4A1FA

Crystal structure of c-terminal domain of helicobacter pylori dnab helicase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
323
structure length
323
Chain Sequence
ARNIKEVLESAMDLITENQRKGSLEVTGIPTGFVQLDNYTSGFNKGSLVIIGARPSMGKTSLMMNMVLSALNDDRGVAVFSLEMSAEQLALRALSDLTSINMHDLESGRLDDDQWENLAKCFDHLSQKKLFFYDKSYVRIEQIRLQLRKLKSQHKELGIAFIDYLQLMSGSKATKERHEQIAEISRELKTLARELEIPIIALVQLNRSLENRDDKRPILSDIKDSGGIEQDADIVLFLYRGYIYQMRAEDNKIDKLKKEGKIEEAQELYLKVNEERRIHKQNGSIEEAEIIVAKNRNGATGTVYTRFNAPFTRYEDMPIDSHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATIVE DNA HELICASE
publication title Architecture of a Dodecameric Bacterial Replicative Helicase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 122
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a1fA00
3U6BA 1Z06A 2SHKA 4RCZA 2R6FA 4WOPA 4TT3D 1BMFA 1VG1A 3AF4A 4GOJA 4GMDA 2GVDC 4GRAA 5AUOB 4IEIA 1G6OA 1DG1G 3BIFA 1Q57A 2GZAA 2V54A 4QHYA 2IUSA 2VYFA 4XWAA 3U7EB 1TX4B 2ZI4A 3LBHA 1NG9A 3JZMA 1SVKA 3CO5A 3GLFB 1OB2A 1XPOA 5JEDA 1CTQA 4ERNA 2ZANA 1DPFA 4MDFA 4HB0A 4LV6A 3RWOA 1XXHA 2G83A 4IOLA 4TL6A 1XJ0A 3MWYW 4JT2A 4BFUA 4V0NA 3RAPR 3VNVA 4MYUA 1HUQA 5DI3A 5FTMA 1GL6A 3QKSB 4CEJB 4V02A 2J9RA 5JECA 1U90A 4B6FA 1TQDA 1EG7A 2RGNC 4JSTA 4XWOA 4QJ3A 1M74A 4ACBA 1NLYA 4EJSB 3GLIA 4BFWA 4EQ6A 4JMPA 4DLWA 1XB2A 3RDPA 2NMVA 2FSFA 3CNLA 4DLVA 3KQUA 2QGZA 3EZ9A 3KXIA 3T5GA 3OE7D 1AM4D 3SS8A 5DHFA 2ODWA 5HPYB 2ZRBA 5JCZA 4RD0A 1AK2A 3GEEA 1RPZA 1D5CA 4TMKA 4FINA 3X1ZA 4LC0A 3KTAA 4V0MA 1LVGA 3F3YA 3TRFA 2CJWA 2A78A 3VMFA 4BUJA 4M9SA 3GLGA 2OLKA 2JLWA 1HV8A 3DZ8A 4M4SA 1Z47A 3SU8A 1NBMA 3MWLA 3P27A 1XPRA 2FEMA 5BN5A 1XCMA 2J0SA 2V7QD 2JDIA 3T34A 1EFCA 1UBCA 1GNQA 3KUCA 1NNEA 3D7MA 1OIXA 3U5ZB 1KO7A 1Q1EA 3QF7A 1W1WA 2NTYC 1NKTA 3ZH9B 2C99A 4DCVA 2Z0MA 3UXMA 4F4CA 3KQKA 2W0SA 4PAOA 4QM7A 1TF2A 2AD5A 4HLDA 4Q4HB 1Z0FA 4BFZA 5BW8A 4Z8XA 5F98A 4DIDA 3R9WA 2ZS7A 4EAQA 2QENA 4L9WA 1T0HB 4MKFA 1P6XA 2QT0A 1WBBA 1H8EA 1UKVY 3OESA 4A6PA 3B9PA 4JLBA 1ZM9A 1GITA 4HLUC 3DEFA 3GLHB 5GVRA 2CE2X 2QSZA 4LHZA 1NMXA 1MRSA 2ZXUA 3BB4A 5J5CA 3KQHA 3CZQA 5FUYA 2IHBA 2O52A 2FFQA 3A4MA 4UNNA 1C1YA 1XFAA 2N1BA 4QRHA 4B35A 4C0KA 3F5FA 5A0FA 1DOAA 3MCAA 3BFXA 4MKGA 2O0KA 3RS4A 1Z29A 4Q4JB 2PZGA 2BJVA 4I1VA 1JJVA 2DY1A 1OYYA 2CMKA 3EC2A 2IS2A 1RYFA 1BH2A 2XAUA 2AK2A 2BDTA 1KMHA 2JCSA 1SKYE 4WAUA 4EPXA 2ERXA 4NDZA 4EJSA 3GLIB 4RZ3A 4PPGA 4DSOA 3VQTA 1DO0A 2PL3A 2FX3A 2BV3A 2ZRAA 4G0NA 2ZR0A 2VP0A 1MV5A 4QNRA 4PR0A 1CF4A 2Z4RA 1TU3A 4A1FA 2GRJA 4B34A 1G8YA 1KK1A 1TF7A 5EZ5A 3TGPA 4TYPA 2GAAA 5SZJA 3WNCA 2JLQA 2D74A 1DELA 1CIPA 1W7AA 1DAEA 4M1TA 2F3RA 2CK3A 3NKVA 3WP0A 2WOJA 3LXRA 1AZSC 1G5RA 2CBZA 1NF3A 5FR1A 3VR6A 5K8TA 5LDDC 1VYTA 2OEPA 5L3RA 2ZRNA 1G291 1I4LD 2CCKA 4A36A 4RD4A 2A5FA 4UNQA 3ZLJA 1AGPA 2BC9A 1FNMA 2O8FA 3TIFA 5A4JA 3U44B 4K8OA 1XMIA 2J1LA 2B7CA 2J59A 3A1SA 4Q01A 1R5BA 1KAGA 3LX5A 3LDAA 5DYGA 2WVJA 2PZEA 1YZLA 1AQYA 1R8QA 1WA5A 4A4DA 3AUXA 2ATXA 3G0HA 4ZIRA 4OK3A 2GXSA 3JVVA 3SE0A 3E5HA 4PAMA 1NMZA 4UXJA 4DB4A 3FKSA 4Q03A 4PQFA 1EFUA 1G7TA 2RCNA 1TUEA 3SEAA 4EPYA 1ZD9A 3OFNA 5KNBA 1FQKA 1E98A 2OG2A 2WIAA 4WBSA 1MT0A 2J87A 2KI5A 3AF3A 1ZUNB 2ZI6A 2BCGY 2D3WA 1P62B 4O2LA 5TXGA 5C46F 5GJWC 4DEYA 3I3SR 2B8WA 3WRXC 3BS4A 3W5IA 1TAGA 2OESA 2F43A 2BBOA 1CR0A 3DM9B 3H1TA 4LPKA 4P33A 4A0FA 5K8UA 1N25A 2YKGA 2IS1A 4B3XA 3HDTA 2RGBA 1KNXA 4PX9A 2C2HA 3SYLA 3Q8XB 1E9AA 4NHOA 4F38A 2ZE5A 4MYCA 1Z2AA 4HB4A 2W0MA 4A8JA 4XVUA 1VCNA 3EG5A 4PPQA 1N5LA 1CJTC 1JR3A 2TMKA 4A15A 4DVGA 3K0FA 1SVWA 4OQLA 3MWKA 3ZD6A 5KSPA 1M8PA 3LLUA 4V0KA 3FPAA 2PMDA 2XXAB 3U3OA 1DAIA 4KI0A 3T1OA 2VH5R 3L0PA 5H8WA 3O8RA 2VBCA 5J47A 1NLFA 3BERA 3MJHA 5AJVB 3KJIA 4DLXA 1VIAA 1ZM2A 4YC7A 3RS3A 2HUPA 4NKRA 2F3TA 3I73A 4PPNA 5IK2A 1D8TA 1Q1QA 1NN1A 1E1RD 4NH0A 1YU9A 2J0VA 2IYSA 4CT4B 4LJ8A 1T9HA 3WMEA 2R9VA 1XXHE 3GLIE 4QL3A 1HT2E 3W3AA 2RHDA 4QXAA 1ZM4A 1SHKA 3H84A 1IM2A 3W5JA 4UNPA 2GETA 4GMXA 2XJ9A 1HT1E 2OCYC 2AFIE 3KFVA 4OJQA 2CNWA 4I99A 4C9BA 1T8TA 1WXQA 2GJ9A 1QHHA 1W4AA 4A8JB 1RJ9A 2K5UA 3VR2A 2H8KA 2BEKA 1CJUC 4GOKA 4RZXA 4LJAA 3EARA 2ODNA 4NBSA 4UXIA 2O0HA 3UIEA 2WSSD 5EP3A 1W4CA 2QM8A 2YWHA 2ZRFA 3AEZA 3L43A 4NYJQ 5J40A 2PT7A 3RC3A 4B47A 5HKKA 4MUBA 2ZSEA 4TLAA 4PC1A 2WM9B 4JJZA 3CF2A 2FFBA 1Z5ZA 1XTJA 1LFDB 4O25A 4LSGA 5FI1B 4B75A 2PMKA 4D25A 3UANA 3WP1B 1QHHB 1T3LA 4URUR 4IVPA 1KI8A 2ZRKA 1OLOA 3R9IA 3BB3A 3JZAA 4DSTA 2VP5A 3NC0C 3CIOA 2XNDA 1XMSA 1QHXA 1I2DA 1SVOA 3I8XA 4LV8B 4YMWA 2OCAA 3DZDA 1TF5A 4IDQA 2ODBA 2GWHA 1OXXK 4KBFA 4TL9A 3EPKA 1JPNA 3KL4A 2YV5A 2MMCA 2N46A 3QPWA 3QSYA 3BH0A 2Z6VA 2QP9X 1YZNA 3TAUA 1KO1A 2NG1A 2NO1A 1X86B 3NHBA 5FOXA 4C0BA 2OXCA 1A4RA 2RMKA 1E0SA 2Z43A 3GLHA 3LY5A 4YONB 1UF9A 1U8YA 2QORA 2OE2A 1GFIA 2C96A 4PC7A 4M8NE 4RD2A 3CRMA 2W6IA 2BMDA 3V9PA 1KJWA 5JI3E 3QXCA 5IT5A 1KI6B 3FDIA 1SXJE 4RFVA 4MGKR 2OV2A 1JQJC 4M1MA 2XOKA 3TH5A 5KSZA 1Q44A 4Y0AA 1HE1C 4U02A 4ZDJA 2OFWA 1DAHA 1TQ4A 1ZINA 3AP2A 3BK7A 5L3QB 4LGMA 1DBSA 2NPFA 1W5TA 2EFEB 3MJRA 2JGNA 2LWIA 1M34E 2Q6TA 4ZCIA 4GPTA 4B76A 1E2KA 3LH5A 5D3MB 2GA8A 1JQLB 4FIDA 3G5UA 1G64A 3GLGB 1E2FA 1RRPA 3ZVNA 1BYUA 4MGYR 2H1LA 1G3IA 2GJSA 2XGJA 2OCPA 3I1FA 2J45A 2A3RA 2ZE6A 4WA7A 3KXKA 4LYAA 4AY2A 3WBKA 4KAXA 4WZAE 5FBLB 2CL6X 4IRUB 4JYBA 4PANA 4JVMA 1UFQA 2O8DB 4BWYA 3M6AA 3OFND 1W5SA 1E2LA 2IUTA 2IWRA 1TUIA 4OK5A 5JRJA 4ZCLA 4ZKDA 2IF0A 3AVTA 4DCNA 3K8YA 3QXSA 2DFKB 1XWIA 1NVVQ 3HR8A 2JATA 5AR1A 3FVQA 3W90A 2NO9A 3C5HA 3VR4A 2LKCA 1S4QA 4MDEA 1OFTA 2EWWA 1R5NA 2PBRA 2ZJZA 4BZQA 2D62A 1XTIA 3SYNA 5KU1A 1E9FA 4JLOA 3C16C 4Q4AA 2IYZA 3EIEA 3K0AB 3E2IA 1GM5A 2QPTA 2DWOA 1J2JA 1ODFA 1FTNA 2P2LA 3QVUA 2YOHA 5P21A 2ZJAA 5CK5A 4JJKA 3UKDA 1KSJA 1GDDA 2YOGA 4V0OA 3T12A 1BYIA 1ZP6A 3HR7A 1N2CE 1CR2A 1NRJB 2E9SA 3VFDA 1EESA 5BYKA 3I92A 3ZVLA 1XMVA 4KHZA 1R6BX 2AK3A 2X2EA 3BE4A 2VF7A 3RNLA 1CRPA 4FXPA 5FL3A 1EFRD 4NP6A 1EFRA 3AV0B 1ZC3A 1OW3B 3CX7A 4EUNA 2RGNA 1E2JA 2F1JA 4RD6A 4C0LA 3L8ZA 2HT1A 4G5SA 1ZBDA 5KDLA 1X8JA 3OAAA 1AS3A 3EIHA 2OZEA 1YZQA 2J7KA 2XB4A 4DCUA 1KTVA 4KSCA 1Q22A 2P6NA 1GVNB 4BLPA 1Z6AA 2F1HA 5FOTA 3A1WA 4OHYA 1DS6A 4Q1CA 1CXZA 3A4LA 2E87A 2ZR7A 3AB3A 2W58A 2V7QA 2OFOA 4IVQA 5DGXA 4BRWA 2BMFA 4AKGA 4L4UA 4M9QA 4NTZA 1CULC 3REFA 2O8CA 1P2VA 1R10A 1IN5A 4F4IA 2G6BA 1TQ6A 1IY2A 1R7RA 1Z28A 3GJXC 5EE5B 1HA3A 4B3BA 2FDCA 2V1XA 1VTKA 2OILA 4QOSA 4CT5A 2JLYA 3OEHA 2IEYA 4LJ5A 5JZVA 1E32A 1KO5A 5HTKA 4K46A 3QKRA 4RVCA 3QOFA 1DAMA 2CCGA 4NU0A 4QGHA 4C2UA 1S9DA 2GZHA 4F93B 2Q3HA 1KYIA 2VP6A 3Q85A 5J4YA 1LV7A 1MH1A 1NVVR 4YQFA 5KDDA 3RRZA 3EA0A 1E2MA 1FUKA 4XSGA 2FFAA 2QAGA 3LFUA 2RGGA 2OO7A 1QG4A 4KV9A 4PHHA 1U8AA 2GXQA 3TR0A 2GCNA 4EPVA 1TTTA 3GJ5A 1SULA 5JWRA 2OSBA 4Q48A 2A5YB 2BHRA 3ADKA 1ZM7A 3X1DA 5E7IA 3T1VA 4NONA 3WMGA 2MSEB 2VHTA 1IBRA 4PQRA 1OPXA 4GL2A 4TQAA 4GP7A 1J90A 1KI1A 4HB2A 3HJNA 4RD3A 2QE7A 1XD9A 2ONKA 1EXMA 1XBTA 2ZI5A 2F1RA 1IXSB 4KVAA 1J99A 4IOJA 2VP4A 4W9MC 5F2EA 2VF8A 1ZW6A 2IS6A 2FPMA 4NYMQ 1CBUA 2OBNA 3FMFA 1I2MA 2ZE7A 2VO1A 3R20A 2DFLA 3K9LA 2FSGA 1OFHA 1OFIA 5DH9A 5FUWA 3U60B 1OH6A 3CPHA 4NCIA 2OXRA 2V9PA 3UMFA 4JL6A 1NMYA 3LV8A 4PC2A 3A4NA 1L4UA 4U5XA 5B64A 1HE8B 2AXPA 2FGJA 4O0MA 4HAVA 1L7VC 4V0ME 1G8GA 3HU1A 2WJYA 3AKYA 1KI6A 4MRRA 2YWGA 1U99A 4TL8A 2ZJOA 5H68A 1IXZA 1XMJA 4TYWA 4TMTA 4NCJA 4B2IA 5L3VA 4K81B 4TT3A 5E95A 3WBJA 2FSIA 3NG1A 1VIYA 1ZIOA 1KK3A 1UPTA 3Q7QA 2MMGA 4GNKA 3WHKA 1S1CA 3VX4A 5DI9A 1G18A 3KQNA 1WBDA 1RKBA 2VTKA 2Z4SA 4NCNA 3VR1A 3O8DA 3WYAA 2W83A 3AVOA 1S2MA 5G40A 1UEIA 2CLCX 3NVAA 2ERYA 3IO3A 3J81k 3PEVA 2ZQ5A 3LRPA 4OQXA 4H9GA 4IVRA 4QFMA 1KK0A 3R7WB 4MYHA 3RSLA 3GFPA 2W6JA 1IJFA 2WKPA 5KPJA 1JAIA 2Q0HA 4JS0A 4D4MA 3RS5A 1S9HA 4DB2A 2XXAA 3LNCA 2O8DA 1ZD8A 2QROA 2RGDA 2Q21A 1DADA 2DWPA 1XEXA 5CM8B 2WPDD 4GFDA 3CH5A 1CJVC 2JEOA 5FPTA 3IILA 1E0JA 1E1QD 4QNMA 1Z6YA 5HE9A 1IAQA 3LX8A 3Q5DA 4B71A 1P9RA 2V6IA 2NO0A 4PTLA 4Z1MA 4CEHB 4LRWA 3DKPA 2VPPA 1QHIA 3A37A 3AM1A 2WSSA 2PX0A 4QBGB 2ZRIA 4TWZA 1GNRA 2C9OA 4KLNA 4Q7JB 1G19A 3GP8A 1WMSA 1UBEA 4M1SA 4MRPA 4C2TA 1MO3A 4HZIA 2JLRA 2PEZA 2C03A 3KKMA 5IK2D 4Q1DA 2NO6A 2NIPA 2H57A 2O8FB 3BH6A 1Z0JA 3LBNA 4LZZA 1E9CA 2G0TA 3NHAA 2C95A 4LHYA 2BIFA 2WHXA 1C4OA 2B7BA 2OAP1 1G41A 1NL3A 2QQEA 3M0EA 4B2LA 2V1UA 2ZITA 4LC1A 1YRBA 5AJZA 1MR3F 3EWAA 2REBA 3UG6A 1CP2A 3ICQB 1N0VC 2OHFA 2PCLA 4PSVA 2JLSA 2ZI3A 3NEJA 1QHYA 2KB0A 2R6DA 2R8RA 3K9NA 4Q4AB 2WOOA 4RZUA 5FTKA 5CB6A 1NY6A 3GEIA 3W8RA 4EFNA 2ZJ8A 1G21E 4NCHA 2NZJA 1WCV1 1PZNA 3Q7PA 4PFSA 5JSZA 1E94E 5HCIA 3PEWA 1H65A 2WPDA 4JBWA 3L82B 4Q5IA 2IL1A 4LY6A 2H5EA 2G3YA 2ZTSA 4I4LA 3ZQJA 2IS4A 4DDTA 2WV9A 1ZNWA 5HR5A 5LB2A 5AJXA 1E9EA 4M22A 4OK6A 5CIWA 2ZUBA 1F2TA 1FQJA 1KZ7B 2BCJQ 2IEZA 3GJ0A 4HSEA 3SQWA 3RRNA 2F9LA 3TW8B 1H8HD 2ZRJA 4YLGA 3MFYA 1LS6A 2WWWA 3KB1A 4AG5A 1N5KA 8OHMA 5B2ZA 2ZI7A 3OEEA 4QGGA 3VR3A 3ZIAA 1G4UR 4PHTA 1XTRA 2QMOA 3WNDA 2VLIA 1GKUB 3ZZTA 2YINC 4LDJA 3MWJA 3QQ5A 4U7DA 1NKSA 4Q66C 3WMFA 2ZPTX 3K0CC 4ILEA 3O8CA 1ZNYA 121PA 2HXYA 1W44A 5CIQA 4FCTA 2D2EA 4OI0A 3EAQA 3W6PA 1N6PA 3SI7A 5KYKA 1PLKA 1MABA 1UKZA 2BVNA 1BKDR 2CVFA 2WWGA 1M7GA 2HV8A 2JLXA 2YWEA 3GQBA 3LLMA 3PUWA 2JLUA 2IT1A 3T5DA 3KX2A 1XEWX 2ZROA 3Q9LA 3THOA 1VCMA 2G0NA 4Z1MD 1D9ZA 3KB2A 2WIBA 1ZRHA 2ZREA 3KXLA 4KBGA 4D80A 3AVUA 3HU2A 2QT1A 3K0FB 1V5WA 1GAJA 5FI0B 3DMDA 5BQ5A 2C77A 1KAOA 2GK6A 4DLTA 1MABB 3IQWA 3QY0A 4XJXA 4JLVA 3W6OA 3CNOA 2GAOA 4HATA 3ZYCA 5LPNA 5HE8A 4KFTA 1KO4A 4PC6A 2ZVPX 4P4TA 3AVVA 3TR5A 2E1RA 1OB5A 1LS1A 3IIJA 4EPTA 4DUGD 3NH9A 1M7HA 1ZIPA 3W9YA 5DNYB 1VG9B 3I5YA 2IHYA 4I81A 2OT3B 1W2HA 3BRWD 1OJLA 3O8BA 3NBXX 3L0IB 4YDSA 3ADDA 1DEKA 4M21A 1E9BA 3IBGA 4GZLA 1VYUA 1OXUA 1WB9A 4XWKA 1Z63A 4CF7A 3QPVA 2ZRCA 3OEHD 3BB1A 3B1ZA 5EUQB 2JJ1D 4FCVA 3RVBA 5K8IA 2OAQ1 4MQBA 1FW6A 3GD7A 3X1XA 3GLFE 1IJEA 3DHWC 3K0AA 1U81A 2XNSA 2NOAA 4D4JA 4PAQA 3LQRA 1W0KD 1DG3A 2C5LA 3I32A 721PA 1VYVA 1OV4A 4CEIB 2QA5A 2D06A 1S3SA 1OKKA 2FPLA 3IEVA 2UKDA 1E2DA 1G5PA 4OI2A 5HZHA 4OHWA 2R6GA 3B1VA 4L9SA 3LW8A 4N3NA 1NSFA 2JIZA 2GKSA 1EFHA 3OAAD 4LHVA 1OSNA 1FMLA 1UDXA 4NE2A 1M6NA 3CPJB 4FWIB 4H1UA 1ONBA 3PENA 4LBZA 1WE2A 4LBYA 3T15A 2YVUA 3PV0A 4AYWA 5AUPB 2V3CC 2X77A 1KDRA 2BM1A 2WBLC 4FW9A 4YMTA 1Z3IX 4AURA 4XOIA 2CJWB 1MO5A 1ZU4A 1AGRA 5DISB 621PA 3MAAC 3RANA 3LWNA 1OF1A 4CYMA 3ADCA 1UBFA 2L0XA 1U0HC 2DBYA 2DFTA 1GRRA 4C7OB 4Q9IA 4B2PA 2IF2A 2IXFA 1RYHA 5EJEA 4R98A 3ZS8A 5FTNA 1G8FA 4DT1B 3C8UA 4EQ6B 4BGDA 1G3MA 1G1MA 1R5OA 1V43A 5JWOA 3OIYA 3EZFA 1OT3A 2A30A 1FFHA 4C0JA 3PUXA 3ZDQA 4TMXA 2IXEA 1RE0A 1XEXB 4KYUA 2KWIA 4EIWA 2QP3A 5EUMA 2WICA 3LXXA 1Z0IA 5L3SA 5EP2A 3NBYC 5GVSA 1E9DA 1KY2A 3OEED 4NL4H 3ZIAD 4L15A 3GJ4A 1NBMD 1N5IA 5C1BA 1IN8A 4NYIQ 2IBMA 4A0HA 3AVPA 4ASUA 4RFSB 1W4BA 2XJ4A 4MRVA 5EE1A 2WWYA 2DPXA 1JEEA 2YZ2A 4C3ZA 3WY9A 1GSIA 1K5GA 3MRSA 2QSYA 2LCFA 2ZS8A 4IKEA 3C15C 2DYKA 3FOZA 2P3SA 1Z0DA 5AUQA 1KSHA 4Q1FA 3DO6A 2RGAA 4DSUA 3CB4A 1GNPA 1MRNA 2C98A 3SOPA 4Z8YA 1QF9A 1XRJA 2WJGA 4B3FX 3LW7A 4Q7LA 2GBLA 4HUQA 1FX0A 2O8EB 4ACAA 1AA9A 4DUGA 5FUVA 4A9AA 5C4MA 1U98A 1G8HA 1I4TD 2HF9A 4PO8A 4MGIR 1RRFA 4PSAA 5EXPA 2JAQA 2J5XA 1FL9A 2HCBA 4HEJA 1IHUA 1CLUA 1SQ5A 5JJIA 4EFMA 4G01B 3ETLA 3TBKA 3B85A 2CEAA 1NJFA 1ZAKA 1UEJA 4J0QA 3TE6A 3VTKA 1J7KA 3D3QA 2HT6A 4KSBA 5CK4A 4IXMA 1RFLA 2IYUA 3W3ZB 3PVSA 2MSDB 5JWHA 3U7HB 1Z07A 4PZZA 4TYYA 2RGEA 1VECA 2HEIA 4LHWA 5TDHA 2GCPA 2JLVA 4IOMA 4PO9A 5EQTA 1BO6A 1GUAA 3QJYA 2EYQA 2ZRPA 4C7OA 3L0OA 1SXJC 1KMHB 1T8UA 2WZQA 2GCOB 4HDCA 4MUAA 2VSXA 3SFZA 3U61B 2WWXA 1XU4A 5J4HA 2HCJB 3S1AA 3SC3A 3ECCA 1W0JD 4ZKEA 3IHWA 3AKDA 3AGQA 4QM6A 5H70A 2DCUA 3KTAB 2FG5A 2KSQA 5FBQB 2QAJA 4HLQB 4MKHA 5DYIA 1ZVQA 1E99A 1MKYA 2X1VA 4LJ9A 1COWD 4F4JA 2JIZD 5KOYA 2CDNA 3Q72A 1F6BA 3FMIA 4Q7MB 4F7WA 2VEDA 1II9A 4XSHA 4TLCA 1W36C 2GEUA 3K53A 3P20A 3ADBA 4PXAA 1E79D 1VG8A 2HJVA 1YVDA 3A1VA 421PA 2QPOA 1B23P 3C14C 2XNDD 2ZSAA 2A5JA 4QJ4A 3I72A 4A2WA 2GZDA 1KDPA 2J0UB 1VG0B 4AYTA 1EX7A 1KI9A 1TL7C 3EZ2A 4S2EA 2JJ2D 4WIAA 4B43A 5DE3A 4JSYA 1N6RA 3VHLB 1DTSA 1KO8A 5GJVC 3W34A 1TEVA 5HKKD 5FFMA 3SHFA 4XVRA 1P5ZB 5F3WB 2VHQA 3GJ3A 1KSGA 2HLDD 4PZYA 4YXWA 1KI2A 4QHSA 1YRAA 2ORVA 4OI1A 5J4LA 3C4JA 3JVUA 1COWA 1KNQA 5CYOA 1RZ3A 1RRGA 1SHZA 1SVIA 1O3YA 1F5NA 1GL9B 2I4IA 3OHMA 4JVLA 2XZOA 4IEEA 4QGFA 5AK0A 4HZUA 3A1UA 3QVVA 3R8CA 2O8BB 3SJCA 5KNCA 1ZUIA 4TMWA 1G4AE 4AC9A 1N6LA 4UKDA 4M53A 5FL7D 3NH6A 4I1SA 4H1VA 2ZETA 2YNMA 4KU4A 3PG5A 2KBFA 2ZI9A 3PUVA 1T6NA 4JLAA 3UWOA 3DDCA 3OIVA 3AQ4A 3ZGXA 4BASA 1AN0A 2EFGA 1SXJA 4QBIA 1P4SA 3CONA 5B57C 3GMTA 2ZS9A 4Q1EA 1E79A 1HQYE 3SNHA 3TUIC 3NBZC 3ONWA 2CHQA 3GFOA 1E3MA 2CK3D 3VNUA 3QXXA 3IKJA 1KGDA 1PUJA 5DLQC 4C0QC 1G3UA 2QTVB 2V55B 4IFBA 1K5DA 4L5BA 2YJTD 1TADA 2BKUA 4B73A 5LD2B 4W5HA 3QBTA 3AVWA 1KI4A 1P2UA 2JJ8A 4D6PA 5HZKA 2VHJA 4M1YA 3FFBA 2AFHE 2BBWA 2IYQA 5BYJA 3U7GA 2ZSFA 1CRQA 1Z2CA 2Q9AA 3AF1A 2QQ0A 4URWR 4E03A 3EW9A 1U8ZA 2ZVQX 2ZSBA 4XVQA 1M1YE 5KSYA 5L3SB 2WSMA 3THYA 3A58B 4HDQB 3AP1A 2FN4A 1US8B 1ESNA 3AVQA 1LB1B 5LBIA 1ZUHA 3WHLA 5E3HA 3T1TA 3RHFA 4UQOA 2ASEA 2QBYB 1HY3A 3KKOA 4GT1A 1HEIA 4E5UA 3F8TA 3CZPA 5CYPA 3REGA 1PLJA 5DHAA 1P72A 3BH7A 1DAGA 3KJHA 1CEEA 1JR6A 1VHTA 3UMSA 5E4FA 4Q1BA 2PX3A 2OM2A 4NPHA 3VX3A 5E7MA 3UPUA 1VCIA 2QMEA 4IDPA 1ZM3A 1Y3AA 3HU3A 2RB4A 3WYFA 4A0RA 2BBTA 3FHOA 1XJCA 3PQCA 4A92A 3QKSA 4ON9A 5FPHA 3AKCA 1NY5A 2FPKA 2XOKD 3NC1C 1KZGB 3IIMA 3ND9A 1X1RA 2KJQA 1SKYB 2RHMA 4BLOA 1UKYA 1E2HA 5DN6D 2BJWA 3ZQ6A 4TMZA 4L8GA 4US1R 5FL7A 3N2EA 1NBME 1IN4A 3QXHA 4UJ3A 3UG7A 5C4GB 4KCGA 4F92B 5F9HA 3RLFA 2FZLA 4TLEA 5JCPA 3K09A 4HI0E 3I61A 2WJHA 4JLJA 3B1WA 1Z6XA 2VHUA 3I8SA 4D0NA 1S3GA 1NN3A 2QP4A 3Q5EA 5TARA 4FMCB 1E2EA 2EQBA 2QE7D 2I1VB 3CPEA 3FTQA 4PHGA 4D81A 2FE4A 3VHXA 1OKKD 5IHPA 1XZQA 3CKLA 1DARA 2B21A 3IQXA 3R8FA 2V4ZA 4JIMA 4LK2A 2REOA 4X8OA 3P1JA 2GCOA 2NO7A 2IX3A 4US2R 3B8HA 4WZ6A 3MLEA 1ZNXA 4JVNA 1RW4A 3KKQA 1JR3E 2P6RA 1WQ1R 3BD9A 2CCJA 1N6OA 3RYTC 5L8VA 4I1OA 1JECA 5BXQC 2UZ3A 4CRWB 4AK9A 2ZJBA 3CRQA 2DWQA 2Q9CA 3TUZC 3THYB 4Q9KA 3E70C 1NVXQ 1LNZA 2WAYA 2WAXA 4D4KA 4CEHA 1MO4A 3L0SA 1XP8A 2OUKA 4BLRA 3NEYA 4GDFA 4Q21A 3U3KA 4A6XA 1SVLA 4BFTA 3CWQA 1RC8A 2XZLA 2IYTA 4DCSA 1OH7A 1OHHD 5EP1A 1XTQA 4TYQA 1W4RA 4G5RA 1D6JA 2GDJA 1AZTA 4QHTA 4YMSA 4G5QA 5IF9A 4OL0A 2R65A 1II8B 3ASZA 1S0UA 2GEDA 2IA5A 4LBVA 2ZAMA 2HYDA 4FMDB 4EFLA 1T3SA 4MITA 4AYXA 2WKRA 1WRBA 3WYGA 4YXWD 1E6CA 3RABA 4M1WA 2VP2A 3TVDA 4ARZB 1P2TA 4DT1A 2WTUA 4HB3A 3CNNA 4JKYA 3SJAA 1XXHB 4DRZA 2DFNA 4OI4A 4PPFA 3TLXA 4BEJA 4C0SA 3QE0A 1IOZA 2EFHB 4IW3B 4JLDA 3GJ8A 3THWB 4HUQB 3FMOB 3K9GA 4AG6A 2D7CA 4P4SB 4KVGA 4V0LA 3RRMA 2CHGA 1N0WA 2O8BA 4LUCA 1E4YA 3EWSA 3Q3JB 1QHSA 3SDZA 2OFXA 3WXMA 1QVAA 3U2QA 5GJBA 3QEJA 4DSNA 1KDOA 3W6NA 5EE9A 4LI0A 4BEBA 4CGZA 2BOVA 4BRUA 4D0GA 2YC4C 3P4XA 1KDTA 2VHCA 4JBYA 3F0TA 3SBEA 4QG7A 2J3EA 4W7SA 1WF3A 1H8HA 2FU5C 5E7JA 2WKQA 4FN5A 1ZD1A 1OXVA 5FUXA 1EGAA 1NP6A 2GTPA 2ZUCA 1FP6A 4KXFB 4ZDKA 2A7QA 1QDEA 5AJWA 5CITA 4B32A 1K6MA 1JBKA 1PUIA 1TNDA 3FYHA 4MA4A 1Q0UA 1WDTA 4WXPA 3U4QB 3I62A 2H17A 2ANBA 3VR5A 3U44A 2X2FA 4TTRA 1FX0B 1A2KC 1VHLA 3IUYA 3KQLA 4FWTA 1LF5A 3QENA 4P3YA 4LWZA 1NG1A 3N5CA 1N0UA 3BGWA 4B3CA 1HQCA 2FMXA 3IGFA 5FPSA 2FA9A 1F60A 4IJMA 2IYLD 3KJGA 4ZI3A 1GG2A 1LW7A 3OIWA 5FTJA 2FJUA 4FD2A 5CDFE 3ASYA 3MG9A 2IC5A 4B3DA 2RH5A 2YC2C 3VAAA 1NIJA 1KY3A 1W47A 4KLZA 4ZCMA 4B3GA 5JLJA 5JFGA 1OH5A 2QRZA 1HYQA 2XITA 3LVQE 5C18A 2QN6A 1NI3A 3NDBB 4OYHA 5CLLA 4OBEA 1JXMA 2C9YA 3KKPA 1O87A 3B1YA 4JL8A 5C2JB 3RC8A 1E0KA 2VQSA 3B5JA 3GFTA 3V00A 2B92A 3IPXA 1II0A 4WZBE 2ECKA 1II8A 1PJRA 1XNJA 2FEOA 3BOSA 4CIDA 3TVTA 4EPWA 1GRQA 1KMQA 4QBHA 5AWFC 3EZ6A 1YR7A 4ZI2A 4A0GA 2F7SA 1LY1A 1G8PA 3BXZA 3V4RA 1Z08A 2GXAA 4KFRA 2EVWX 1ZCAA 2B8TA 3HYTA 3PEUA 3M4YA 4IOKA 2FH5B 1G9XA 2IW3A 5L3QA 3RS0A 5TV2A 2IYYA 2QEQA 4N1AA 5CDFA 4E07A 3U7FB 4ZDIA 5LD2C 3CLVA 5CB8A 1QBKC 2ORIA 1YJ5A 4D0LB 1OIWA 4YDHB 3GCGA 3MSXA 1S8FA 1YZKA 1JAHA 2ZEJA 3BORA 2QI9C 5EXTA 1F2TB 2ZRLA 3W8NA 5H1YA 3GLGE 4OHZA 3BAFA 4JLPA 4HLUA 2YOFA 3QIAA 5CJPA 2WJJA 1P9NA 4U00A 2Y8EA 2DB3A 2QTHA 5DO9A 2CLSA 1E2PA 1HH4A 1OIVA 4R71A 5IDVA 4JBXA 5J4KA 3NTUA 3WRYC 1QZXA 1D2MA 1R0YA 2BBSA 4IFEA 1KJYA 3PXGA 4POAA 2UZIR 1S96A 3U3MA 1Q21A 1YZUA 2ZU6A 3CBQA 1XTKA 4NYJR 4BPBA 4Z51A 2PJRA 4DLUA 4PSKA 1GL7A 5SZIA 1TEXA 4ESVA 1OFUX 1L2TA 3IIKA 1AJEA 4OQNA 3THXB 1YZTA 1U94A 2KE5A 2W2TA 1QHGA 4M9XA 2QMHA 3TSZA 2QUZA 2J7PA 4C0HA 2IYVA 3BJIC 2QM7A 1Z0AA 2C04A 1W46A 2FNAA 4HAYA 4A82A 3OIUA 1N6KA 2PLRA 1E96A 2GJAA 2DR3A 3DL0A 1ZU5A 3PFIA 4OKSA 4Q19A 1DVRA 2XSZA 4RSGA 4XIGS 2V6JA 3TKLA 3VU9B 3FFAA 3THXA 4LHXA 4LYFA 5IRCD 1TU4A 2AN9A 1MO6A 1YQTA 1R0ZA 4BLSA 2UVQA 4GZMA 1NN0A 1AKYA 1W49A 4KFSA 1L4YA 3B6EA 4NYIR 4QC2A 4MKIA 4F91B 1D9XA 1NJGA 3CW2A 2W2VA 4RJLA 2IXGA 2RGXA 2W2XA 1BIFA 4IXNA 4LJ4A 4OQFA 4HLCA 2GF0A 2BEJA 4R2HA 4ZO4A 1DAFA 5F9FA 2C8VA 2QTFA 1NIPA 3UWKA 3VKHA 1JALA 1E1RA 4QGAA 5G41A 3R7WA 1JR3D 2QBYA 3AH8A 3ICEA 5ANRB 5JEEA 2FWRA 3FWYA 4UXHA 2J7PD 4DLRA 4JVSB 5CLQA 4LCBA 4AKHA 3PR1A 4GP6A 3A8TA 1EX6A 2YWFA 2D2FA 1U9IC 1F2UA 3MUFA 3ZJYA 1KKLA 4QKQA 2QRNA 4ZV4A 4GI7A 3LBIA 1J70A 3KFXA 3EPHA 4DDVA 1QVRA 2GXUA 2Q3MA 2C78A 2ZYTX 3D6TB 1N5JA 3RRYA 1ELOA 3B9QA 3QEOA 2Q3FA 1KI3A 2W6JD 3EC1A 3R9XA 4BECA 1JI0A 3RS2A 2IYWA 3GEHA 5FH9A 1DAKA 2ORWA 1KK2A 3DPUA 3NDPA 1OH8A 1Q3HA 1Z0KA 4NZYA 1E2NA 5G3YA 4BLQA 2EYUA 4KO8A 1XPUA 3AF2A 1ZJ6A 2EFCB 2J46A 1WP9A 2QNRA 4DXAA 3ZD7A 3C41J 4X8HA 2JASA 1R0WA 4TMVA 4A2PA 2IYXA 1R2QA 1P2SA 2GHIA 3AUYA 2EFDB 4EJSC 1VPLA 4L16A 5JS8A 1IXRC 3C5CA 5TVKA 1VCOA 1N3BA 2XTNA 1W48A 5JRZA 2P5TB 4Q4JA 4B74A 2QAGC 1C9KA 4XTCS 1Q1ZA 4HUTA 1G7SA 1BS1A 3GLFA 2XB2A 1YHNA 1G3RA 3QG1A 3QBVA 1F48A 3EIQA 3I5XA 1T3HA 1ANKA 3GPLA 3VKGA 1A5TA 1XEFA 5G3ZA 3EASA 2ATVA 4CDGA 4DDWA 2P6UA 4LV5B 1NN5A 3KZ1E 5GJCA 1KOFA 4P0TA 1P61B 2WMOB 5G53C 3UMRA 1U0JA 3GJ7A 3TQCA 1FUUA 3PUYA 1NVUQ 1T5LA 2EU8A 3B7GA 4O2RA 3UATA 2G1JA 4FCWA 2QPAA 1QG2A 2F55A 521PA 2JDID 4M2LA 5M04A 4X8MA 3T35A 4OQMA 2ZE8A 3AKEA 2P5SA 2P67A 5FOSA 4URYR 1GKIA 2CLDX 4WXRA 4BQSA 3IEUA 4M0LA 1YR6A 2C9CA 2ZAOA 1IQPA 4JKIA 3SBDA 2VRWA 1FTSA 3PEYA 3EA5A 2O8CB 4RY2A 1N6IA 3ZS9A 3UK6A 5ELXA 221PA 4LJ6A 2JJ2A 1UM8A 1JNYA 2JJ1A 4LPSA 2X19A 4TZ0A 1KHTA 5JI2E 2ZIAA 3CM0A 4N0EA 4DC9A 1U9IA 2KBEA 3TK1A 1YZGA 4Q7KA 1A1VA 2BMEA 4KYIB 3CRW1 5CM9C 1FP7A 2R6AA 3DVLA 3H2YA 3IHLA 4EKDA 3H4MA 1CJMA 1E2IA 2J41A 4G3XA 4R7ZA 3EPLA 3PCRB 1Q1BA 3PITA 1CR4A 2JLZA 4PC3A 2CHVA 4JLKA 2ZM5A 1ZMXA 2BM0A 4HZUB 4IHQA 1GRNA 1JEDA 4P31A 5JMTA 3CH4B 4WW0A 5TY0A 2OBMA 3ZZUA 3WNBA 1CS4C 5HCNA 4QJ5A 1XX6A 1E2GA 3K09C 1YKSA 2ZSDA 5JHGB 5KUTA 3RSOA 5CJ2A 4TLDA 1N6HA 1UJ2A 2NPIA 2J0UA 2ZJYA 1A7JA 2F1IA 1H8ED 1SXJB 3HWSA 3S1AB 4KODA 2AD1A 2R6CA 3TW4A 2AHOA 3PUZA 1CKEA 2ZUDA 1IN7A 4X8LA 1XEWY 3NBFA 2B6HA 4C0AC 1OHHA 4DLZA 1KJZA 2WJVA 4HAZA 4D2IA 3KUDA 1IN6A 3CR7A 1SZPA 3L2OB 4DLYA 2XSZD 4GBMA 4TN1A 2ONJA 5FBWB 1UAAA 1D2EA 1JJ7A 1KSFX 2HLDA 3O47A 4BZPA 4E22A 3RWMB 1Q12A 1M7BA 2D7DA 2ANCA 3TQFA 1SGWA 3G82C 3EZ7A 4MGZR 5SZHB 1GTVA 5KNDA 4TYNA 1IY1A 4C30A 2JA1A 2FSHA 2RGCA 3TNFA 5KDOA 3FB4A 3GLHE 5B30A 1Z83A 4MH0R 3EXAA 3OE7A 3H0KA 3KDSE 1FOEB 3ND8A 5EE3A 4TLBA 4ZPXA 4LBWA 4HAXA 2VA8A 4CVNA 4EDHA 5EE0A 2QY9A 1E9RA 4M9ZA 1Z6TA 1NSTA 4O3MA 2OBLA 2VL7A 3EPJA 3QF4B 5JS7A 2VSOA 3LQQA 4UNSA 2IK8A 3TUJC 3LA6A 1UADA 2CL0X 5JJKA 4PO1A 2GK7A 1PV4A 4E09A 3BFVA 4M1KA 2FV8A 1S1MA 1BOFA 2AWOA 5FPYA 1X6VA 3CX6A 1P3JA 4RKEA 3PJRA 3GJ6A 4HDOB 3CWZA 1RVDA 3DM5A 3LD9A 1YR9A 4XH9B 2FFHA 3SYKA 4W5JA 1RIFA 2CE7A 2AWNA 4LYHA 4S35A 4JT4A 5SZKB 3K0SA 3FMPB 4Q02A 1G17A 2VIIA 2AR7A 5TB5A 2G77B 2CNWD 821PA 1W36D 3MMPA 1I4DD 5JBQA 1OYWA 4TZ6A 2DHRA 1TQ2A 2EW1A 4B33A 4ASUD 1JPJA 4N0DA 4V03A 4URVR 2YYZA 1US8A 3K0EA 4RD1A 2QGNA 1SVSA 1B0UA 2XEXA 1RJ9B 2QU8A 2GF9A 4JLMA 3A6PC 2V8OA 4NMMA 3QG5A 3TMKA 4IDOA 3OZXA 2F9MA 3BFKA 2QMUA 4QBFA 3B60A 4UNRA 3PIRA 2X8AA 3ZVMA 2G9NA 3T61A 4Q00A 3SHWA 1UBGA 4MRNA 1XTSA 4OHVA 4HAWA 4Y0VA 5DSZA 2H16A 3RS7A 1P75A 1LTQA 4FMCF 3ZZ0A 5TMPA 1XF9A 2W00A 4BZXA 2XZPA 3X1WA 1AIPA 1Z6GA 4TTQA 3IDQA 1CU1A 2OCBA 4TSFD 5EP4A 5FOUA 2AKYA 1GP2A 4AKEA 1F3OA 3T06B 4A2QA 4LX0A 2P65A 3X2SA 2A2ZA 2GVZC 2WMNB 1D2NA 1IY0A 1HTWA 1Z8FA 2ODEA 2H7VA 5KHOC 2I3BA 1PLLA 2O0JA 2PJZA 1SKQA 1OXTA 2A5DA 3B1XA 4Q9HA 3U6KA 1W0KA 4AKIA 1GKYA 2F43B 2ZR9A 5DIFA 2FOLA 1T5IA 3TAHA 4URZR 1MOZA 3NXSA 4IDHA 2ZRDA 5FTLA 1GILA 2NQ2C 4YMVA 2GESA 3THWA 1P73A 2WWIA 4DZZA 3SR0A 1G6HA 4P4SA 2YHSA 4HAUA 4JLNA 2PT5A 3P4YA 1R4AA 3L8YA 1XCPA 5A5GA 4CW7A 1SXJD 4LJ7A 4XTRA 3U3JA 5BWMA 2WWHA 4NCKA 4NYMR 4TSFA 4AI6A 3DOFA 1FPMA 1DE0A 1GIAA 4TQ9A 5J4VA 3HPQA 1NVWQ 1F2UB 3VKWA 1XDBA 5AUNB 3CF6R 2GBLC 2QL6A 1E69A 4PHFA 4Q1AA 2BKEA 3U3RA 4CEJA 2BMJA 1HURA 1T4GA 1ZC4A 4EPRA 4BLTA 4CZ2A 5DN6A 3U4QA 3QXJA 4G5OA 1G7CA 2MSCB 1GOTA 4RZ2A 3HP1A 5D3MA 4URXR 1A82A 2ZYUX 1ZCBA 2XTZA 3AGPA 1T0JB 1G16A 3P32A 2CL7X 4DHEA 1EWRA 1G7RA 3CR8A 4JZKA 3SN6A 3NWJA 1G5TA 1FZQA 1LF0A 1EFTA 1XD2B 1Q20A 4PQYA 4W5WA 3MD0A 2J0QA 2W6ID 2P0EA 2H18A 2PLFA 1N6NA 4ITRC 5DI3B 2ZRGA 3ZVRA 3MGCA 1OE0A 4LYJA 1VKJA 1ZNZA 3SJBA 4TTPA 4OJKA 4AD8A 1OXSC 2PCJA 2Q9BA 3IPYA 4ZIRB 1XZPA 3LAWA 1X8LA 2BWJA 1U0LA 4JYCA 4ARZA 3QKUA 4R2IA 3BC1A 5JHHB 4KFUA 2HDNB 4DIEA 1XD2A 2ZJ5A 4Q47A 6Q21A 2R2AA 2EWVA 4M1OA 4RKFA 2R62A 1J8MF 1IONA 3M1IA 4BFVA 4DLSA 1CR1A 4B6EA 5KPDA 2Z83A 1PVOA 3FKSD 4DKXA 4Q4HA 3B2EA 5EXXA 4LOAA 3K70C 3A1TA 3EX7C 1KI7A 2RKOA 1K8RA 3BWDD 1L8QA 1U2RA 1YR8A 2ZU0C 1XJQA 4DDUA 2FGKA 1ZYUA 1X3SA 3TJZA 2GJ8A 3V4FA 4BE7B 3IBYA 4Q9LA 3FKQA 1EK0A 4G1UC 1ESMA 3BBPA 1KKMA 2A9KA 1FMJA 1FNNA 2G88A 1E0AA 2G1KA 4D82A 4LJYA 2R44A 5JJLA 3D8BA 2F6RA 3QNUA 1GZSA 1XCGB 3DMNA 1DO2A 1E4VA 2CXXA 5KSOA 4WVFA 4CEIA 2D4HA 4IDNA 4P4UA 2ZJ2A 5JSZB 3SZRA 1M2OB 3OF5A 1R0XA 5KO2A 2GNOA 4JL5A 2HJGA 2HYIC 4DBLC 3N70A 4Q9JA 1AKEA 1BMFD 4US0R 2ZRHA 1UDWA 3CX8A 4KJZA 4Q4LA 1ETUA 2HXSA 3VU9A 3TSWA 2IUUA 5FBVB 3AF0A 5LB4A 3C7KA 4ABYA 5FPKA 1X8KA 3FHCB 1Q3TA 2AXNA 1TMKA 5K8LA 1EWQA 4ZDWA 4KITB 3N2IA 1VMAA 4II7A 4R9UC 2FZ4A 2H92A 1AS0A 4I1UA 3CF0A 4GOXA 1X1SA 2ZYVX 3QF4A 4XD7D 4ESHA 4XD7A 2XX3A 3DKVA 2GJKA 2IYRA 2WWFA 3QKRB 5EXSA 1KIMA 5AJYA 3B13B 4FI3C 3A36A 3I4LA 4UJ5A 4FMBB 5FR2A 3DOEA 4B48A 3HYRA 3D31A 4RCYA 1UKEA 3AP3A 2QAGB 2ZYWX 5FBRB 4BFXA 3AVYA 4DEXA 4DCTA 4OHXA 4G5GA 1P60A 2FF7A 1QHNA 1XD8A 2I1QA 2VP9A 1W36B 3CUEF 2NGRA 5B58C 4TL7A 3QKTA 1CJKC 2PH1A 4P32A 2WJIA 3QPUA 3T1QA 1YE8A 5UKDA 4YMUA 3K0CA 3KKNA 2Z5FA 3K1JA 2CVHA 1E9SA 3FHTA 4AWXA 3B82A 4D4LA 5GADl 3K9HA 2LKDA 3HPRA 1J8YF 1JB1A 1RRCA 2QZ4A 5EZ6B 2ZRMA 3IO5A 2IWHA 3SQXA 1T91A 2VSFA 4Q18A 4D26A 2N42A 1E2QA 2O5VA 3E1SA 4FMDF 3CRVA 5FOVA 4BFSA 1NLZA 1W2GA 2PEYA 3SFVA 3K70B 1GWNA 1QRAA 2NZ8A 3TSOA 4A8JC 4HYYA 4DJTA 1SVMA 1TPZA 2XTMA 3KJEA 4MRSA 1R8SA 3LO5A 3P26A 3FGNA 4AIIA 1AQUA 1VDZA 1A2BA 1G3QA 4DWJA 4GSYA 3AVXA 1Z22A 3B78A 1W0JA 1G20E 2GEVA 2QG6A 5KTYA 3FE2A 3LVRE 5FOWA 3X1YA 4Z54A 2O8EA 2A5GA 1P7CA 2RAPA 3SJZA 1Y63A 2REXB 2OLJA 4TQUS 5BN3A 5BN4A 2HF8A 4B44A 3CRRA 2PZFA 4C4PA 3H86A 1AS2A 2AKAB 4PZLA 3K70D 5D3QA 3QI2A 2AL7A 2AX4A 3NIBA 4RFSA 1P9WA 1E1QA 3QUSA 4BFYA 2GILA 1JXOA 4MYTA
chains in the Genus database with same CATH superfamily
4MUGA 2RE8A 2BUBA 2WU4A 5GONA 2SHKA 4PZPA 1IB6A 4WOPA 2N75A 2MU1A 5REQB 5JARA 4RACA 2EP5A 2DOKA 4GMDA 4GWLA 4KUEA 3FETA 4IEIA 4U9UA 2Z09A 4HEHA 4Q05A 5U9CA 1Q57A 2IPOA 3A27A 2G9RA 5IBRA 4BVEA 1RHUA 2ONZA 4QHYA 2VYFA 2PIDA 4XWAA 2WNHA 4IMRA 5TQ0A 4Z4CA 4C5AA 2FW1A 2J3LA 4TKVB 3CO5A 4L75A 3IMKA 3WLIA 2JCVA 1SCNE 4HB0A 1A77A 4GR4A 4HX5A 2QLNA 5BORA 5I45A 4E31A 1DKQA 3ZK8A 3ILXA 4QAQA 5AM0A 1XXHA 1IM8A 3TD9A 3V97A 5G4KB 1QFYA 3HLKA 2B0CA 4IOLA 3C3XA 4G67A 3QU5A 3MWYW 4BFUA 1MJFA 3RC2A 3KAJA 2O7QA 3Q6MA 3N0TA 1HUQA 3RAPR 5CGQB 1GSOA 5FTMA 5BSMA 1PJLA 3NOVA 3QKSB 3WAKA 1EQUA 2GZ1A 1RAFA 2V6BA 2W4IA 4QDKA 2GCGA 3N39C 1USGA 5JVDA 4CG0A 4L50A 4YXFA 1QYDA 2DT8A 1Y6GA 3HR4A 2QLLA 3N0VA 4XWOA 1FS4A 2C1ZA 4R5HA 4NJOA 4QJ3A 5KCZA 1L5ZA 4ACBA 1KYTA 1NLYA 3COYA 3TSCA 4B8YA 3ZQ4A 2YHIA 4H6WA 2VA9A 3T9AA 4JMPA 3W06A 4DLWA 1JKJA 1XB2A 3IMCA 2FSFA 3CNLA 3O8LA 5DXJA 2O3UA 2QX9A 2VHWA 2BD0A 1AGNA 3JQAB 3HXMA 3QYPA 2UYQA 4K0RA 3ZWKA 5K6AC 2ZRBA 4OCZA 3GEEA 1L5HA 5FWAA 1D5CA 4FINA 4BNMA 2IZZA 2QJRA 4UVHA 3PA8A 2UZ0A 3F3YA 2DG2A 2ZBPA 3AO0B 4NESA 3M3HA 4DY4A 4MPPA 3VMFA 1RMYA 3PNMA 4G4SP 3AYXB 3IHTA 4IUYA 3WKCA 3GLGA 4HFNA 3W05A 5KJ1A 4L78A 1O9HA 2P8SA 3DZ8A 2JAHA 4D9HA 2PUEA 1NBMA 4TZTA 2P75A 1SOAA 4BB9A 2G28A 1T43A 1J7JA 1DLJA 1SR8A 2V7QD 3T34A 4GEGA 5AVVA 1NNEA 3D7MA 4CFZA 5AVUA 3U5ZB 4XB1A 2BFOA 1Q1EA 2OY0A 4BB6A 1Z2EA 3C3MA 2VZ8A 4OP2A 5HIMA 3AW9A 1MX5A 3GV0A 4M1QA 1Q1AA 4OL9A 4JJ8A 5HHTA 2PVSA 2I65A 3ROEA 1UT6A 4O4JA 1B15A 5G02A 3C1UA 3EGEA 2P0YA 1NURA 3ONDA 2QKYA 2HI0A 3HZOA 3OE4A 4B17A 3KG2A 3NLLA 3WG9A 4ECEA 1SELA 3DF7A 4IG4A 4P08A 4ZYVA 5CB4B 1T0HB 1VBNA 2W8BA 2BEWA 3G8BA 1C4XA 4LWQA 1P33A 4A5SA 4PYIA 1H8EA 1UKVY 5FBZA 4A6PA 3ZPXA 4JLBA 5ITZB 3A3NA 2ZVDA 3V8QA 1GITA 4J3FA 1DTEA 1YDFA 2QRGA 3B6MA 3PQ4A 2ONYA 4LTNA 4HLUC 2VRNA 3BIOA 5AOVA 1NLMA 5H83A 5J5VA 2IDMA 2CE2X 1T25A 1MAAA 2QSZA 3ABZA 3T7IA 5KJ6A 1FP4B 4KSYA 1NMXA 5DNEA 4B6JA 1U04A 5GM1A 2IEIA 5KQMA 1CUIA 3KQHA 3AFOA 3JPWA 1J2EA 3QTLA 3OLYA 4WFIA 2IHBA 1CZUA 2FFQA 3A4MA 1IU9A 1NDUA 2N1BA 1A7UA 3EDYA 1YQ9A 2H29A 2YHBA 1TYZA 3H2KA 4C7JA 2G0AA 1CUZA 2WAMA 1RCUA 3AUAA 3OTIA 3R7NA 5IMBA 2Q2NA 5HF6A 3LI2A 1ULTA 3E1GA 3O4JA 2OZKA 5CDHA 1G38A 1KMHA 1SC9A 5BMVF 1PCXA 3KZVA 3QBJA 4BXOB 1AK9A 1RS0A 2WUGA 3DXYA 4PS0A 4RZ3A 5EWMA 1A7KA 4MIKA 1WXXA 3VQTA 1K8YB 2ZRAA 2VP0A 3WMXA 1BXRA 4TM8A 4BV3A 2YYAA 2FQXA 1HFKA 2RK3A 2PDAA 2VKTA 4X44A 4A1FA 4Z4GA 5ES4B 5CMLA 1TF7A 5AKIA 3TGPA 4FYXA 5KWEA 2CZQA 2JLQA 4LWOA 1DELA 1QYXA 4LW8A 3U19A 1W7AA 1DQYA 5A0TA 3QLVC 2XDQB 3FNBA 2C5AA 4GDMA 3C6ZA 4NXMB 1C7ZA 2GEKA 4BNLA 3DAPA 2CK3A 3KT0A 3RRJA 4AN4A 3HDQA 4N18A 1EFPB 1Z7GA 5CUQA 4X1YB 3LXRA 3RG2A 2X7HA 1PVDA 1Y8QB 4K1XA 1O1YA 5L3RA 1X9HA 2ACVA 2QRJA 2ZRNA 3FCAA 3ANYB 4GBED 4WY2A 1MDBA 1I1NA 2P1ZA 1KZ9A 3HO8A 1X87A 1H2HA 4O1MA 4MUXA 4Z7JA 4CCWA 1U6KA 4HJRA 3U4CA 2WAOA 3C1TA 1PR0A 4F71A 1ONPA 3UHFA 5EJ4A 4IHKA 2EW8A 4RWZA 4CKCB 2J1LA 2B7CA 2J59A 3A1EA 1KMIY 3CH6A 3DCNA 3RVDA 1RPAA 1B6SA 1R16A 3G1TA 2OD9A 4MPDA 1L5GB 2WYHA 2C59A 1ZRMA 5CDSA 2OR3A 1SUSA 2PZEA 4A4DA 1LPOA 1QZZA 3GP3A 4ZIRA 5CXSA 4Q6WA 4YR7A 3E3AA 3E5HA 3SE0A 1P1CA 4IQ8A 1TW2A 4UXJA 2ID9A 1BCSB 4HH0A 3EVTA 4D5GA 4J2OA 1EFUA 4LDQA 2MJLA 1GTZA 1YB6A 4GX2A 4V24A 5KNBA 1OREA 1GUDA 3WL7A 1FQKA 3NAZA 3D8SA 4EUKA 1LI4A 1E98A 2OG2A 2ZSHA 4Y2GA 4PHCA 1MT0A 1UFOA 2KI5A 5HJ5A 1UJ5A 5E4YA 2NZVG 4FNMA 4YHHB 2PD4A 5BN1A 2ZI6A 3EZGA 4GGPA 4KG7A 3ND7A 4L9AA 3T7CA 5TXGA 2VSNA 4RY0A 5D1NA 4AO7A 2B8WA 3LA8A 2VWHA 1I9CA 4QXPA 3BS4A 3W5IA 1OLSB 2VDJA 3G0CA 5EWJB 4A0FA 5FQNA 5IULC 5K8UA 2CD7A 3H1TA 4XAQA 4CKEB 2J07A 1IEQA 5DW0A 3UW1A 2YKGA 4ZAXA 3URKA 2GZRA 3RLIA 1M6HA 2RGBA 1DIBA 1JXOA 4X90A 4DNPA 4PX9A 3Q8XB 3I05A 1E9AA 1EX9A 4L5IA 5A5VA 3JQQA 1XL0A 2PQ2A 2PRKA 2ZUVA 3OT4A 2A0KA 4N9QA 1DXHA 1Z2AA 2G7ZA 1DXQA 4XVUA 3RBXA 4IRXA 2A86A 3DMGA 1Y4AE 1JR3A 2Y9MB 2TMKA 4G89A 3OOWA 3ADOA 2PFGA 2QTAA 1GQYA 3LC0A 1YRQA 3ENKA 3E3MA 1GZ3A 3FFTA 3OPYI 3PYXA 3NHSA 2OLEA 4V0KA 1PJBA 4ABTA 2Z8YM 1JLSA 2J67A 2ATIA 4KI0A 3T1OA 1K98A 3D4BA 5H8WA 4RDIA 2GMWA 1QK3A 4NOJA 4WLFA 3RVPA 3WLLA 2BFCB 1FYDA 3T9FA 3NT5A 4DCGA 4E33A 4W6QA 5BMVB 5DNVA 3LKBA 5CH3A 5AJVB 3KJIA 3KXDA 4MR9A 4IGIA 4LI3X 4DV3B 4YC7A 3GAFA 1FLVA 2HK6A 2TSYB 4BMYA 2VJMB 3RF7A 1KETA 3RS3A 4MP8A 2LDBA 2O6HA 2IELA 4WCFC 5T3YA 2RAFA 1JRLA 3MT7A 4JX9A 1NN1A 5EMHA 2B5WA 1Z4KA 1RNLA 4MQ6A 2HRQA 5IC6A 5I4CA 1YU9A 2BF4A 1KHHA 1J2UA 1L4GA 3GFGA 3P5SA 1KMMA 3N8KA 3OZRA 5CURA 4CT4B 2YXLA 1ZEJA 3GW8A 5AM3A 3MIZA 1S02A 1IVYA 1OI3A 2IOFA 4IIHA 1IM2A 1KIAA 1S8AA 5DM2A 3RWBA 1DIOB 3UFXB 5EQDA 3W5JA 3H9GA 3R4CA 1D2CA 1ZN8A 4UNPA 3RVKA 4F5EA 4AY6A 1YE3A 3FOCA 4B31A 3B3FA 3LHDA 2IXDA 2K2WA 3RSSA 1A8SA 3KFVA 2CNWA 1T8TA 1WXQA 1Y1PA 4PYRA 3WGQA 4A8JB 1RJ9A 2C8JA 2K5UA 1J4AA 5ALQA 2Q50A 3VR2A 1K1EA 2QYSA 1D3AA 2GYUA 3A11A 4GOKA 1N77A 3MS2A 5HG0A 2I34A 2O0HA 4F6RB 2QM8A 3AEZA 3V7WA 4Y0NA 4CNQA 4B7AA 1Z2DA 4QUGA 2YV1A 2DHCA 2PR2A 1P2DA 2PT7A 3EFEA 4M3NA 3O84A 4MQ5A 3RC3A 3T95A 3IPAA 3LMKA 1JQ3A 4B47A 4TLAA 3JR3A 1UXIA 1XKQA 2Q5OA 3CHYA 3CF2A 1Z5ZA 1XTJA 3GN1A 4FNGA 1IUKA 3LQKA 4DMKA 5JZBA 1EU1A 4UASA 4XWTA 3VNBA 3WP1B 5M2QA 3JASB 1RZVA 1TMYA 2MT9A 3R74A 5EOVA 2ZYHA 3GROA 3JZAA 3LUJA 1PZFA 2VP5A 4ZXPA 5AHXA 2H63A 3ZOKA 2JL1A 4YMWA 2OCAA 3DZDA 4DLLA 2I7DA 4NXNB 2ZSKA 2Q3JA 4JWKA 2C2ZA 1B0AA 2MMCA 1DXYA 2VYVA 4TPKA 2N46A 5ALTA 3QSYA 4ESOA 3WOVA 1V8DA 3BH0A 4OG2A 1YZNA 4U8HA 3F6BX 4QREA 3ORFA 3KJZA 5IZ4A 1OX6A 2NO1A 1P5HA 3H87A 2HRDA 3NHBA 5DNDA 1HKUA 4L4XA 4UZSA 4ZODA 4EYQA 3LY5A 4N82A 5LMUB 1Z45A 2QTNA 1UF9A 4RIHA 5FEMA 5C3MA 3DJYA 3R6WA 3ENNA 4HN4B 4V0QA 1SU6A 1EEXB 1VMKA 1GQ2A 3H0EA 9LDBA 1S2GA 1KI6B 3WIOA 1EYZA 1QONA 4MUIA 1Z88A 2BGUA 4JQSA 1HLPA 2E4AA 4RA6B 1QPBA 5C8YB 3PIIA 5J23A 1KRXA 4TQGA 1U7TA 1W9MA 1FTYA 1JEQB 1U2DA 3TQTA 2A9JA 3I64A 4L2IB 3ELWA 2M1ZA 5ADUS 3COWA 1GZUA 1E1DA 1QOZA 2X22A 4F8EA 4GI3A 4RELA 3OQHA 4LWPA 3RIXA 5L3QB 1UT8A 3KEQA 4FHGA 2JS7A 5EZYF 2GSWA 1R18A 3ILVA 2IHKA 3UC5A 3QWAA 4RMHA 2WM8A 5KOHA 1M34E 3QA3E 2IY9A 4LGVA 4GPTA 2NVWA 1RQ7A 4ZC8A 5GIPE 2QU7A 3QRWA 3DA8A 4OMDA 4RAQA 3S5JA 3ZVNA 1G64A 3MRXA 4S04A 1BYUA 3AF5A 2C4MA 1G3IA 5BW4A 2ZW9A 3IP1A 1KZ4A 1WW3A 4R8RA 5TQ2B 3E27A 1U28A 2J45A 2PXHA 4E14A 3RYIB 4B9EA 1JQDA 3B3JA 5DOVA 1E6LA 1H0KA 3LM8A 2CL6X 4JYBA 1RKVA 4UARA 1NI5A 3EBLA 3VZDA 3B2NA 3WI7A 3OFND 4LY0A 3TI7A 5A3RA 3F90A 5AW1A 1L7AA 1TUIA 1P18A 3DCIA 3L46A 5EKXA 4PLVA 3RTGA 4DCCA 4QSHA 4P3KA 1YB4A 4AJHA 4RABA 5TLSA 3V1LA 1Z35A 3QVWA 1NVVQ 2AQHA 3HR8A 4G4IA 4Y6PA 1DBPA 3W90A 2E1PA 1S4QA 1I3OA 2HCRA 2LKCA 4Z0NA 4LRSB 3VPBA 3ZTTA 3OZVA 1ONSA 4JAVC 4JLOA 1RBZA 2FP4A 4KAFA 2NVOA 3O8QB 4LYYA 1GM5A 4EB8A 4XX0B 1ODFA 2JGAA 4ZANA 4EMSA 2G82A 3GGSA 5A9SB 1R12A 3UKDA 1MU0A 2YOGA 4LVOA 4V0OA 1B0PA 1FFDA 1BYIA 3WNVA 1NVMB 1ZP6A 4ZVNA 2EERA 1N2CE 3AIIA 3PHGA 1GDTA 2R85A 3I92A 2KYRA 2X2PA 3T7RA 2FKNA 3HG7A 5LQNA 4C6TA 3ID6C 5D86A 2DZDA 1EFRD 1GAXA 1EFRA 4Y67A 4IDFA 2NUTA 4EUNA 1E2JA 3GELA 5JZ9A 2FDRA 3L8ZA 3LP8A 3NIWA 4RHUA 5KDLA 4E1BA 3OQIB 3R4VA 2CFCA 3FZNA 1RQGA 4JP1A 1TEHA 1VGQA 4QXMA 2VQDA 4UM7A 3MMXA 2JFNA 4F2GA 1Q22A 3RYHB 1Q1GA 3WLKX 2F1HA 5FOTA 2R8ZA 4ALNA 4XARA 4ENTA 1W4ZA 2R79A 1Z9BA 4E7PA 1MRZA 3A7EA 4INJA 4BRWA 4XSVA 5CA1F 1GSHA 5FI3A 2BMFA 1OWPA 4LA4A 5B3KA 1PJQA 4X6YA 2P9JA 4D99A 3OUTA 3REFA 3WGVA 1ZK3A 3OJCA 4JP8A 2XA9A 5EZSA 1YT5A 2G6BA 1TQ6A 1R7RA 3MGGA 1Z28A 2HU7A 4RLFA 3M49A 1GU1A 1RYYA 4O1HA 3OZFA 3QPBA 4B3BA 2SICE 6NULA 1D6MA 2M2IA 3KDPA 3O1HB 2JIRA 2V1XA 4HL6A 4QOSA 5K9ZA 2Q9UA 2FPXA 5EKUA 5DGCA 4LJ5A 5JZVA 3UGKA 5HTKA 3GJYA 2ZUSA 3LUHA 1IN1A 4M37A 4CR6A 3TXAA 4NU0A 2XNKA 4RF4A 1SC6A 3WE7A 1N5DA 3Q85A 3W5AA 5J4YA 3HWX1 1MH1A 1Z4NA 1FMTA 2OV8A 5COQA 1E2MA 1FUKA 1QC5A 1N1DA 1T4MA 3FUTA 4PHHA 4IFTA 2PH3A 3AETB 1YWGO 1OI7A 2ZAIA 3GLUA 1U8AA 5JAOA 3TR0A 2E7ZA 3F7TA 1SXPA 1O95A 3GUZA 4R8LA 5DNCA 1TTTA 1SULA 4RESA 3VU3A 4L0QA 4Q48A 4C89A 1Y9DA 4XDYA 2PWZA 2XUPA 3ZY4A 5IJZA 3ADKA 3EVAA 1P2FA 5E7IA 1DC5A 4FJ1A 4DY6A 3H05A 2NO5A 2VPZA 4FYKA 5A06A 2UVPA 1XDWA 1TTHA 2MSEB 1N2EA 1EB9A 1IBRA 2VHTA 2WIKA 1DQZA 2YZNA 2VDOB 2Z2ZA 2ZG6A 3FDZB 4GP7A 4TQAA 1YC2A 5D2CA 3BIWA 5T64A 5IMSA 3NORA 3QWIA 2E21A 3OURA 5AI6A 5FUMA 2OFPA 2QE7A 3OP4A 5IM4F 3G02A 2ZI5A 3CX3A 4FILA 4JB0A 4KVAA 1JEYA 2QMZA 3DTNA 5J2UB 3H2JA 5F2EA 3OM1A 2GN6A 4M9CA 3MCZA 1IEXA 4Y2JA 3TRIA 1UC4B 2WTMA 4FU0A 4KZKA 1U0SY 2G25A 2ZB2A 5HILA 4B4DA 4TV9B 1CBUA 1E3SA 1R6XA 1I2MA 2OBNA 3FMFA 3FTNA 3LYAA 1TXGA 3NBAA 3I6ZA 4GAEA 4IO0A 2BSQA 1WSBA 1QYCA 3R20A 3K9LA 3Q41A 4HNVA 2AG6A 2FSGA 1WXHA 1YQWA 1U2PA 4ZAYA 2WPNA 1OFHA 4CKEA 2H4ZA 1KQNA 3ZWMA 3U60B 3BMQA 3CPHA 4I2NA 3KRTA 4I4TB 1NRIA 1NMYA 2NWQA 4JL6A 3A4NA 1VPVA 1X1TA 3QVXA 1YDGA 2ZIZA 5JVDF 1L7VC 4PG5A 1GYQA 1THGA 1GTRA 2WJYA 4YEDA 1V1MB 5DCWA 3K8ZA 5AXDA 2PKEA 3WV5A 4HK4A 4Z4FA 1A8IA 5JPDA 2V6MA 2YWGA 3U9SA 4YFYA 3STTA 2JFWA 1IXZA 1SOUA 4FFLA 4X41A 1RZRD 1MC5A 4KQJA 2XOEA 4TMTA 3SKXA 1T5BA 4EM6A 3DFKA 1UBLS 3AR8A 4ZCIA 1YS6A 1KP2A 5E8JA 4H08A 4K2AA 1KK3A 3TQOA 4LSMA 1QYIA 2MYPA 5DI9A 1TZCA 2VDMB 1QH8B 2Z4SA 4UTXA 1KYQA 4ENWA 3O8DA 2A57A 3D3KA 4J4HA 5G40A 1GUBA 1GCGA 3U31A 2A1UA 3PC8C 5IX8A 3EF1A 1JHQA 3K8OE 2Z58A 1Y1LA 3I2IA 3LOUA 2H85A 1I01A 4OQXA 4IVRA 1PEYA 3R7WB 2YXDA 4MYHA 3L8CA 5FI5A 2D4AA 1E4EA 4PLTA 4U0JA 3N05A 2G9UA 4DARA 1IJFA 2WKPA 2WIJA 3IDAA 5CBPB 1V5FA 2LUOA 2XUZA 4MO2A 1HSOA 4H4CA 5EWLB 2NACA 1S9HA 2X0FA 3GVIA 3KWLA 4IFIA 3LK6A 5I7HA 1QNFA 2XECA 4BE9A 2XXAA 3LNCA 3GUUA 1GU0A 1PKEA 2DUJA 4UMFA 5CX1B 2QROA 2RGDA 1GN9A 2I2XB 3AONB 3FHLA 2VYQA 3GCZA 3IT1A 1R9MA 4RJ2A 4E94A 2PX5A 4HT3B 1JKFA 4G36A 4GU5A 5E6UB 2QWXA 1XEXA 5U4XA 3R8XA 2C82A 3SPXA 3WWDA 3VI4B 1ULHA 2Q4RA 3CH5A 4CMIB 5JR3A 3NHYA 4GMGA 2FUNB 1E4EB 1JDSA 1UH5A 2JEOA 2GN0A 2RIPA 4GKJB 1E0JA 3AERA 2K6GA 5LZ5A 4V3BA 2PSSA 1G8KA 2WFLB 2QRMA 3G85A 4E11A 4CUZA 3H1AA 3UUFA 1BU8A 1N1MA 2JH3A 1D0VA 4HO1X 1Q92A 3BPSA 3A37A 3DKPA 3K7EA 1NDQA 2PX0A 1ITZA 5BQOA 1D4OA 2I4OA 4Y1GA 1B4DA 1GNRA 3JVEA 4Q7JB 3V33A 3U1TA 1R9GA 3GP8A 1NSYA 5C8ZA 2JLRA 4MWEA 4YRTA 2PEZA 3ORYA 2C03A 3KKMA 4LOIA 4WZBB 2DBZA 4N0MA 5EZYB 1DQNA 3UKJA 4XVCA 2O06A 3JD0A 1EEHA 4RS3A 4KK3A 5ARBA 4D9GA 2O8FB 1Z0JA 2EW2A 2WP0A 3W8DA 4LZZA 1E9CA 2FSVC 1LPSA 2C95A 4LHYA 1JR2A 4CETA 4BQFA 2WHXA 1R9JA 3LG2A 3QOYA 4O4IB 1W8IA 3NGMA 3WDKA 1Q1NA 1OTXA 2B7BA 4W99A 4DFDA 2ZITA 2ZJ4A 2JK0A 3UG6A 1HKHA 1CP2A 3H5NA 1N0VC 3ICQB 2XMBA 2E0IA 1PV1A 1K66A 2KB0A 1PFWA 2R6DA 2FW8A 2WOOA 3GNSA 1DIRA 4L0MA 1NY6A 2V7TA 2BE9A 4BHTA 4RLSA 4JV5B 4EFNA 1UWCA 4FDLA 1MH9A 2O6LA 1V2GA 2H0QA 5IW8A 4K6CA 4GSLA 3GIWA 3ER8A 1WCV1 2IW1A 1E92A 1XAGA 3Q7PA 4PFSA 4QOHA 5IXSA 2XVXA 1R0LA 1E94E 5HCIA 3RU7A 3S6JA 2IRWA 2ZXFA 4H27A 2V97A 3OLZA 2AOVA 2KLBA 1XTVA 2OK8A 4KX5A 2IL1A 4YJ2F 4LFAB 2JAUA 3PSHA 4KBYA 2ZTSA 1QIEA 4ENPA 1DCKA 2WV9A 3G5TA 1DQSA 3ZK7A 4BN4A 5IDQA 2CSUA 1BMQA 4WGGA 5DSTA 4RM2A 2PKQO 4DM7A 4FEGA 3M4XA 3WK9A 4KV7A 1KZ7B 3S28A 1QTRA 1XROA 4RXTA 3JV7A 1Y4ZA 4HSEA 3TW8B 3E48A 2XDQA 4N5MA 2O7VA 2COUA 2ZRJA 4KO4S 3MFYA 1LS6A 3EXEB 3KB1A 2BR4A 8OHMA 1T2UA 3ZCRA 3PC8A 1FP2A 4IS3A 4P4NA 1G4UR 4F97A 3U1VA 2R8EA 4MX8A 1W88A 2QMOA 2VLIA 3WNDA 3EGVA 2B36A 1D4ZA 5H9WA 4BTEA 3VUEA 3LGXA 1Z0SA 2JKVA 2X42A 2Y0PA 5DU2A 4BX9A 3GRPA 2BM8A 4Q66C 3UYLA 2WQ6A 3O8CA 3OICA 3B1FA 2AFHB 5EMKA 3KUXA 5CB6A 3CUTA 5HQ3A 4UDOA 1KFKB 3SI7A 4YQYA 4OPMA 3MJTA 3NNSA 5JO0A 2ADOA 4B4VA 1M7GA 4K9KA 2HV8A 2JLXA 4AB1A 3C39A 4BJ3A 4D6XA 4O2AA 2BKAA 5FHQA 4R1LA 1G5FA 5DULA 4PLCA 4S1NA 2F8MA 1XEWX 4XCXA 2GK4A 3IR7A 2G0NA 3THOA 3ZWXA 1OQAA 1VFNA 1R6DA 3KB2A 3ME5A 4YUAA 1ZCFA 2R7KA 1C0LA 4HMOA 1IDN1 4GXNA 4P82A 2IV3A 1YS7A 4FSHA 5K4AA 3SY8A 1WZ2A 1MABB 4UM8B 3FVWA 5J1TB 2G9ZA 4AQDA 5HE8A 1I7PA 3RBVA 4EG4A 3IL2A 3OETA 3AUJB 2XBMA 1Y3BE 3JYNA 2YV4A 1PR4A 1USUA 1L5RA 1N8NA 3SP1A 3IIJA 4P7JA 4EPTA 4DUGD 3NH9A 1M7HA 2A33A 2ZSIA 5E2IA 1LVHA 3SXPA 5HFAA 1AB5A 2A9FA 4I3FA 3O8BA 1OJLA 2NTEA 3GT3A 1DEKA 4TLLB 2IYNA 1KPHA 3HB1A 4I5IA 1K8ZB 4GMKA 4M21A 4BAGA 3A10A 1CV2A 1R0RE 3DKKA 3HCPA 1ZH0A 4YT8A 3SLRA 5CLJA 3KJXA 4M1EA 2AC2A 3WGUA 3D43A 4TRRA 4Q12A 6GPBA 4OQEA 2ZQYA 3KR0A 4WKBA 3T5BA 2DUWA 3Q1KA 3R9XB 1ZK1A 4N6NA 4CKZA 2B3DA 1ADJA 2FLKA 2ZJ6A 4RTLA 3BB1A 4C4YA 3WHPA 5EUQB 4LMRA 4FCVA 3W5BA 1FVFA 3MF4A 1CNMA 4O4LB 2V7XA 3DW3X 5JSHA 5CGZA 3I6QA 5BR7A 3P2EA 3GLFE 2NOAA 2EV9A 3CKMA 3MMZA 2A1UB 1F0YA 2O2GA 4UQLA 3TNLA 4D97A 5JUWA 2WUDA 4CEIB 2QA5A 3S27A 4KIFA 2EOAA 4BWVA 5BV1A 1L5NA 5EJ6A 3BT7A 4B85A 4TKUB 2R6GA 4DM4A 1NVAA 1OBHA 3RAEC 1EBBA 1U8UA 2W93A 2GZMA 3LW8A 3NWPA 4L9SA 4N3NA 1NSFA 3V55A 1C0KA 2GRUA 2IGTA 1OSNA 3PFKA 3T52A 4QEKA 2FPUA 1G8AA 3PLNA 3L8DA 1FMLA 1PD0A 1M6NA 3CPJB 1WOYA 1YC5A 4FWIB 4PLFA 5EVCA 2IV7A 2UYCA 1ONBA 4JFAA 3I2YX 4LBYA 1ZVJA 5AUPB 4G8JA 2BI4A 1YHZA 3FGPA 3WGKA 1T8YA 3WLEA 3GFBA 4IHJF 5FT9A 3HSKA 1ZU4A 1PGJA 4IJVA 2XNCA 2BKLA 3FVTA 621PA 2FVXA 4KTVE 3KUUA 1TECE 1RAGA 3MAAC 4MYDA 3WFIA 1L3IA 3C97A 1COZA 1PK9A 1WXGA 3EUWA 4Q9IA 2NUAB 5LKRA 1QRSA 4RTQA 1FFXB 1XHLA 4W9NC 3IYLW 1G8FA 2PXXA 3OZBA 5LBTA 4DT1B 1UK9A 4BGDA 4D9MA 1G1MA 4LJRA 4HNAA 2YS6A 2B99A 1FFHA 3C48A 1I80A 1A0OA 1NHWA 4AJIA 4PZ0A 5IARA 3DBLB 1MIHA 2GQ0A 2KWIA 3FI9A 4EIWA 3JALB 2XQKA 3RE1A 4BNNA 1ZXBA 2QN9A 3DR3A 2JI8A 2IIBA 3WB9A 2XDAA 1U6JA 1KY2A 3OMWA 5GVSA 1EQ2A 2NU7B 4L15A 3GJ4A 1N5IA 3V3KA 2P62A 4NYIQ 3TECE 1QPZA 3GCXA 4QU5A 4Z99A 3ZU6A 4X66B 1ICIA 2FX2A 1GT91 2UV8A 1E3EA 4RFSB 3WYEA 4N47A 3T1YB 1UPBA 2FXIA 2XJ4A 4MQEB 3UJ7A 5EE1A 1QUFA 1P7ZA 4JZYA 4QYTA 3T7KA 2WJ3A 2JJYA 3IMFA 4C3ZA 2OQIA 2NTVA 4L4RA 1G4HA 3MRSA 4IKEA 4NULA 3ZLVA 3C15C 2DYKA 3R7DA 3FOZA 5BVGB 2YQ5A 1Y5IA 4KQKA 2NU8B 1JLRA 1BQ4A 4U0KA 3DEIA 4EBBA 1MQ8B 5H7XA 3ZJUA 3A2LA 1GNPA 4B3FX 1D1SA 1GQQA 2NZWA 3N74A 3NALA 4MVYA 4BIIA 3K5HA 2EZTA 3LW7A 3TTYA 5BQPA 2FXVA 2C31A 2GBLA 3EW7A 4HUQA 4G2NA 1MEEA 3F5SA 2XCTB 3IAS1 3HBMA 2O8EB 1BXGA 2Q6VA 4ACAA 2O2SA 2NUBA 4M0KA 3N53A 4AS2A 3L7DA 2C7GA 1QIJA 1XRSB 1JVNA 4R1UA 4F3NA 1A2QA 2M32A 1PYOA 5C80A 2X8JB 5BO5A 1M2VB 4HQ0A 5EXPA 5I4KA 1CQZA 4RULA 3SC6A 1N36B 2J5XA 1RYZA 3KVRA 5ERYA 5EXDA 4UBMA 4ZOQI 5KQPA 1SA0B 1L7DA 4HEJA 1CLUA 3G0BA 3UJHA 1UQUA 4AQYB 4G01B 3TBKA 3B85A 3HGMA 3HNRA 1QIGA 7ABPA 1ZAKA 2GRAA 3RUAA 1NYRA 1XJ5A 3FSJX 2F8LA 3O92A 3O82A 4MWOA 3ZE9A 3DBOB 5FF9A 3EXG2 1ODTC 2HT6A 3L6DA 4KSBA 1RAEA 1ZD5A 2G4CA 2VK1A 1X9GA 4KOAA 2BZ0A 3HBAA 1DAPA 2IYUA 3QNMA 4IXMA 4Q3KA 4NPCA 5DZSA 3W3ZB 3U7HB 2Y1EA 1JFTA 4TYYA 2XCOA 1VECA 3CZ5A 2MSNA 4WT7A 2CYBA 1X7GA 3MCVA 1RLUA 4GGOA 4IOMA 4XLLA 3C5WP 2VHVA 3TRDA 1BO6A 5B55A 1GUAA 3T0FA 2FSVA 3DKRA 3VM6A 3ZXYA 4CUKA 4AZ3B 1KMHB 3VPXA 1EWKA 4BQQA 3KELA 1JPVA 3H83A 1DKLA 4RV4A 1CLEA 3S1AA 4UFPA 2N3ZA 5J4HA 3W5DA 4BVAA 5LQUA 5KYXB 5H70A 2JRCA 3KTAB 2FG5A 2W5UA 4EHFA 4C88A 4WK2B 3ZI7A 4ZK6A 1AKMA 1SK9A 2R8BA 4KQ1A 3HCFA 1VL0A 1MKYA 1VXOA 3LIIA 3LUPA 1DT5A 1XELA 1GFSA 4EB3A 2CJPA 4X93A 4AJ1A 3FAZA 4OHPA 1B00A 2ABWA 1RJWA 1MAUA 3FY4A 3S5UA 2GBPA 4F72A 2CMFA 2RH9B 2GEUA 5T4EA 1PJAA 3P20A 2WM2A 1NM5A 2IV2X 2G72A 4DYHA 3HXOA 2WHRA 3FWNA 4ZQHA 4JHXA 2F2TA 1X77A 4F7DA 2JANA 4ZYXA 3C14C 3KPYA 1AUPA 1KYXA 1RWQA 1LXCA 6AT1A 3AG6A 1OROA 4OYYA 5GAJA 5B53A 4WL0A 3LU1A 4TRMA 1TO2E 1IZ7A 2Y1XA 5AHKA 2CHFA 3JCZA 4WOCA 1UJ4A 4QWWA 2APJA 4RC9A 2UYYA 4HYQA 5C0OE 2O0LA 4JD5A 5TQ2A 4YUZA 2WHEA 1SKUA 3MT0A 4ZVMA 1QG6A 4F2DA 3JS5A 3BGDA 2CW5A 4NMXB 2PYDA 3W34A 1TEVA 1T4DA 2OMKA 4F9GA 2Q1WA 2QOEA 2R8XA 3O91A 5KTTA 4YAOA 4RTKA 2FR1A 4A03A 2ZGVA 5CRIA 1FMFA 5TR9A 4HH3C 3GJ3A 1VGVA 4PZYA 3IKMB 2R1TA 4OI1A 5JTUA 1YRAA 3IEIA 4BEWA 2HHLA 3JVUA 4FB5A 5KS2A 1XMOB 1GPAA 3NTRA 3F2VA 1ECBA 1M2GA 1O3YA 1NWCA 2XRYA 3INYA 3NVKI 3DAOA 3WLAA 4K0KB 5LYJA 4QGFA 3MCTA 5AK0A 5LKAA 1SBNE 2WG0A 4CU2A 5C8XA 3H9JA 1FJXA 2H1FA 4K6FA 3TDNA 1JHDA 1IG0A 5FL7D 4Y6SA 2A35A 5B4UA 3PG5A 3PUVA 4Y7DA 3H2IA 3OIVA 3AQ4A 1Z4JA 4F9FA 1SXJA 5CR9A 2B37A 2A58A 2EKPA 3TNYA 3LQFA 5BVHA 1EFDN 3DQPA 3ORRA 1NJ2A 4LVCA 4D9FA 2ZS9A 2HA2A 1E79A 2ILVA 3THRA 1HFJA 1XGKA 3W9UA 4BKRA 3MERA 3EAGA 5D3ZA 3SNHA 2OYCA 5DW3A 4FR2A 1AT1A 2YMMA 1H4VB 1Y4SA 2CHQA 1VLQA 4I1IA 5IYZA 1I6LA 1JXAA 3GJSA 3N0XA 4EEXA 3B3QA 2J9GA 3QKWA 1JFSA 4C0QC 1ZH4A 1T2FA 1DKUA 2V55B 3K6KA 2JD2A 3A9VA 4XYMA 4W5HA 5FNVA 3AVWA 4EUEA 2AN5A 1KI4A 1XZDA 3HB0A 2Y1FA 3NP9A 3I6IA 3KJQA 3WRYA 4EHJA 1VJRA 5BUCA 3CVUA 3HXPA 4MWTA 2BBWA 2RSLA 4F8YA 1EGMB 1EFPA 4ID9A 2ZSFA 2IYEA 4PPYA 2JLCA 1AO3A 1CRQA 3HLYA 2FRVA 3AF1A 4IO1A 4MS4B 4U9IS 4X45A 3TKAA 3ZWPA 2X58A 1KPIA 2O8VA 4OIMA 4URWR 4F5WA 1DIHA 5JH7B 1N2IA 5C3UA 4J4TA 2DSTA 4YJ3B 1ID8A 3PS9A 1T9GR 3DO8A 4IV0A 3UK7A 3T1TA 4D6YA 1QB8A 2FEKA 4DF3A 4IGEA 4DZRA 4KNYA 2ZTLA 3RHFA 2VNHA 1HY3A 4LSWA 1HEIA 1XOIA 2BZGA 1L9XA 1JZTA 4QFDA 1UOPA 5JE8A 4PWYA 3EZYA 1G66A 5C31A 1PLJA 5IABA 1FYWA 3JQAA 2Y0EA 1EK5A 3GCDA 5DHAA 1KRHA 4U7HA 1DJMA 2V9ZA 5AKGA 1CEEA 1JR6A 3DL2A 5FWXA 1T24A 1A8HA 4Q1BA 3IFSA 4HCJA 2GA9A 1DRVA 4QU0A 2NW6A 1T9GS 5KNBH 1TI7A 3KE8A 3VU8A 4JGBA 3GGJA 2B5VA 3IVCA 4LHSA 2BBTA 3V8EA 2PFKA 3FHOA 5EJ5A 3ETCA 2OO5C 2WQZA 3DZBA 3ITKA 5AQEA 3QKSA 2AFIA 3M5PA 4JQZA 5FPHA 1GNLA 3IBSA 3BD7A 3NC1C 3DFFA 5EJAA 3ND9A 1X1RA 1SUDA 4YIKA 4C14A 2KJQA 2P3QA 1VM6A 4G9GA 1HZJA 1LBIA 3QLJA 2HA0A 2P9ZA 3BMOB 4KIWA 3KBOA 5A5DA 4Z4HA 1QDUA 3UAGA 1FS5A 3GDGA 1QAMA 4US1R 5FL7A 1IN4A 4E0BA 2FG7C 3M6XA 4UJ3A 5U1PA 5JQGF 1CNFA 2DQSA 1PT6A 5F9HA 2Z2XA 3EXG1 5CNIA 4TLEA 2ZT8A 1F8XA 4KXWA 3B1WA 4HXYA 4QDOA 1V6AA 4MCJA 4R3NA 2OG1A 2ODPA 3W2FA 4DRYA 3I8SA 4D0NA 4CM6A 4MUKA 5ALUA 1EVKA 4J3NA 3AG5A 3F9RA 3K16A 4PVDA 4S0ZA 2I1VB 3R40A 1NXSA 3HL0A 3FTQA 2O8NA 2QNIA 4PHGA 2FE4A 5KHAA 1JL3A 1OKKD 3VHXA 3RAFC 4HWOA 2UUAB 3KP1A 4LZOA 4JUAA 5I7WA 2VKQA 4IIJA 3PI6A 1CQIA 4MMXB 3R8FA 1Z13A 2FPIB 3CNQS 4JIMA 4XQCA 1BX3A 2REOA 4ER7A 1AKVA 1QSGA 2IX3A 2P9EA 3DB2A 4US2R 3R3HA 1HPLA 4WN9A 4BQEA 1ISRA 1RW4A 4NCAA 1KQOA 1JA0A 1JR3E</