The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
178
|
structure length |
178
|
Chain Sequence |
PGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPDGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transport protein
|
molecule keywords |
Outer-membrane lipoprotein LolB
|
publication title |
Roles of the Protruding Loop of Factor B Essential for the Localization of Lipoproteins (LolB) in the Anchoring of Bacterial Triacylated Proteins to the Outer Membran
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
44
|
structure length |
178
|
sequence length |
178
|
ec nomenclature | |
pdb deposition date | 2013-10-16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Clam | outer membrane lipoprotein receptor (LolB), chain A | Lipoprotein localisation LolA/LolB/LppX |
#chains in the Genus database with same CATH superfamily 4Z48 A; 2P4B A; 2W7Q A; 1UA8 A; 2V42 A; 1IWN A; 4MXT A; 3WJU A; 3BK5 A; 2ZPD A; 3BUU A; 1IWL A; 3KSN A; 3WJV A; 2ZPC A; 4KI3 A; 2YZY A; 3WJT A; 1IWM A; 2V43 A; 3M4W A; #chains in the Genus database with same CATH topology 3MH9 A; 4EGD A; 4Z48 A; 4QA8 A; 2P4B A; 2W7Q A; 4ZRA A; 1UA8 A; 4EG9 A; 2ZF3 A; 3BMZ A; 2V42 A; 2ZF4 A; 1IWN A; 3MH8 A; 4MXT A; 3WJU A; 3BK5 A; 2ZPD A; 3BUU A; 1IWL A; 3KSN A; 3WJV A; 2ZPC A; 4KI3 A; 2BYO A; 2YZY A; 3MHA A; 3WJT A; 1IWM A; 2V43 A; 3M4W A; #chains in the Genus database with same CATH homology 4Z48 A; 2P4B A; 2W7Q A; 1UA8 A; 2V42 A; 1IWN A; 4MXT A; 3WJU A; 3BK5 A; 2ZPD A; 3BUU A; 1IWL A; 3KSN A; 3WJV A; 2ZPC A; 4KI3 A; 2YZY A; 3WJT A; 1IWM A; 2V43 A; 3M4W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...