;  1VS3 A;  2Q79 A;  3H8Y A;  3P5B P;  3C66 A;  2YNF A;  4LFC F;  1FRX A;  5EDW A;  4LF7 F;  4KJG A;  1RT7 B;  1WSV A;  2ZKU A;  2I8E A;  2HSE B;  1RTI B;  2M0G B;  3QSI A;  2C2M B;  2ZBP A;  2DNM A;  4ZOS A;  3UR0 A;  4DV4 J;  4A8S A;  3TYT A;  2B7B B;  4X64 J;  4GVL A;  2H5E A;  2W5W A;  2RF2 A;  3TP2 A;  4OJH A;  5DM7 Q;  5E2Q A;  3HJF A;  2B9X A;  4EBD A;  4Y3C A;  1KQK A;  3M05 A;  1XMB A;  4QIG A;  3U27 A;  2VQE J;  2OPR B;  1RHR B;  3OHA A;  2GGP B;  4MAK A;  4RW9 B;  1S6P A;  4R5P A;  3I55 S;  1TL1 B;  1TP7 A;  1VI7 A;  3H90 A;  8AT1 B;  1QLN A;  5EX0 A;  2GV1 A;  2HBY B;  2QZ8 A;  3E01 A;  4WFB Q;  4LRB A;  4QWB A;  2H1Y A;  4C7Q A;  3M8Z A;  5LT5 A;  2DXD A;  2N7C A;  1X5S A;  3K0J A;  2ZJR Q;  1IBM J;  1QTM A;  2RJZ A;  2KDO A;  1YJW S;  3SYZ A;  2CQH A;  2KO1 A;  4LSL A;  4URQ U;  2W9C B;  5ITH A;  3EGZ A;  1G4C A;  2MZ1 A;  3UD5 A;  2L9D A;  2YKN A;  3HVT B;  4WK1 A;  2R8I A;  2UUB F;  4EO6 A;  1YJ9 S;  5M2R A;  2DO0 A;  4Y65 A;  2NXJ A;  2XZT B;  3H5Y A;  3JB9 k;  1JLE B;  5KFO A;  2FLL A;  4IOC Q;  3N6L A;  1FT8 A;  1FTR A;  1C1B B;  3PHE A;  3BH7 B;  3GYX B;  3I0R A;  4FKX A;  5DO2 A;  4N47 A;  3HHK A;  4ILR A;  4AYB D;  1L5U A;  2BM1 A;  3C19 A;  4EBC A;  2OPS A;  1N6Q B;  1HNX F;  3ISN C;  4JI6 F;  1Y7P A;  4FKY A;  2QLX A;  5LMN J;  1S4F A;  3IG1 A;  5J1N A;  4JI7 J;  1S0O A;  4MYT A;  3HLU A;  2CPJ A;  3MMC A;  4PG8 A;  3ILL A;  4EYI B;  4UOO A;  1NO8 A;  4KJD A;  1S97 A;  3I9V 9;  2B8Q A;  2B4U A;  4M5N A;  1VQ8 S;  2KTQ A;  2Q3P A;  1T11 A;  4USW A;  1WKL A;  3HF5 A;  5CYQ A;  2VFT A;  3QGH A;  2E5L J;  3BPD A;  2B5J B;  1HWK A;  1G6B A;  1TL3 A;  3MM7 A;  4ZKA A;  2PMZ D;  1JK9 B;  3BO3 A;  1JB0 C;  4EK2 A;  2J6S A;  1OY8 A;  5F8J A;  2JSX A;  3EUN A;  1P1T A;  1S59 A;  2CPH A;  4OI0 A;  2CVI A;  1VIS A;  2RQ4 A;  4OJG A;  3PEH A;  5L8R C;  5JMN A;  5CYJ A;  1RHM B;  5GAD U;  3HHL B;  3GQC A;  1IKV B;  2LMI A;  2MDA A;  4LR9 A;  2WAQ D;  4FZV A;  4RX6 A;  3KUG A;  4RW8 A;  2GQ2 A;  3KHR A;  5KFP A;  3CJK A;  5C42 B;  5IFM A;  2QX0 A;  1X5T A;  1O6X A;  2QL7 B;  3HI9 A;  1AYE A;  1JLC B;  1HBU A;  4RPF A;  4WFN Q;  5GAE U;  2V5H G;  1VQ5 S;  1HFE L;  4OHY A;  2IMO A;  1UEV A;  5I42 B;  1F9H A;  1UVI A;  5CYM A;  1WC5 A;  2Z0G A;  5CZV A;  5D0E A;  4WWS A;  4DF4 A;  1LQ9 A;  3PZP A;  2ZEJ A;  1ZAX A;  4K8R A;  1PBU A;  4TQR A;  2R7O A;  3EJM A;  2EFV A;  2CPE A;  1FDN A;  1CJV B;  2NUH A;  1NBE B;  1S99 A;  5B7W A;  5KFK A;  4GKJ F;  4K0K J;  2MKY A;  4TN0 A;  1K73 T;  1C2P A;  1C1C B;  2HBZ B;  2VBX A;  4F3Q A;  2M9K A;  5KG1 A;  3CE8 A;  1O8B A;  4HAC A;  3UNG C;  4DUZ F;  3GE9 A;  4TY8 B;  4ZPC A;  2R7X A;  4K2X A;  4J9S A;  1HI1 A;  1IBM F;  2K3K A;  2U1A A;  3VAJ A;  2PA3 A;  2HWH A;  4DL5 A;  2OPP B;  2B9E A;  1C0T A;  3ZTP A;  2PD1 A;  9RUB A;  1SL2 A;  3G8Q A;  2XZW A;  3LF0 A;  2XMV A;  2LQ8 A;  3VAF A;  1KDN A;  4OHX A;  4ELT A;  1S6O A;  4JYA F;  2CPI A;  2VZ9 A;  4QR2 A;  4FYY B;  3OJS A;  1FWL A;  2E1P A;  1FDB A;  2MHN A;  4J37 A;  3UFC X;  2BKN A;  2FVP A;  3RW6 A;  2V50 A;  1LWX A;  1Q4R A;  2NS1 B;  3DLG B;  2IYG A;  4USJ C;  2Z57 B;  3OJU A;  4X66 F;  3DDK A;  4AD6 A;  1SHN A;  1Y11 A;  4IG0 B;  1S9E B;  5F0W A;  5ETS A;  3DMJ A;  4CTA A;  4J7C A;  1MWY A;  3MOJ B;  3MMB B;  4I6Y A;  2ATL A;  2LEC A;  2HUR A;  1OWX A;  1WUU A;  1XWL A;  2B9W A;  2QMX A;  4OX8 A;  4OX9 F;  2Z2L A;  3LP0 A;  1HWJ A;  3KOA A;  4M5H A;  4FYD A;  2EFG A;  1GMW D;  3UE2 A;  2FLP A;  4JV2 A;  2FD2 A;  3ZNU A;  2XI3 A;  1WD6 A;  1RTD A;  2MZR A;  3FFI A;  3BR8 A;  3K8V A;  2ZH5 A;  1U45 A;  4RWX A;  3ISN D;  4QBU A;  5IQQ A;  5MAO A;  1HHT P;  2FY1 A;  2HHS A;  2AEM A;  4IDK A;  4UQG A;  3D66 A;  4KR0 B;  2G1H A;  1QY7 A;  2GHV C;  5C25 A;  2DO4 A;  1J5O A;  1SH3 A;  4U7U K;  2ZIT A;  1NK0 A;  3V2U C;  2DY9 A;  1WF1 A;  2RML A;  4WFY A;  3MMA A;  2JFK A;  2P9G A;  2R42 A;  2LXI A;  4DUY F;  4B3R F;  1CJK A;  1EP4 B;  2IM3 A;  2ZE2 B;  1H3D A;  2X1B A;  3B4M A;  3C15 B;  1R27 B;  4PAB A;  4ANC A;  3UD3 P;  2CQG A;  2OSQ A;  1YJN S;  3J7Z T;  5AJ9 A;  4OYP A;  2PEB A;  1Q7Y T;  3A8I A;  3EGN A;  4PG6 A;  5A6P A;  1TR0 A;  1SJ4 P;  4JUZ A;  1UZH A;  4HT7 A;  4C2M A;  5B0G A;  1NSA A;  1U1M A;  4ZPD A;  5L1I A;  4JI0 J;  1MML A;  3IDD A;  4RW7 A;  4IOB A;  5D78 A;  2FZK B;  3D1O A;  1J2V A;  5EGY A;  3BSN A;  2MJU A;  5GAH U;  2DPJ A;  1PC4 A;  1Q1K A;  2JL9 A;  2BJE A;  3DRR A;  3RRK A;  4CLU A;  3P49 B;  3D4J A;  1QAI A;  1EW9 A;  3OXF A;  3CCT A;  3GYG A;  2W8K A;  2B43 A;  3MPD A;  4KAV A;  3OFH A;  4KH1 B;  1YDL A;  1QTN B;  2E29 A;  1KFD A;  2HVZ A;  2MQN A;  2O1P A;  2HVD A;  2JLF A;  3MMJ A;  5LM7 E;  3TAM A;  5CAB A;  5CCM A;  3CUN A;  5DJB A;  3OT9 A;  4NZ7 A;  4LIR A;  1VRQ C;  4LRD A;  4RBV A;  2WTF A;  2VU5 A;  2BEF A;  2XBP A;  1IKX A;  3P3D A;  3H5X A;  2R7T A;  4MKA A;  2CG8 A;  4C0H A;  2HFO A;  2VIH A;  1N4L A;  3QAE A;  4KSE B;  3CDE A;  3NCR A;  3OL7 A;  4Q2L A;  2LA6 A;  4UOP A;  3R97 A;  2O5D A;  4FPI A;  1ELZ A;  3MM8 B;  3TZX A;  2VJU A;  2YVS A;  2QIF A;  3CDA A;  3I31 A;  1PAU B;  5L46 A;  3PW4 A;  4UY8 T;  1BC6 A;  3AT1 B;  3WBZ A;  2G4B A;  3IR7 B;  2ZH9 A;  3SZY A;  2QC3 A;  3WAW A;  2IA0 A;  4DQP A;  1LK7 A;  2BM0 A;  1VIX A;  4YB5 A;  4UOH A;  3HSJ A;  4RZR A;  3T1Y J;  1CG2 A;  4RU2 A;  4IR9 A;  4G3I A;  2VAS A;  2GVZ B;  3OD2 A;  4Q0B A;  5K8M A;  5HQ8 A;  1UEK A;  1HYS B;  3QYY A;  4C6A A;  3QIP B;  1NJI T;  1AXQ A;  2CQ0 A;  3R27 A;  3MM9 B;  4RBT A;  5J1E B;  5KT2 A;  2ZZN A;  1RJJ A;  1JQG A;  2OD4 A;  2HND B;  4LQ3 A;  3NG8 A;  4C98 A;  2JRS A;  1M5K C;  3MCO A;  3VAM A;  4YDX A;  3TQ1 A;  1VC6 A;  2Z30 B;  5DZ7 A;  3EE3 A;  3TO8 A;  1RE1 B;  2IVY A;  3TA2 A;  5D8H B;  3VGT A;  5G0R B;  3PR4 A;  3TVZ A;  3NVL A;  1RWV B;  2DYA A;  2P9C A;  2D41 A;  1EKS A;  5KFI A;  4F36 A;  3K7R A;  5IT4 A;  1RYR A;  1Q7L B;  4LF5 F;  2DNG A;  3NKY A;  3CMA S;  4LBP A;  3QT6 A;  1W26 A;  5HSP A;  1IKW A;  2L08 A;  5I3P A;  3QZ8 A;  4DLG A;  5G0R A;  1SKW A;  5EUH A;  2IRY A;  3CO9 A;  5HAO A;  2L9N A;  4LF1 A;  5KFL A;  3A8E A;  2BW2 A;  5KAK A;  5EWF A;  1YJR A;  3FMW A;  4M5G A;  4HVZ A;  4M95 A;  1UVJ A;  1B3T A;  3DI6 B;  2A6O A;  2FUG 9;  4XTT A;  5H9F J;  5BR8 F;  5DGA A;  3W65 A;  2QN6 B;  2G2Y A;  1U02 A;  1BGX T;  1R0C B;  3FRY A;  2OEJ A;  1VCT A;  3PFO A;  3PYD A;  5E7O B;  5BYS A;  5J1E A;  5FLX U;  1T7P A;  4JI1 J;  2MHE A;  2IFY A;  1PYO B;  2UV8 G;  5AXL A;  3N5F A;  2UXC J;  4WP8 A;  4X4V A;  3A3O B;  3TZY A;  1HBN A;  3ETM A;  4GO7 X;  2HGM A;  4K2J A;  1FDA A;  3K5P A;  2GS8 A;  5T7L A;  2VFS A;  1KQF B;  3HX9 A;  1VHF A;  4X62 F;  1NK4 A;  3DM2 B;  5HBM A;  1RAO A;  4DDF A;  3A1Y G;  4U8V A;  1TL7 B;  3G2X A;  3V6H A;  2Z2Z A;  4CLS A;  2RRN A;  3F0N A;  2JC0 A;  3MM8 A;  4LSN A;  2MEW A;  4LRC A;  5E3A A;  1UCN A;  1VQ7 S;  2AJ1 A;  2MY8 A;  1MU2 A;  1S7I A;  3BBF A;  1QM9 A;  5J2M B;  1FJ7 A;  4ZVG A;  3THP A;  1JXV A;  1IKX B;  1SC3 B;  1RAE B;  3P8B B;  1RTH A;  4O0I A;  4ES2 A;  1FKA F;  1F2G A;  2RQM A;  2ZOF A;  3JSB A;  1HHS A;  4M5I A;  3V4I B;  2GHP A;  2AYB A;  2YWF A;  3G86 A;  1UWB B;  1RT2 B;  3TX8 A;  5KFH A;  3K5L A;  3WAY A;  4I2Q A;  2ZBQ A;  4EFA C;  1HQE A;  1HDH A;  4LJM A;  3I5A A;  3DRR B;  4AL7 A;  4C9D A;  2V6A A;  2H54 B;  2JOQ A;  5B0D A;  1NDP A;  1R8B A;  5C66 A;  1QVF R;  4NCB A;  1YJ7 A;  1DTQ A;  1BWE A;  1BQM A;  5D4N A;  1CPZ A;  2H48 B;  4YR3 A;  4NX9 A;  5ETO A;  1UWB A;  4X4O A;  2BR0 A;  1VHI A;  4KHP F;  3SSS A;  1U26 A;  3FC9 A;  4DR2 J;  4ECZ A;  2C22 A;  8RUC A;  4A8K A;  4PXE A;  1YWX A;  2WSC C;  3I0S B;  3QGP A;  1TTH B;  3OBI A;  3OTC A;  4TN2 A;  4CQ1 A;  2XM3 A;  1IBL J;  3NGU A;  4LF8 F;  3HZG A;  5KFM A;  4L74 A;  1H73 A;  5F9N A;  4F4X A;  2ZE2 A;  3C15 A;  4F3M A;  1HL6 A;  3LWM A;  2NXC A;  4OZN A;  3G87 A;  4EMD A;  2LQJ A;  3CGI A;  3ENA A;  3MGJ A;  3MMA B;  4P7V A;  3ZTS A;  3D67 A;  4ZCI A;  1T95 A;  4LT6 A;  5C2C A;  4WFZ A;  2DNH A;  4DR6 F;  3MEC B;  2R2R A;  1VQK S;  1FTC A;  1WSR A;  4WE1 B;  2GMJ A;  1TL7 A;  3NY0 A;  3PM9 A;  4IDK B;  5L1J A;  4RNH A;  2A18 A;  2ZJP Q;  2W8D A;  4F50 A;  1P6T A;  3QNW B;  4KAY A;  2HGN A;  2KT3 A;  1SQG A;  1HBN B;  2W5T A;  4NLP A;  4I6W A;  2I6W A;  2HHQ A;  2DBB A;  3J80 U;  2K2P A;  2DGS A;  1B0P A;  3R9L A;  4J9M A;  3DOL A;  1N5V A;  3JTN A;  1NHV A;  1BLU A;  2HFS A;  5F8H A;  3RB0 A;  2FVQ A;  4ZP6 A;  4ZHR B;  3ZZO A;  2LQ5 A;  4I6A A;  2BAC A;  3DI6 A;  2H5I B;  3PEJ A;  1IBC B;  2E7W A;  3CJ0 A;  4O23 A;  2VA2 A;  1S9E A;  3G96 A;  2MKK A;  2XI2 A;  3FZB A;  2UUB J;  5I3U A;  5ETP A;  4DPU A;  4K4X A;  4KT0 C;  3T1H F;  5KXA A;  1FKO B;  2H65 B;  3LP2 B;  4RNF A;  3DLK A;  2GZO A;  4XIU A;  2XY6 A;  2FC9 A;  1Q8I A;  2ASD A;  2D69 A;  4ZLJ A;  1SH2 A;  1S76 D;  2XSF A;  3PIP Q;  4PXD A;  5DDR C;  3KWM A;  4YHH J;  3B82 A;  1BE4 A;  2OEK A;  2HKE A;  3A52 A;  4CYU A;  4TLR A;  4DOZ A;  3MM9 A;  4LFB J;  3EVW A;  4GVB B;  4NZ0 A;  5KT6 A;  4A47 A;  3BH6 B;  3QIP A;  3HSG A;  2VOD A;  4I56 A;  1HYS A;  1KH4 A;  2VON A;  2EC2 A;  2GVZ A;  4Q0B B;  2VPY B;  4DQI A;  4Q8E A;  2DH7 A;  4MFB A;  2ZH4 A;  2JEJ A;  3R2D J;  1TAU A;  4DV4 F;  2RSQ A;  1UW9 A;  3J81 j;  4UZC A;  1NSK L;  1ACM B;  1F5B A;  3FCV A;  4DZD A;  2DEI A;  4WJB A;  3M2V A;  5HMZ A;  3TZZ A;  4K5R A;  2OHD A;  1R43 A;  3PG9 A;  4PR6 A;  5D4L A;  5CA5 A;  3J7Z 5;  2DH9 A;  1HWU A;  2R3V A;  1IWG A;  1GAO A;  4H4K A;  3PFE A;  3KNG A;  5DDP C;  2YX4 A;  1NAQ A;  2M5Y A;  3PXG a;  1WHY A;  4ALZ A;  2VQF F;  1IBK J;  3OVB A;  1KVK A;  2OFH X;  1UAW A;  2FZC B;  1ZPV A;  1KBR A;  4P2M A;  3BRE A;  4KPY A;  5I42 A;  1M5O C;  1HBM B;  3NS5 A;  2VOP A;  2ZHB A;  1N2L A;  3O2I A;  2ZDP A;  4HH1 A;  2XY7 A;  2BZ2 A;  2YX1 A;  5C42 A;  3TAM B;  4DR1 F;  1UA0 A;  4ZG6 A;  4DV0 J;  1R7I A;  4B3S F;  4X4N A;  4CP5 A;  3G9C A;  1F60 B;  3US5 A;  1JX4 A;  3RZA A;  2MPU A;  3TI0 A;  1XBW A;  4ED2 A;  4PPZ A;  2QLW A;  1NEE A;  2GMH A;  4N8O A;  4C8Y A;  4DSK A;  4Y2K A;  1REV B;  4UZB A;  2MZJ A;  4RW7 B;  4ZPV R;  1SV5 B;  4NI2 B;  1TL3 B;  3PNI A;  2WW4 A;  1SQF A;  2ZHO A;  4PCQ A;  5CYQ B;  4JI0 F;  5ETR A;  5JJB A;  1F1B B;  1KHJ A;  1WHX A;  3A8J A;  3G4S S;  2PO4 A;  1UVM A;  4X62 J;  1FXR A;  1WI8 A;  2VPZ B;  3VVU A;  3W63 A;  2LDY A;  2DB1 A;  1CBK A;  3N6N A;  2KHD A;  2BJ1 A;  2DIV A;  3FQK A;  1U6Z A;  4DL2 A;  1CJK B;  1EP4 A;  1JLF A;  1X5O A;  1H2V Z;  4ZP9 A;  4ZK7 M;  4C48 A;  4PWU A;  3T1H J;  5J2P B;  1G1X A;  1GXT A;  2F3J A;  4WPA A;  3I0R B;  3ZTO A;  3W62 A;  3FNN A;  4QIW D;  4U6P A;  4TQS A;  1OJ4 A;  1VBY A;  4UT4 A;  3RU0 A;  4JI4 J;  4M5D B;  1JLE A;  3FFI B;  3JQM A;  1SC6 A;  1FX2 A;  1I51 B;  3HVT A;  1RBA A;  1I94 J;  1LFP A;  2K06 A;  1K1S A;  1RWK B;  1WOP A;  3PJX A;  5C24 B;  5L9N A;  2W9C A;  2NXE A;  5BXI A;  1IR1 A;  1P27 B;  2C2Z B;  4OFZ A;  4F0K A;  3K5N A;  3HJV A;  2X3G A;  2VHG A;  5IWA F;  2BA9 A;  1NPR A;  2RU9 A;  1TAQ A;  2ZBR A;  3MMB A;  4TY9 A;  3E01 B;  4LR7 A;  4E8U A;  4JI3 J;  4CTA B;  4CT9 A;  4BS2 A;  3DMJ B;  3VGU A;  2CA9 A;  5D3G B;  2Y0B B;  1S6P B;  1MLA A;  2GAG C;  4IG0 A;  4KGV B;  4RW9 A;  4R5P B;  5LJ3 Y;  2AU0 A;  1RAJ A;  5GME A;  5HMW A;  2LQB A;  2EKY A;  1Q81 T;  1PYS B;  4RBU A;  1FD8 A;  1PAE X;  2FHJ A;  3C14 B;  2QLF B;  1Y5I B;  2C1E B;  2RF2 B;  1VFJ A;  1KLM A;  4ID5 A;  4YME A;  4KE5 A;  3ZXW A;  5CZX A;  1WEX A;  4IG3 A;  2OLW A;  1TKD A;  1S0N A;  4WU3 A;  3BBB A;  1FE0 A;  1I3O B;  2X7I A;  4RR5 A;  3UCU P;  1RT7 A;  4ECQ A;  3D6M B;  4R0E A;  4ETX A;  3OR1 B;  1VK3 A;  2ZM6 F;  1JNR B;  2YNF B;  3NCP A;  4OLP A;  1XMQ J;  1KLN A;  2OML A;  3TA0 A;  1UL3 A;  4ZJO A;  1DTT A;  2DRA A;  1TL4 A;  3R6L B;  2JDJ A;  3W5X A;  1YKW A;  2G2Z A;  4CXS A;  3NMA A;  3SI8 A;  2OO4 A;  5IOL A;  2DNN A;  2XZD B;  4TY8 A;  4JV5 J;  1B8J A;  3SFG A;  5K5M A;  4U9R A;  4HAC B;  2V2Q A;  4YP3 A;  3O8W A;  1C1C A;  1UPM B;  2ZFH A;  5AT1 B;  4DFM A;  3C3L A;  1R89 A;  1REG X;  5A8W A;  4DN9 A;  3MAH A;  1RLD A;  1RQ0 A;  5B0E A;  2R7W A;  3DLJ A;  4WTY A;  1NPP A;  1DLO A;  1OY6 A;  1H2U X;  2GVD A;  1GXL A;  4DPT A;  2HQI A;  4QIE A;  3WDO A;  2HS4 A;  3HXM A;  5D0H A;  1U1L A;  3D3B J;  1U48 A;  1AZS A;  3EDR B;  4K4U A;  4QAX A;  2MQ8 A;  1HNZ J;  2ZBC A;  3J80 Y;  3CJR A;  3PRB A;  1L3V A;  1UVL A;  3KK1 B;  2DNK A;  2J0W A;  3GYN A;  1NLK L;  5HLF B;  2DNY A;  2HRU A;  1V3S A;  1ZYQ A;  4CWB A;  1HBU B;  1JLC A;  3ENW A;  4OHV A;  3KLV A;  1S0V A;  2HQG A;  4NYZ A;  3T5L A;  2LKZ A;  3CJK B;  1SH0 A;  1NK8 A;  3U1N A;  1NKB A;  1TFW A;  1FF2 A;  5DLT A;  2HEK A;  3GSD A;  5EWE A;  2IA6 A;  5L0B A;  1IKV A;  3HHL A;  1XIQ A;  5A8K B;  1A0O B;  1M5H A;  2J9C A;  2ZBI A;  2W7A A;  4QZV B;  2Y8W A;  5DS7 A;  4AL6 A;  1RT3 A;  5EGH A;  3KNA A;  4BC7 A;  1CQN A;  1S48 A;  2R7Q A;  1TMJ A;  1ZBT A;  2NYI A;  4GRS A;  2DVI A;  3TVK A;  1X4D A;  2PGC A;  3MM7 B;  1S5Z A;  2BAN B;  3IRX A;  3KHH A;  2ALZ A;  3MF5 A;  1F5C A;  1Q5V A;  3Q24 A;  1U47 A;  1RKJ A;  3DFE A;  4OYO A;  2Z2M A;  3IR6 B;  2OAU A;  2W9B A;  1D1U A;  4LF4 J;  4UW2 A;  4WP9 A;  2QFI A;  2R8H A;  2BX6 A;  2DHX A;  3CED A;  1U1Q A;  5IM0 B;  2A2D A;  2HHH J;  1JKH B;  1S4E A;  1CS4 A;  3PKY A;  1APS A;  4UPI A;  2EKN A;  2AT1 B;  2PT0 A;  4GC7 A;  1VQM S;  3JQJ A;  4KY3 A;  1KD1 T;  2XSJ B;  4DF8 A;  4MIW A;  5AE1 A;  2KYX A;  3C6U B;  1HR0 J;  2OPS B;  4LVN P;  3GV8 B;  3BBC A;  4BLG A;  4AQY F;  2DJW A;  2XSJ A;  1S1W B;  1N36 J;  3A4T A;  2ROG A;  4FXD A;  3FSI A;  5LMU J;  1N5Y B;  4CO0 A;  4QWA A;  2AYG A;  3ZZU A;  3RB3 A;  1URB A;  4ZGA A;  2IHR 1;  3H59 A;  5IM0 A;  4P2F A;  1AUS L;  4CO4 A;  1DQA A;  4RUB A;  2MKH A;  5KFQ A;  1YIJ S;  3M8Q A;  1M1H A;  4J5O A;  3PCO B;  2W9B B;  1RYS A;  2QA4 G;  4LSL B;  1DJ0 A;  4DEZ A;  4W90 B;  3KK2 B;  2ZOG A;  1LV5 A;  2CJB A;  4ED4 A;  1WDD A;  1RSC A;  4P74 A;  2PC6 A;  1JJ2 R;  1RT3 B;  4DSI A;  2UXB J;  2YKM B;  5BYR A;  4I7F B;  4LFB F;  5KFD A;  2MGZ A;  4JYA J;  1UVK A;  5CCL A;  3SMZ A;  4BCA A;  3UVJ A;  3UR3 C;  3Q8R B;  4DR3 J;  2Y8Y A;  4CO3 A;  5F9L A;  2OPR A;  4KRW A;  3L7O A;  4RL1 A;  2KHC A;  4EYH B;  2WOM B;  4JI6 J;  4JI7 F;  1HQU B;  3GTY X;  1W7W A;  5HJX A;  2FJB B;  1K44 A;  1JLG B;  4IFY A;  3CMQ A;  3RGI A;  3WIV A;  3HHD A;  4F04 B;  2MTL A;  3SBM A;  2IC3 A;  2VQE F;  2DIT A;  5EN1 A;  3GZ7 A;  1PYT A;  2CDQ A;  2W8L A;  1UW4 A;  3UDV A;  4JI2 F;  3OXL A;  2C3O A;  2M52 A;  5AXM A;  1HR0 F;  2BV3 A;  3DDI A;  3MEK A;  4Y28 C;  1OYE A;  1DLO B;  4GKJ J;  4K0K F;  5KG5 A;  3D0G E;  3RJM B;  3E2D A;  4ER8 A;  2XMU A;  4DX5 A;  2YX7 A;  2RDI A;  2OEL A;  3HHN B;  1MRO A;  1SUQ B;  1WI6 A;  3DU6 A;  3UI3 A; 
#chains in the Genus database with same CATH homology
 3UO0 A;  3NKQ A;  1KH9 A;  2W5R A;  4FDI A;  1AJC A;  4GTX A;  5IJS A;  3TG0 A;  4UOR A;  4NWJ A;  5DLW A;  5LQQ A;  4CXS A;  3NVL A;  3Q3Q A;  1ALK A;  1KHK A;  3A52 A;  1P49 A;  4LRE A;  1O99 A;  4LQY A;  5GOV A;  3DPC A;  1KH4 A;  3MK2 A;  2ZKT A;  4GTZ A;  3UN3 A;  4N7T A;  1ANI A;  1AJA A;  4KJG A;  3DYC A;  4MHX A;  3B5Q A;  3BDF A;  4GTW A;  1N2K A;  1SHN A;  3WAX A;  5L0K A;  5C66 A;  2IFY A;  1URA A;  2W5W A;  3CMR A;  3M7V A;  1O98 A;  4GTY A;  3ED4 A;  3BDG B;  2QZU A;  2IUC A;  4CXU A;  5DLT A;  2XR9 A;  1ELX A;  3WBH A;  5L0B A;  1ALI A;  1HQA A;  1K7H A;  4LRB A;  1EW8 A;  2W5X A;  4MIV A;  3M8Z A;  5K4P A;  4LRC A;  1N2L A;  1ALJ A;  3TWZ A;  2GA3 A;  4ZG6 A;  5LIA A;  5EGE A;  4CYS A;  3TX0 A;  1AUK A;  3MK0 A;  5GRR A;  1E33 P;  4LRF A;  5HRT A;  3WAY A;  1AJB A;  4UPI A;  4YR1 A;  1ALH A;  1SHQ A;  2W5Q A;  1HDH A;  5AJ9 A;  3NKN A;  1KHJ A;  1Y6V A;  4CYR A;  4ZG7 A;  3NKR A;  1B8J A;  1ED9 A;  3T00 A;  3NKM A;  4LRA A;  1EW2 A;  5L0E A;  3IGY B;  4ZG9 A;  3T01 A;  2GSN A;  2G9Y A;  3IDD A;  4UOO A;  1URB A;  4ZGA A;  1E1Z P;  4KJD A;  2X98 A;  2W5V A;  3UNY A;  2GSO A;  1EQJ A;  3IGZ B;  5IJQ A;  5KXA A;  1EW9 A;  1KHL A;  1KH7 A;  1Y7A A;  1AJD A;  4KAV A;  5EGH A;  3MK1 A;  4UPK A;  5TJ3 A;  1ZEF A;  1E2S P;  5DLV A;  3BDH A;  3UN5 A;  2W5S A;  3OT9 A;  1EI6 A;  4LRD A;  4LR9 A;  4FDJ A;  4KM4 A;  1ANJ A;  3UN2 A;  4NWX A;  1ZEB A;  2W8D A;  1E3C P;  1FSU A;  4CXK A;  2IUC B;  1ED8 A;  4UOP A;  2RH6 A;  2GLQ A;  1ZED A;  4KAY A;  4MY4 A;  4UPH A;  4UPL A;  1HJK A;  2W5T A;  1ELZ A;  3T02 A;  1EJJ A;  4LR7 A;  3SZZ A;  2VQR A;  2W8S A;  4QAX A;  3SZY A;  3WAW A;  1KH5 A;  5LRM A;  3BDG A;  3NKO A;  3NKP A;  4LR2 A;  3M8W A;  2GSU A;  3M8Y A;  2D1G A;  1KHN A;  3E2D A;  2XRG A;  2ANH A;  3KD8 A;  4LR8 A;  4TN0 A;  3WAV A;  1ELY A;  5INH A;  5LRN A;  3LXQ A;  4B56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...