4A8JA

Crystal structure of the elongator subcomplex elp456
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
277
Chain Sequence
GLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRIRNGDTHVIVLSLNQMFAKELPGIYYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPFNQEMTEFLERVYKSQPGKIQHGLVHILKLPVFTDRGEMRVLKSEWAFKNGRKKFEIEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATOR COMPLEX PROTEIN 4
publication title The Elongator Subcomplex Elp456 is a Hexameric Reca-Like ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 84
structure length 277
sequence length 350
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a8jA00
4OQXA 2G0NA 3I4LA 1Z29A 3GEHA 4POAA 3CZPA 5KNDA 5H68A 1JR3A 5CITA 2P5TB 2PH1A 3AVPA 3NDBB 1TUEA 3CX8A 3QXSA 3EPKA 4KJZA 4OQLA 4Q4HA 1I2MA 1N5LA 3OFND 5G40A 4C0JA 1CIPA 3IEUA 4EUNA 4Z51A 1SVIA 4BWYA 1WBBA 3AKDA 3QENA 1NBMD 2EVWX 4XWKA 1W0KA 4IEIA 1E9CA 4D4MA 1YZTA 5HZKA 4PAOA 2FV8A 4AC9A 1R5NA 3WBKA 2FA9A 1M7GA 3A8TA 1G3MA 3OIWA 3U4QB 2IF0A 2CLSA 1SVKA 5E7MA 1IXSB 3MMPA 3CPHA 3W3ZB 2QRNA 3B9PA 3P1JA 3PIRA 5DN6D 2WJIA 4HUQB 2GDJA 1JB1A 4HZIA 3RS2A 3C41J 2AN9A 1LFDB 4IJMA 4JVLA 1HH4A 3HDTA 4NZYA 4QRHA 1XDBA 1GL6A 3AV0B 4LRWA 4FCVA 2R6CA 2X8AA 3ZIAA 2WJHA 1OT3A 2H92A 2QAGA 3PENA 3PUVA 4A8JB 2QAGB 1M2OB 4PZYA 1BKDR 5IRCD 3SFZA 1IM2A 4BFTA 1SZPA 8OHMA 5SZHB 3EG5A 3UIEA 1E2QA 2ZJZA 3AVXA 4LHWA 4P4TA 1W48A 4TLEA 2BM1A 5DO9A 1E2HA 2ZVPX 1N6OA 4Q9HA 4PXAA 1P2SA 4CYMA 1FQKA 1Y63A 3U6KA 2QE7D 4QGFA 5AJVB 2PJZA 1Z6AA 1ONBA 3OF5A 1OB2A 1KIMA 1FQJA 1EG7A 2EFCB 2AKAB 2L0XA 2WJJA 2JJ8A 3UATA 4URUR 1O3YA 1US8A 3B78A 3W9YA 2CEAA 1HE1C 1YZNA 1IAQA 3GLHB 1G19A 4EDHA 2YJTD 4DXAA 1MV5A 2PT5A 4TWZA 5FI0B 4AK9A 1ZM3A 4BEJA 1VCNA 2C9CA 1LS6A 2B8TA 5D3MA 2CLDX 3ZVLA 3IIMA 1ZC4A 2BJWA 2W6ID 5IK2D 3T1TA 1XXHB 4OI2A 1KDTA 3TW4A 3CF0A 1W36B 4M53A 2O8DA 4LHVA 1P3JA 3DM9B 5J40A 3QKSB 2LCFA 1JEDA 3NBXX 4BFYA 1BH2A 1WB9A 4HDCA 3QEJA 4Q01A 1G1MA 1GILA 2V6IA 2PZEA 1GNPA 3U7HB 4LJ9A 1QHHB 1R8SA 2V9PA 3R9XA 4OQMA 1CR1A 3CPJB 1Z28A 3EARA 1G7CA 5DH9A 5GJVC 3T1VA 3A1VA 1E96A 3NC1C 4HB3A 2DHRA 4B2PA 3TR0A 4B43A 4TZ6A 3IO3A 3MAAC 4AG5A 4TYPA 4TYWA 1XNJA 1DPFA 2XJ4A 3PEUA 4BASA 1LV7A 3CX7A 1RFLA 1T8UA 3KKOA 1G291 4L9WA 4C0LA 2YC4C 1UKVY 1YR9A 3O8CA 1JBKA 3JZMA 4JLVA 3RABA 2VL7A 4GFDA 1Z0JA 4XVRA 1EFTA 1FP7A 4IHQA 1F2UB 2EFHB 2PL3A 2ZROA 1XEXB 5EXXA 4Q18A 4PC1A 4BZPA 5FTKA 1Q1QA 5FBQB 2GF9A 4US0R 2AD1A 1IN7A 3DDCA 4RZUA 4YC7A 1OV4A 4R7ZA 2WICA 2V8OA 1W47A 2N1BA 1VCIA 1KMHB 2OEPA 2RGGA 3VNUA 2WTUA 2IHBA 3AUXA 2W00A 3LBIA 1ZUIA 2G88A 4O3MA 2C99A 3BE4A 3EIHA 3CRRA 1E9AA 4M1MA 4HLQB 3T12A 1E2JA 1W7AA 2G1KA 3SJAA 1EFRD 4YMWA 1ETUA 2YKGA 4PPFA 2ZU0C 1W36D 2NTYC 4HAZA 4IDHA 4KHZA 2FFBA 3JVVA 5EXPA 5EXTA 2OILA 2JLSA 4M1TA 3PV0A 2GF0A 2HYDA 1OH5A 4PC3A 1BYUA 1CP2A 1JJVA 2WVJA 2IA5A 4US1R 4MKGA 3GPLA 1NIJA 2Z4SA 3GLGB 2WKPA 2I1VB 2ZAMA 4WZBE 4JSYA 3TMKA 3K0FB 4FWIB 1NVXQ 3C16C 4EQ6B 1CJKC 1I2DA 4KCGA 1IN8A 4OI1A 1AQYA 2ZITA 3LVRE 1FX0A 1W49A 1Z07A 3O8BA 4TQ9A 5GJCA 1RC8A 1TF2A 3RNLA 1A82A 4B3BA 1MABA 4GOXA 4KBFA 3SHWA 1IJEA 1ZM9A 5CK4A 1JQJC 1Z5ZA 1HEIA 3CRMA 2NZ8A 3CWQA 5EUQB 3SFVA 2Z4RA 2QMHA 4OHZA 4TMWA 4LBYA 3I62A 4RKFA 1CXZA 4XTCS 3SE0A 1R6BX 1Z0IA 3VX3A 1KI3A 2WWWA 4NMMA 1W0JA 2R6AA 3C7KA 2P67A 4NYMQ 4MKFA 3LQQA 1HT2E 4TLAA 2ZSEA 4YLGA 2OHFA 1AK2A 4NKRA 1WDTA 2ZUDA 1GNQA 4AYWA 1DAHA 4RKEA 2W0SA 4QKQA 5KNBA 2RGAA 5D3QA 4B76A 4HB0A 2WAYA 1S1MA 2W83A 1TADA 4B33A 1UBFA 2FPKA 4KFSA 1PUIA 1VKJA 5B58C 4AKIA 2HT1A 4LPSA 3MUFA 1E9BA 4OHVA 3GLIB 1P72A 2D74A 2FSIA 4TSFA 2QRZA 5HKKD 4URVR 1GVNB 3BXZA 3ZD7A 5TDHA 3TJZA 3ZGXA 1Z63A 3P27A 2A30A 4G5RA 2GZDA 5A0FA 1VECA 4Q47A 3AF0A 5CK5A 2GKSA 4ASUD 3B1ZA 1VYVA 2G0TA 1EFCA 2DWPA 5J4VA 5EZ6B 1E6CA 2O8FA 4A6XA 1M7HA 1XCMA 4IVQA 4JYBA 3U6BA 2O8FB 2ODBA 2CLCX 4PZLA 3U44A 2IBMA 3KZ1E 2QROA 3BFKA 1KY2A 2W6JA 5G3YA 3OZXA 2NO0A 1EXMA 1M34E 3NBZC 3LLMA 4MQBA 2GCOA 1TMKA 1WF3A 2VTKA 4PHGA 1WBDA 5F9FA 2RGCA 1XEWY 4LHYA 1DE0A 4P33A 2ATVA 4P4SB 5FOVA 3HJNA 3QBVA 4X8LA 4GDFA 3K0CA 3I8SA 3FVQA 1JXOA 2UZ3A 2RKOA 4ILEA 2IYLD 4RY2A 1GRNA 4OBEA 5BN4A 4FMBB 4MRPA 1TPZA 4DSNA 4TMZA 1CRPA 3RRNA 3EZFA 4A0FA 2VA8A 2J7PA 3QOFA 4NCKA 2HCJB 5JEEA 4US2R 4TMVA 4DSUA 4I81A 2ZYWX 1U98A 2HT6A 4U02A 1Q1BA 4XOIA 3RS3A 721PA 2NGRA 1KYIA 1R5OA 1BOFA 1KSHA 5EP2A 4TSFD 4HLUC 2YOFA 1Z0AA 3GP8A 2I3BA 4DKXA 1II8B 2FGJA 4BZXA 2VP0A 5AUPB 4DLVA 2ZRGA 2GA8A 2WIAA 4M9QA 1KI6A 1R0WA 1OFIA 1RRPA 3ZQJA 4R71A 1UM8A 4ZPXA 4PO1A 2FZLA 2OFXA 1G6HA 4ZDKA 4JLOA 1SVWA 2OBMA 4IXMA 1EWRA 2FSGA 2ZSFA 3HU2A 3L0IB 2FJUA 2C9OA 1SKQA 2VO1A 4DCTA 1NRJB 3TVTA 4DCVA 4NP6A 4RZ3A 1ZYUA 4TL7A 1L7VC 1KI7A 1M6NA 2OESA 2ZE8A 3SNHA 4RD2A 1YHNA 3EW9A 4M4SA 3GEEA 2AX4A 2OE2A 1D2EA 2BIFA 3PUZA 3TQCA 3ZS8A 4MUBA 3ZVNA 3GJ3A 4GI7A 4A0HA 1FX0B 2TMKA 3LD9A 3DKVA 4LV8B 1F6BA 3IBYA 3JVUA 2BBWA 4CW7A 5JCZA 3Q7QA 3KTAB 4GPTA 2A5FA 1KO4A 2ZRMA 2XTZA 2OUKA 3B13B 2BBOA 4OKSA 4TZ0A 1Q22A 1E9SA 3KB1A 4B44A 4QGHA 2C03A 5C18A 5EE0A 1VCMA 1II8A 3Q5EA 2ECKA 3TSZA 2ZEJA 1VDZA 1PV4A 3DOEA 4F4JA 3FMPB 4PHHA 1OPXA 2BMJA 2P2LA 4TTPA 2C04A 3VAAA 1R10A 2XNDD 2W6JD 3QPVA 3QSYA 4GOJA 2ZYUX 5FUVA 4DSOA 4DDUA 1DADA 4C2TA 1A7JA 1D9ZA 3K0CC 5FPTA 2YYZA 1TQ2A 3IO5A 2YV5A 1EX6A 2ZI4A 1QBKC 4QJ3A 4YMTA 2IYVA 4NYIR 1ZNXA 4UNPA 1N0VC 1CJUC 2NPIA 2WIBA 4Q4LA 4V0NA 4Z1MA 3VR3A 4EFNA 4JIMA 4L16A 1S96A 3BH0A 3I3SR 1KHTA 4MA4A 1Q0UA 3TIFA 3QKTA 121PA 1KDPA 1KO8A 4LJ4A 4G5GA 1JEEA 1NG1A 2WHXA 3HPRA 3DZ8A 5CIWA 3WMGA 1QVRA 1KKLA 1YU9A 2E9SA 5FTNA 2JLVA 2VHCA 3AB3A 2A5GA 1E2MA 2IS1A 4ZDIA 4NCHA 4R2IA 4MKIA 1GTVA 1TU4A 3DKPA 3U7GA 1ELOA 4PQRA 1M8PA 4ACAA 2WOJA 1FTSA 1MOZA 4FCTA 1PVOA 4W5HA 1II9A 5J5CA 2CVHA 3HPQA 4DUGD 4CEHA 2F43B 2D4HA 1HYQA 2XXAA 1XXHA 2QPAA 3RRMA 1EK0A 3E1SA 3N70A 4MRVA 5LB2A 4URYR 4DIEA 4JLNA 3RC8A 1W4RA 4DB2A 1G6OA 3KXLA 1G3IA 2WJGA 3QKSA 2YC2C 2ZI9A 1YR7A 2MSCB 1G3RA 2GILA 4AURA 4BFUA 4BECA 1DG3A 5KDDA 3GLHE 1JI0A 3KKQA 1YR6A 4JLDA 3PITA 3EIQA 4WOPA 2QAJA 4RFSB 2AWOA 4ZV4A 3GFTA 2ORVA 3FKSA 4ARZB 1OH6A 3QNUA 3C5CA 2FH5B 1W5SA 2GAAA 4JSTA 2ZS8A 2BDTA 3RS7A 4CZ2A 4NYIQ 4KAXA 1IXRC 2ZRFA 1NN3A 2C78A 4PSKA 2OCPA 5AUNB 1E79D 4RD6A 1XB2A 3RHFA 3AVWA 1H8ED 1HTWA 1N0WA 1S3GA 2REXB 3OFNA 4L15A 1XMJA 2OCYC 3KFVA 1QHIA 3O8RA 1OSNA 1ZIOA 1ZM4A 4S35A 3Q8XB 2X2EA 4BLPA 3TK1A 4BEBA 1VCOA 2IYQA 4ZKDA 2AXPA 4M0LA 4QHSA 1U0JA 4XD7D 3LV8A 2IYUA 2OAP1 4N0DA 2OXCA 3V00A 2DR3A 3GD7A 4EPWA 5BQ5A 1Q21A 2D06A 4QJ4A 3GQBA 3RS5A 1W0JD 3MSXA 4GP6A 1AGPA 5G53C 3W8RA 3K1JA 1B23P 3HWSA 3TSOA 3K53A 4EKDA 3KKNA 3EA0A 2JASA 3B5JA 4IOJA 4ZIRA 1JXMA 3QXXA 3W34A 2QPOA 3GEIA 1NMZA 1IHUA 3BBPA 2V3CC 2F9MA 2HCBA 1U8ZA 2GCNA 3BRWD 3X1DA 4AKGA 1XU4A 2PX3A 4LX0A 5AJWA 5FH9A 3VU9A 1XMIA 1ZNWA 4NDZA 1W4AA 1ZU5A 4C3ZA 4QGGA 1I4TD 1KNXA 2DFLA 1SXJD 1W2HA 4CEHB 4M1OA 3NHAA 4HUQA 4NHOA 3ZZTA 4B3DA 3U60B 3L43A 1GRQA 2J45A 1E99A 4I1SA 1E2IA 4B6EA 4HZUB 2B92A 5HZHA 5LD2B 3THYB 2RMKA 3AF1A 2ZR9A 3FGNA 1OH8A 4IDOA 2NG1A 3K70B 2ZR0A 1U8YA 1W4CA 2BEJA 3V9PA 1OB5A 1AS3A 3EPHA 3U3JA 3AVOA 2CHVA 4DVGA 2ORWA 3A1SA 3EZ2A 2ORIA 4IEEA 4IOKA 3E70C 3B1WA 5EZ5A 1W46A 2N42A 3PUWA 3VKHA 2OFOA 3FMIA 2XX3A 3I5YA 4LJ8A 4QG7A 1XPUA 4HUTA 1X1SA 2OZEA 2ZJ8A 3G82C 1NMYA 2VSXA 2H57A 2QT1A 5DYIA 3PR1A 1OLOA 2QORA 3VR1A 1DELA 4D80A 2O8EA 4TLBA 1AN0A 3IIKA 3PG5A 4MYTA 5B2ZA 4L5BA 3SS8A 1YZKA 2O52A 2RGNC 3CX6A 2QMEA 1L4UA 5KSOA 2GETA 3THXB 2IS6A 2J0SA 1FPMA 4B6FA 2BEKA 4FMDB 4Q7JB 4YDHB 4DRZA 1UAAA 5GVSA 4QNRA 4TN1A 4Q9IA 3AVYA 3LVQE 4FCWA 1U9IC 2QTFA 2JLQA 3Q72A 3SC3A 4YQFA 2CK3A 3EIEA 1KI9A 2CL0X 1DAIA 2O8DB 1GITA 3BH7A 2GESA 4JLJA 5KPDA 4B3CA 3CZQA 3FPAA 4Q21A 4JJKA 4IOMA 1YVDA 2VBCA 3NIBA 4LUCA 1KNQA 5UKDA 4PC7A 1P9WA 4F92B 5CM9C 1DS6A 2V54A 2GZHA 4B3FX 1A1VA 1C1YA 4EAQA 1LVGA 2VP9A 1II0A 4IKEA 1JJ7A 4MDFA 3VR6A 3CM0A 1X3SA 4G5SA 1CULC 1KZ7B 4LV5B 4OI4A 1AS2A 3D6TB 1T5LA 1G17A 1FW6A 1XD8A 5FR1A 1CJTC 2BVNA 2YVUA 3ICEA 3CO5A 4MITA 5AWFC 1RYFA 1KK2A 3K09C 1RPZA 1NL3A 1UBEA 3LW7A 1F60A 2QNRA 1GL7A 2WOOA 3THXA 3P4YA 5C46F 4PX9A 1MABB 1G7TA 4ESHA 3PFIA 3VR4A 3HR8A 2AFHE 3ND8A 4YMSA 2XNDA 1YRBA 1ESMA 1NBMA 1FNNA 3UMSA 3CRQA 4OI0A 3T1QA 4LJ7A 4MGIR 1JAHA 1ZMXA 3EZ7A 3UXMA 1JPNA 2JJ2D 2YOGA 3W5JA 1DAKA 3F5FA 4JL8A 3GJ7A 1QHXA 5AJZA 4Q48A 3RS4A 2GZAA 5ELXA 1OXSC 3CR8A 1MO3A 2J7KA 2ZUBA 3D3QA 4E5UA 3C8UA 2XZPA 4L8GA 1H8HD 1AKYA 4M21A 5DE3A 4BFVA 4LYHA 4A15A 4QHYA 3K09A 2PZGA 3SBDA 4GMDA 4BFXA 1RKBA 4CF7A 5B57C 4BLTA 4A4DA 3DPUA 2J7PD 3MG9A 4RVCA 3K0SA 5IK2A 2WMNB 3TGPA 1Z06A 5FBWB 3QVVA 4Q1EA 2NPFA 2KB0A 4S2EA 3PVSA 1KAGA 3EPLA 2PLRA 2Q3FA 2J0UA 2CVFA 1KI8A 1ZU4A 4AY2A 5JBQA 2JLRA 2O0JA 1UFQA 1GFIA 2WV9A 2ZI7A 5DHAA 4ESVA 4O2LA 4C9BA 2CNWA 1AA9A 1ZP6A 2WMOB 4II7A 2WJVA 3BIFA 2DFTA 3C15C 1N6RA 1QG4A 1LW7A 2Q0HA 1Z47A 2LKCA 2HLDD 1HT1E 1Z6XA 4IDPA 1XEFA 4ACBA 4IDQA 1ZNYA 1WRBA 5SZKB 3VQTA 5E3HA 1SKYE 2AXNA 3F3YA 5FOXA 1AJEA 4ASUA 1UEJA 4G1UC 4PPNA 3ZJYA 4C4PA 3SN6A 3KJEA 5JCPA 2FFQA 4RFVA 2B8WA 2B7BA 3ZQ6A 4AIIA 2Q9BA 1D2MA 1BYIA 1XMVA 4HEJA 4D0LB 1N5JA 2YNMA 1MRSA 4PTLA 3IIJA 3MWLA 3FHCB 3T5GA 3B85A 4TL8A 5JRZA 2RGXA 2GCPA 1VG1A 4C0SA 3UMFA 2F9LA 3HU1A 1LF0A 3T61A 5E95A 5AUOB 1EWQA 4F4IA 1ZCAA 1XXHE 1YJ5A 1GL9B 1T0JB 2G1JA 4D0NA 2WSMA 4M1KA 1TNDA 1P75A 2GJAA 2F7SA 4HDQB 3H0KA 3UKDA 3Q5DA 1A4RA 2QU8A 3ZYCA 2ZI6A 1V43A 3GJ6A 5DNYB 4HB4A 3BAFA 3LBHA 2PMDA 1J8MF 2OO7A 4EJSC 4XVUA 1QG2A 1FTNA 1N5IA 2IUTA 3BS4A 3ADDA 1BS1A 2VF8A 1N6PA 2ZAOA 2B6HA 5JWHA 3AH8A 3ONWA 5DI9A 1C4OA 3FKSD 1DAGA 2KSQA 4TQUS 2GJKA 4DB4A 4FMDF 1G16A 2F3TA 2QM8A 4XSHA 4O2RA 1XP8A 4YXWA 2Q6TA 1XF9A 3I73A 2IUSA 4NL4H 1M1YE 1NIPA 2IYXA 4OHYA 2OT3B 3FMFA 4I1OA 4RZ2A 2A5DA 621PA 2RGDA 1VTKA 2VLIA 2IWRA 3RS0A 3SYLA 3W6PA 4EPYA 3MJRA 3IQWA 4R98A 5FL7A 3AP3A 2ZRJA 4OJKA 1ZNZA 2CL6X 2V7QD 4C0QC 2HJVA 2AK3A 1KAOA 4JKIA 3VNVA 1E2EA 4PSAA 2QUZA 1YZLA 2ZRCA 4W5WA 4A9AA 1PUJA 1N6HA 3H84A 1X8LA 4XWAA 2ZM5A 4IVPA 2GJSA 1P9NA 3BOSA 3CRW1 1VMAA 3ICQB 2EW1A 2C5LA 5B30A 2GVDC 2JIZA 2ZJOA 1JALA 4DEYA 3G5UA 4LJAA 3T5DA 1SXJC 3WHKA 2K5UA 4Q19A 1KI1A 1Q1EA 2A2ZA 2OAQ1 4URXR 1Z6YA 4PC6A 3RSOA 1J2JA 1Z6GA 2R9VA 4BGDA 2Q3HA 4QOSA 4HAWA 2GXUA 4LJ6A 1CRQA 4UKDA 3DM5A 2GCOB 3W5IA 1W1WA 1S9HA 4YDSA 2XEXA 4PPQA 1E1QA 3BGWA 2HV8A 4QHTA 1G4UR 1KK3A 2FX3A 4F93B 2IL1A 5DISB 3SBEA 5HE8A 4B32A 4QJ5A 4Q4HB 4RD0A 2F3RA 3GJ4A 2ERXA 4NYMR 3R8CA 2ZS7A 3HP1A 2DY1A 1DBSA 1ZD9A 1G5TA 2ODEA 3AP1A 1MO5A 3Q7PA 4KYUA 4A8JA 5FOSA 3R9IA 2OLJA 2KE5A 1G7SA 4PO8A 2NO9A 4D6PA 4LBWA 2NZJA 4LZZA 1RRCA 3L8YA 5GJBA 3NKVA 2PJRA 1VYUA 3IGFA 4MGKR 2KJQA 3WYAA 4H1VA 5CB8A 1P2VA 3S1AB 5L3QA 4MYCA 1EFUA 2W6IA 3K0AA 3Q85A 3CH4B 3PUXA 5DI3B 3EAQA 4NCNA 2FPLA 2REOA 5KDLA 1G7RA 5HE9A 2B7CA 3RYTC 5B64A 3A37A 1E98A 2WPDD 2HXYA 1E1RA 2BWJA 5EJEA 4F4CA 3IPXA 1RYHA 2VHJA 1ZCBA 3WXMA 3IUYA 5J4LA 4GSYA 3EPJA 2EU8A 3TR5A 3TUZC 1L4YA 1MT0A 4PC2A 1QDEA 3K9HA 4UNRA 3CKLA 2JLWA 3B60A 4UNNA 1T91A 5JSZA 3LX5A 1EESA 4LDJA 4HYYA 2QG6A 1E1RD 1G9XA 3X1WA 1UPTA 1KSFX 2JGNA 4PQYA 4JVSB 5KSPA 2W58A 3AVVA 2C77A 3B9QA 2OV2A 2IWHA 5TXGA 1FL9A 3BFVA 3DEFA 1P2TA 2FNAA 3U7FB 2R65A 1A2BA 3KUDA 4OQNA 3BFXA 1ZJ6A 4M9XA 3X1XA 4BRUA 1NVWQ 2Z83A 2CJWB 2HEIA 4KLZA 3L0PA 1KJYA 4LCBA 3GLHA 1MH1A 2ZE7A 2FDCA 2R6GA 4EJSB 2F1RA 2I4IA 2FFAA 2G9NA 5P21A 2XB4A 4QBHA 4ZI3A 1NLYA 3CNLA 1VG0B 1MKYA 3FTQA 3B6EA 3SOPA 4TMKA 3TBKA 4P4SA 4TL9A 1FZQA 2ZE6A 3TKLA 2ONKA 2RGEA 2IEZA 1YE8A 4DDWA 1WXQA 4R2HA 3D7MA 3SYNA 3AEZA 3N2EA 4FINA 3OEHA 2GEDA 4WW0A 1UBCA 3H4MA 3M4YA 1IQPA 4CT5A 4GMXA 1XWIA 5DLQC 2QE7A 1G8YA 3U44B 1XJQA 2A9KA 1HURA 3ZZ0A 5SZJA 2HLDA 2KBEA 3A4MA 3QF7A 4A2QA 5M04A 4NYJR 4AD8A 4BFWA 4EFLA 2GXAA 2IYYA 2D7DA 5FOWA 2ZRIA 5H1YA 1ZD8A 1CBUA 2VPPA 3KL4A 3KXKA 4DT1B 2YWGA 2QTHA 5KSZA 1RZ3A 3H1TA 5G3ZA 3FMOB 3L0SA 4M9SA 1KDOA 3KQUA 3ASYA 1IN5A 2ANBA 5F98A 1ZBDA 1JNYA 2ZJ5A 1JAIA 4Q5IA 3BERA 1WA5A 2F43A 1GKYA 3NH9A 1T3LA 4BPBA 4QM7A 1O87A 2CCGA 1RJ9A 2BJVA 5LBIA 3WNBA 2XTMA 3LDAA 2G83A 4WVFA 4XJXA 1FUKA 3EXAA 4NYJQ 3FFAA 3LRPA 3SJBA 1EGAA 4I99A 3LA6A 5EE1A 5JHHB 3LY5A 3ZVMA 3UWKA 3U3KA 1E9DA 1Z08A 4UJ3A 1KI6B 1KY3A 4RFSA 1TEVA 4GP7A 4U00A 2A7QA 1COWD 1SHZA 2CNWD 4JYCA 5FBLB 3VR2A 1IY0A 2BMEA 4QFMA 2GHIA 3GJ0A 4G5QA 3FHTA 1TAGA 4WBSA 5E7JA 4DDTA 1BIFA 2DWOA 4JJZA 3I8XA 4B3XA 1OF1A 2QSZA 2XXAB 1NNEA 1OYWA 2PCLA 4YXWD 4M1YA 3A1TA 4OHWA 1M7BA 2OFWA 3B1XA 1Z0FA 2P6RA 3EWAA 2VEDA 3GLGA 4D82A 1E0KA 1NMXA 1J8YF 2GJ8A 1UKYA 4JT2A 4BLOA 4TT3D 5FPKA 5TV2A 2QL6A 2ZRPA 3AKEA 1E4YA 2RGNA 3PEVA 2DPXA 4OL0A 4E09A 4KFUA 5FPYA 2GVZC 3WNDA 3LWNA 1ANKA 1E4VA 4LJYA 5F3WB 2Q3MA 4LHZA 2Z5FA 4P32A 5L3VA 1H8EA 1CLUA 4CVNA 1NP6A 3GLIA 2RB4A 4QGAA 2IEYA 3B8HA 5J4HA 1NLZA 1S8FA 2V4ZA 4JBWA 4LOAA 4PSVA 3RRZA 4N1AA 4KSBA 1R7RA 3NDPA 1OIXA 2GJ9A 4BLQA 1KMQA 1OFTA 3OAAD 4DT1A 2XJ9A 3K70C 3KQKA 2E1RA 5ANRB 5FOUA 3ETLA 3L2OB 3WYFA 3ZVRA 4W5JA 3SQWA 2ZSAA 4A0RA 2C96A 1G3QA 4XTRA 3WRXC 4DLSA 2BOVA 2D7CA 3W8NA 2WZQA 1NVUQ 2ZREA 1L8QA 5FPSA 1TEXA 2F1HA 3K9GA 4KO8A 4X8OA 4Z54A 1XTJA 4RD3A 1R0YA 3QKRB 3CNNA 1SKYB 4KXFB 1KDRA 421PA 1E0JA 2AFIE 1KTVA 4CEJA 5FUXA 5HCNA 3CLVA 1R0ZA 2JEOA 2UZIR 2ZPTX 4B35A 2VF7A 3B1VA 2QZ4A 3D31A 2HF9A 5LDDC 1Q12A 3VTKA 2KWIA 4X8HA 1IXZA 5EQTA 2FU5C 3CH5A 1SXJE 1D2NA 1KSJA 1ZD1A 1OIVA 3CWZA 1G64A 2FEOA 4G0NA 4UQOA 5DSZA 5AR1A 5EP3A 3Q3JB 3TE6A 1P7CA 4XVQA 1N0UA 1GNRA 4B48A 3J81k 2IS2A 2AR7A 2QMUA 4EFMA 4DZZA 2QAGC 2X19A 521PA 3X2SA 1VHLA 3TRFA 1X6VA 2FZ4A 2W2XA 3ASZA 4BQSA 3DL0A 2EFDB 4LGMA 1CR4A 5JZVA 5FR2A 3UG7A 4UXIA 1S3SA 2YHSA 4CDGA 3R8FA 4DIDA 4O25A 3VHLB 2GXQA 2ZRDA 1Q57A 1ZW6A 3CF2A 3LX8A 3WMFA 3LW8A 3RLFA 3T1OA 3VHXA 3EC1A 2NO1A 1NN5A 3LXXA 4PHFA 1NN0A 3B82A 4M8NE 3A1UA 3UK6A 1XTKA 3B2EA 4KSCA 3U3OA 2YOHA 1VG9B 5JLJA 1KK1A 2AKYA 5IF9A 4C0HA 2W2VA 3KUCA 1XBTA 2ZVQX 1JPJA 4OK6A 3BB1A 3KQNA 4EJSA 2PEYA 1GIAA 1XD9A 2WSSA 1D5CA 4JS0A 4D0GA 5C4MA 5IHPA 3BC1A 4DSTA 1TF7A 3FB4A 1GZSA 2ZQ5A 1T8TA 1KOFA 2WAXA 2VIIA 4EPXA 4Q03A 1SULA 4GZLA 4B74A 3R7WB 3THWB 2DB3A 3LLUA 1L2TA 4ITRC 4LPKA 1G5RA 4JBXA 5EE5B 4TTRA 5AJXA 5DN6A 3VR5A 3THYA 2BMFA 3IHWA 2W0MA 3K9LA 5FBVB 1NJGA 1AQUA 2PCJA 3A4NA 2BMDA 3L0OA 2JLZA 4Q4AB 4C30A 2Y8EA 1TF5A 3OEEA 4ZCMA 1Q3TA 3CB4A 1X1RA 4YMUA 3LO5A 5L3SA 1KZGB 3AVQA 4WIAA 5J4YA 2Q21A 3QUSA 1F48A 1IOZA 1QHGA 2ZRLA 3AVTA 4NU0A 3GJ8A 2RAPA 4Z8YA 3KJGA 3MD0A 1NBME 2XOKA 2FEMA 3I92A 2IK8A 3OEED 4WXRA 2MMGA 2A5YB 1UKEA 1T6NA 1YRAA 3OHMA 4N0EA 2VH5R 5EUMA 3M0EA 4ZKEA 2ZRBA 3U2QA 1US8B 1E0SA 4JL6A 2ZANA 4QC2A 4DCUA 2JDIA 3MFYA 4AYXA 2WSSD 1DARA 1QZXA 4K8OA 1G3UA 1I4DD 3AVUA 3B1YA 3REFA 5HTKA 4DEXA 4FW9A 4NH0A 3SYKA 1G8FA 4KU4A 4OK5A 4TMTA 2MMCA 2UVQA 1NVVQ 4X8MA 5HCIA 5C4GB 2PLFA 3FE2A 1ZC3A 2FOLA 3QBTA 1KSGA 2JJ2A 2PMKA 1NSTA 4AI6A 1VIYA 1U90A 3NWJA 5J4KA 1Q20A 1G5PA 3C14C 3EASA 1W2GA 1WCV1 4DLZA 1U0LA 4KFTA 2ZJBA 2IYRA 4L9SA 1GUAA 4KITB 3CRVA 3HU3A 1ZVQA 3LQRA 5FTLA 1IJFA 3V4RA 1KK0A 4I1VA 2H16A 1UADA 2ZRKA 3A6PC 4DLTA 4ARZA 4JMPA 3SEAA 2RHMA 3SDZA 2PBRA 2QSYA 4A36A 3KQLA 3ZLJA 3VU9B 3NG1A 1D9XA 3P4XA 3K70D 3DO6A 1CEEA 1GDDA 4LHXA 1Z0KA 3KJHA 4Y0VA 2VRWA 5FOTA 1ZUNB 4IDNA 1AIPA 4M9ZA 5EP1A 1GKUB 1E2FA 4KBGA 1ESNA 4CEJB 2FMXA 5FFMA 5TY0A 1TQDA 3QVUA 1NY6A 4A2PA 3M1IA 5FBRB 5A5GA 4Q7KA 2ZR7A 2H5EA 3PCRB 4TT3A 1K8RA 1TX4B 2NQ2C 2RCNA 5IT5A 4JT4A 3O8DA 3DZDA 5K8LA 2P5SA 2EYQA 3QF4B 4DLRA 1LTQA 4HLDA 1VHTA 1JECA 1I4LD 1XD2A 4PPGA 4C0BA 3PJRA 2J0QA 4MDEA 3KJIA 3EX7C 3QXJA 3FKQA 1LNZA 1QRAA 1E2PA 1Z22A 2QM7A 2ZU6A 1D6JA 3U5ZB 2F1JA 1DOAA 1W4BA 2XSZD 2JATA 4B47A 1G8PA 2IT1A 1B0UA 4IVRA 5KSYA 1E94E 1U99A 2C8VA 1X8JA 2GAOA 3IEVA 4JKYA 4E07A 3W90A 2QP4A 2IF2A 2EFEB 1LS1A 2EYUA 2ZJAA 1LB1B 2O5VA 3IHLA 3KKMA 3QIAA 3R20A 3PUYA 4FD2A 1KO5A 2XOKD 4Q1AA 1KO7A 5F2EA 3UANA 1AM4D 2ZETA 4M2LA 2ZRNA 1NVVR 5L8VA 1E9RA 4FI3C 5HPYB 3A1WA 4P31A 3I5XA 1V5WA 2ATXA 1X86B 3R7WA 1GG2A 3THWA 3AQ4A 1GAJA 1NI3A 4LJ5A 3T34A 1J99A 1A2KC 1GWNA 5BW8A 1RE0A 4JLBA 5KOYA 1ZRHA 1OXXK 4RZXA 1JQLB 3AKYA 1SHKA 4OYHA 2PT7A 1T9HA 4Q1DA 5FPHA 4BZQA 4PQFA 4ZCIA 3WRYC 5LB4A 1JR3D 5JWRA 4HDOB 3VX4A 4FWTA 2X77A 5CIQA 2VHUA 2HDNB 3Q9LA 1T0HB 2JA1A 1R0XA 1CU1A 3L82B 1S0UA 1U8AA 4LC1A 5JJKA 2BCJQ 2X2FA 4QBFA 3QXCA 4IRUB 4PAQA 3IDQA 2R6FA 5EP4A 4KLNA 2R6DA 5JS7A 3OIUA 1SVSA 4QBIA 4B34A 5EE3A 4Y0AA 3KX2A 3G0HA 4ZI2A 2QP3A 2BKEA 2VP2A 2WBLC 1LY1A 2WWXA 2HXSA 4URWR 2QQEA 2J41A 1P4SA 3HYRA 2CBZA 2FGKA 1E9FA 1KJWA 4MGYR 4V0OA 2OBLA 1SVOA 2J59A 2GBLA 3LFUA 2YWHA 3SR0A 5JECA 2ODWA 5JSZB 2P6NA 1CKEA 2H1LA 3CBQA 2QY9A 3ND9A 3ZS9A 4BE7B 4NTZA 2OXRA 1DO0A 1S4QA 3MCAA 4XSGA 4DJTA 1Z0DA 1ZM7A 4JLAA 5TVKA 5JHGB 5FI1B 2WWFA 3AKCA 3RWMB 3SJZA 4EIWA 5KDOA 1GM5A 4NPHA 1NSFA 1QHSA 4KVAA 3NBYC 5HKKA 2X1VA 2D2FA 3MWYW 1XTSA 4ZIRB 1OXVA 1IBRA 2ZJYA 4ZO4A 2Q9CA 4QXAA 3RSLA 3GJXC 5JRJA 2F55A 1YKSA 2EQBA 5SZIA 3ADKA 2P65A 3EZ9A 3NH6A 4TYYA 3NBFA 1VYTA 5AUQA 4TYQA 4B2LA 1YZGA 2CHQA 2EFGA 2XTNA 1PLJA 3MJHA 4BFZA 2ZUCA 3GCGA 2ZE5A 2CK3D 4PFSA 1CS4C 2REBA 3CNOA 5BXQC 3LNCA 3W6NA 5GJWC 2J46A 2AL7A 2B21A 3OESA 1XTQA 4LI0A 1J7KA 1CJMA 3FWYA 5CYOA 4TLDA 2WKRA 4LV6A 2QBYA 3U7EB 2R8RA 4ZCLA 4CT4B 1IONA 3F0TA 3RAPR 2PEZA 2H7VA 3AGPA 3LXRA 1NF3A 1ZM2A 1OJLA 2JJ1A 3AUYA 1OFHA 1TUIA 1ZINA 3QG5A 4Q00A 4D26A 3DMNA 3A4LA 4BLRA 1CR0A 3CUEF 2O8BA 2A3RA 2Z6VA 3OE7A 4PR0A 1FNMA 5DHFA 3W3AA 3P20A 2LKDA 4JL5A 1TQ4A 1T4GA 2C2HA 4YMVA 2BKUA 2CCKA 1RRGA 5E7IA 2CE2X 5JWOA 2G3YA 2HF8A 3OEHD 4HAUA 1J70A 1EX7A 2ZYTX 4F7WA 4NONA 4HATA 5CB6A 4LWZA 2VQSA 5L3QB 2BBTA 1TL7C 3K0EA 1QHYA 4FMCF 4HAVA 1P61B 2XGJA 4TL6A 5LPNA 4D81A 1TQ6A 2ASEA 2EWWA 4ZDWA 2O8CA 1J90A 1MO6A 1OFUX 4ERNA 3VKWA 2V1UA 2AK2A 4Q4JA 4ZDJA 3CR7A 1OHHD 2VP5A 1U94A 2XNSA 3CPEA 5TB5A 2MSDB 1XTRA 1Z3IX 2VHTA 2FFHA 3L8ZA 4N3NA 3I61A 4JBYA 4TLCA 3A58B 3QE0A 2IW3A 4DDVA 1G18A 3REGA 4F38A 2FN4A 4CEIA 1C9KA 1FMLA 2FSFA 4UNQA 1GKIA 1RIFA 4UXJA 4E03A 3GFPA 3GMTA 4IXNA 1H8HA 1UDWA 1UF9A 2GBLC 2WWIA 4Q9KA 4D25A 3PQCA 4EPRA 1G41A 1ZAKA 1UEIA 4A92A 4V0LA 1ODFA 1S1CA 5FL3A 2ZXUA 3W6OA 5TMPA 2ZSBA 4A8JC 5G41A 3V4FA 2AWNA 1KI2A 1W44A 3QY0A 2IXFA 1NLFA 2QP9X 3KDSE 2RGBA 1HQCA 1KJZA 4HAXA 1XCGB 3MLEA 1R4AA 3KKPA 5JS8A 1XRJA 3TH5A 2FG5A 2HJGA 2J87A 3LAWA 2PX0A 4B73A 2ZI3A 5DI3A 5CLQA 4OK3A 5BN5A 2YWFA 3FFBA 4ABYA 3DVLA 1DAEA 2GK7A 5CJPA 4HZUA 4DUGA 3EA5A 2ZRAA 4YONB 2C95A 4C0KA 2NO6A 3OIVA 4P3YA 5DIFA 2LWIA 2JLXA 4QL3A 3TAHA 2HUPA 3IPYA 1N25A 3U3MA 2WWHA 1T3HA 3SJCA 4NBSA 2VYFA 4PO9A 1SXJA 2Z43A 4V0MA 3AM1A 1IY1A 1FUUA 1Z2CA 2VSOA 4OJQA 3IBGA 2F6RA 4LY6A 3X1ZA 4F91B 4D2IA 1P6XA 1R8QA 2H17A 3CF6R 3U3RA 3K9NA 2RHDA 4GNKA 4M1SA 2WWGA 1OE0A 3QI2A 5H8WA 3OE7D 1PLLA 1YQTA 4U5XA 4AKHA 4XH9B 5KTYA 3D8BA 2V6JA 2CMKA 2E87A 1G21E 4P4UA 3OIYA 2A78A 1FMJA 3FHOA 3AF4A 2YZ2A 2DBYA 5KPJA 4LSGA 1E9EA 3CONA 2IC5A 3U4QA 4FN5A 4MKHA 2C98A 2V1XA 5D3MB 1GSIA 3WNCA 4BLSA 2WM9B 4RD1A 4LYJA 1Z83A 3P26A 4A82A 3WBJA 1E2NA 3QKRA 4H1UA 1G8GA 2V55B 3MGCA 3A36A 4MYHA 2YWEA 5JI3E 2GRJA 4PANA 2W2TA 2J0UB 4AYTA 2JIZD 3HYTA 4LBZA 2XITA 2EWVA 1N5KA 3M6AA 1BO6A 3WYGA 1Y3AA 3SZRA 4JLMA 4DCNA 2DYKA 4WAUA 1XMSA 2JAQA 4HAYA 3KQHA 2O8BB 3QG1A 4OQFA 3AGQA 1GP2A 4AKEA 6Q21A 2O0KA 1VIAA 2BM0A 2P0EA 4Q1CA 3TAUA 3TLXA 5HR5A 1XTIA 4Z1MD 1ZUHA 1KO1A 2QN6A 3BORA 5L3RA 3TUIC 1WE2A 5FL7D 3TW8B 1XPRA 5FUYA 3UMRA 1RVDA 4BFSA 1R2QA 3AP2A 1E1QD 3IQXA 1EFHA 1TU3A 3DOFA 4XWOA 5KNCA 3CIOA 3BB3A 5GADl 4ON9A 2DFNA 3H86A 4H9GA 2GEUA 2P3SA 3BWDD 4Q4JB 4DCSA 1Q3HA 1VPLA 1F2UA 1DVRA 5CDFA 5L3SB 1AS0A 2GNOA 3F8TA 4HI0E 1P9RA 4HLUA 1IN6A 5DGXA 1XEWX 2KBFA 1XZPA 2IYSA 3TSWA 3WP1B 4LYAA 1XD2B 1E3MA 2QEQA 3R9WA 4J0QA 2MSEB 1UDXA 2IXEA 3C5HA 1S9DA 3VFDA 2WJYA 4GBMA 3PXGA 5BN3A 1SVMA 1FP6A 5AJYA 2QQ0A 1MO4A 4R9UC 3PEWA 4DWJA 3QPUA 3QPWA 1DAFA 1OW3B 3SQXA 3NXSA 4IFBA 2QTVB 1P5ZB 4U7DA 1QHNA 1AZSC 1XJ0A 3RANA 2ODNA 1HUQA 1E2LA 3THOA 1G20E 1PLKA 4MRNA 5CM8B 1MR3F 4WZ6A 4TYNA 1Q44A 1S2MA 1F2TA 1U81A 1G4AE 2A5JA 4Q1BA 1K6MA 5CYPA 3IILA 1F3OA 5KHOC 5JI2E 2AD5A 4I4LA 4EPTA 1OYYA 3HR7A 4XIGS 4XD7A 3WMEA 1KKMA 4FXPA 2OCAA 1T3SA 3RVBA 1SGWA 2AHOA 3QJYA 2D2EA 4DHEA 4K46A 1UBGA 2ZYVX 3EZ6A 2CCJA 1LF5A 4Q4AA 3T35A 1DTSA 3U61B 1NKSA 4LYFA 1K5GA 2IS4A 4B3GA 5CJ2A 4Q7LA 4AG6A 3QKUA 2ZJ2A 1QVAA 2ZRHA 2ERYA 4FMCB 2Z0MA 1XX6A 4DLUA 4KV9A 2IX3A 4Q9JA 2GK6A 1CR2A 5BYKA 1NKTA 3B7GA 3DHWC 3UG6A 3NEYA 1KMHA 4JLPA 3S1AA 3QEOA 4TQAA 2XB2A 4RD4A 1OKKD 2CE7A 2ZIAA 2FWRA 3KFXA 2J9RA 2IYZA 1Q1ZA 3AF2A 2NIPA 3EWSA 4K81B 1AKEA 1KGDA 3GLGE 2H18A 2QI9C 2P6UA 5FTMA 3PEYA 1OHHA 4WA7A 1OKKA 4URZR 5H70A 3H2YA 4G5OA 4E22A 4GZMA 1DG1G 2QGZA 4M1WA 4AWXA 4JZKA 1XFAA 1P73A 1VG8A 221PA 2QGNA 2RH5A 4JVMA 1E32A 2VSFA 4GRAA 3VKGA 1QF9A 4Q66C 5K8TA 4UNSA 2JDID 4B2IA 1U0HC 4A6PA 4FIDA 4WXPA 4CRWB 2R2AA 1GOTA 1FOEB 1Z2AA 4V03A 3QXHA 2CL7X 1KI4A 4MH0R 3RWOA 3E2IA 1W0KD 5TARA 4KODA 1XZQA 1SQ5A 2KI5A 4KVGA 5FUWA 3TVDA 2JJ1D 3BK7A 2CXXA 3IKJA 4QM6A 1HA3A 4MYUA 3RC3A 1OXUA 2O8EB 2D3WA 2J5XA 4GOKA 4LC0A 1T5IA 3LBNA 3WY9A 1BMFA 1U2RA 3TUJC 2WPDA 4DC9A 3ZH9B 4QBGB 2BHRA 4CGZA 3ZDQA 2XZOA 2IYWA 3GJ5A 821PA 2QBYB 1HV8A 4DLWA 1GRRA 2O0HA 5F9HA 5E4FA 2O8CB 3K0FA 1K5DA 1F5NA 4MRSA 4BUJA 2JCSA 3KXIA 1AZTA 1CF4A 3ZZUA 2GXSA 4MRRA 3MRSA 1JR6A 2YINC 3I32A 1N6KA 3GLFA 2VP4A 2FE4A 3GLFB 1OXTA 4CEIB 4V0ME 1FFHA 5EXSA 4UXHA 1YZQA 4Q9LA 4RJLA 1MRNA 2ONJA 3GLFE 2HYIC 1CJVC 2BCGY 4HB2A 4M22A 1SVLA 2OSBA 2DFKB 3GFOA 4WZAE 4RSGA 2V7QA 5DYGA 2GWHA 4Q1FA 4V0KA 1RRFA 2BBSA 1HQYE 2H8KA 1N6NA 4LK2A 2XAUA 2NO7A 2J1LA 2OM2A 3TQFA 4MGZR 4QNMA 1NN1A 3N5CA 5KYKA 3RDPA 2C9YA 2BV3A 4DBLC 3ADCA 2XSZA 4PZZA 1HY3A 5LD2C 2QENA 4Z8XA 1NJFA 2IHYA 5JEDA 4GL2A 2PZFA 4C7OB 2CDNA 4B75A 5JFGA 2OLKA 2Q9AA 1A5TA 2VHQA 1COWA 3C4JA 2GEVA 4EPVA 3CW2A 1PJRA 2IUUA 3NHBA 1R5BA 4IW3B 3BD9A 2ZS9A 4MUAA 5BYJA 1W5TA 1DAMA 1E2KA 4O0MA 5KUTA 1UJ2A 5C1BA 2ZSDA 4RCYA 2ANCA 2DCUA 1WP9A 3GLIE 4D4JA 4Q02A 3I1FA 3NEJA 1XPOA 5K8IA 1WQ1R 4RCZA 2G77B 3SHFA 5BWMA 4PAMA 5GVRA 3T15A 3TNFA 1XCPA 3ZD6A 2VP6A 4DLXA 5KU1A 3WP0A 4KI0A 3DMDA 3K8YA 4JVNA 3BB4A 1HE8B 2JLYA 4B71A 4G3XA 4GT1A 1P2UA 1DEKA 1XEXA 2FPMA 5A4JA 4CIDA 1AGRA 1BMFD 1NY5A 3N2IA 3QQ5A 3SU8A 4UJ5A 3WHLA 3FYHA 3O47A 5JMTA 2QPTA 4A2WA 2FSHA 2ZTSA 3MWJA 3MWKA 1P60A 1SXJB 3BJIC 1G8HA 1Z6TA 1RJ9B 3KB2A 3NVAA 2NMVA 1IN4A 1N2CE 1PZNA 1EFRA 3UWOA 4IOLA 3AF3A 3BH6A 3EC2A 3VMFA 1E0AA 2J0VA 1UKZA 4JLKA 2CJWA 2GTPA 1X8KA 5FTJA 1OIWA 1RW4A 1H65A 3E5HA 4V02A 4G01B 1JR3E 1QHHA 3ZIAD 3KTAA 1NG9A 1DO2A 5J47A 1N3BA 1F2TB 1N6IA 2I1QA 4W7SA 1OH7A 1IY2A 5C2JB 2BC9A 2J3EA 2N46A 4NCJA 5CLLA 2QMOA 1E2DA 3JZAA 4OHXA 1M74A 3NC0C 2R44A 2OBNA 5IDVA 2FF7A 3FOZA 3I72A 4C7OA 5AK0A 4PHTA 2QA5A 4D4KA 1E79A 2XZLA 1D8TA 1N6LA 2OCBA 4EQ6A 1E2GA 2NOAA 4HSEA 5EE9A 3SI7A 4Q7MB 2R62A 2F1IA 2IYTA 1P62B 4LBVA 5JJLA 3NTUA 4KYIB 4HLCA 4L4UA 4P0TA 2D62A 3OAAA 2UKDA 1TTTA 3QF4A 5K8UA 4KFRA 4IFEA 2WKQA 3LH5A 3UPUA 1ZIPA 1E69A 4BRWA 5JJIA 1YZUA 2SHKA 4TTQA 3K0AB 5KO2A 2JLUA 1W36C 2CHGA 2ZI5A 2DWQA 4NE2A 5CDFE 2OG2A 3FDIA 4C2UA 1XJCA 4D4LA 4A1FA 3T06B 2QT0A 1YR8A 1U9IA 1WMSA 2G6BA 4I1UA 3P32A 2WWYA 1CTQA 4NCIA 2IXGA 4A0GA 3ADBA 4TMXA 3RRYA 3ECCA 4DLYA 4W9MC 3X1YA 1Z8FA 4C0AC
chains in the Genus database with same CATH superfamily
1ODTC 1GQ2A 1OD6A 3B12A 3I4LA 1Z29A 3GEHA 1JH9A 4O4LB 4PXSA 1A7AA 3CVYA 2Q0SA 5FD8A 1EWYA 5DCYA 5KNDA 1JR3A 5HJ7A 5HRAA 4J1TA 2P5TB 3AVPA 1C29B 5KHLB 3CX8A 3QXSA 2G17A 4AVYA 5BN3A 3DCJA 2XVMA 2PH3A 1RR6A 4NDAA 1N5LA 1GG9A 1NBHA 3IMCA 1TIPA 2A1UB 4EUNA 3TDMA 1BWPA 2H4FA 2HK6A 3OPNA 1RLMA 3GAAA 3THSA 3B1FA 1J49A 4XWKA 2ZWMA 4IIJF 1T9DA 3OLVA 5HZKA 1H1LB 3EXHC 5J9FA 3VO2A 1GD1O 1M7GA 2FA9A 1G3MA 1SPBS 2G4CA 2WFMA 3A8TA 3OIWA 4HWTA 2CLSA 2H0QA 2IITA 2CFTA 3WYDA 2AH5A 2DMRA 2FSSA 3W3ZB 2QRNA 4Z3KA 4ZODA 1QMGA 4E46A 1CD5A 3BE5A 1F12A 5IUJC 1OTYA 1O96A 2H65A 3GOHA 3WADA 1JL3A 2M6RA 2E89A 1F8GA 1T8WA 2JGMA 1F0PA 1HH4A 3DAGA 3HDTA 3DBLB 2FW8A 3UCXA 1XDBA 1ULAA 2WYIA 1SRQA 2LP4Y 4YPVA 4FGKA 3O3OB 3BHMA 3TZKA 1OT3A 2H92A 3PUVA 2V0NA 1JJIA 4ENTA 2QAGB 1A04A 4QJIA 2YRXA 1M2OB 2BT4A 2Y1XA 2LUOA 4BFTA 4MHTA 1Z33A 1H0RA 1OA0A 2VPTA 3QV1A 4U3JA 3JQ9C 3EG5A 4MV3A 5SZHB 3UIEA 1E2QA 3DE2X 3P4UA 3PC4A 3RVNA 3ZHCA 3AVXA 4LHWA 5LP1A 4TLEA 3S44A 1I3CA 2BM1A 2HOQA 1YI8A 1B8OA 2C8KA 5DO9A 1E2HA 1JTVA 4YJKA 4DRXB 1H2RS 5FULA 1FQKA 1XZBA 2I54A 4KXVA 4HWOA 1D2RA 5FLKA 3I1IA 1Z6AA 3JWEA 3NM5A 3OF5A 1H2EA 1FQJA 1QFJA 1S2LA 5LOVA 1E3EA 2JJ8A 4GVPA 2WVGA 1O3YA 2I65A 2YUTA 4C7VA 4D4GA 3GLHB 4O2BB 4NRDA 1XZAA 3PUHA 1O7JA 3FR7A 2AZTA 4L0MA 4NSNA 3ESXA 4YQYA 3V1UA 1MV5A 1N2OA 1REQB 1EFLA 4J4BA 4FONA 4TWZA 1YKGA 2E5FA 4WDRA 5FI0B 3UWPA 3KALA 3O4VA 3OQ6A 3QK7A 2B0CA 5IXYA 1UBOS 3VR6H 4FR0A 2P1RA 5COBA 2CLDX 3ICOA 2PQ2A 1MIOB 1B76A 4OI2A 3TW4A 1KDTA 2X0FA 4BO4A 1NOKA 2JKVA 3L06A 1P3JA 3MWDA 5BN4B 1L3IA 3O90A 2Q0XA 4C0XA 1J9ZA 1CUWA 1IVNA 2XH8A 3VNSA 4CQLA 3NBXX 4RMGA 1LXCA 1TFRA 5KTTA 3GDOA 4IV0A 5IDXA 5BUZA 3D6UA 3BTVA 1G2QA 3OMXA 3HNPA 5AVUA 1XALA 1GFSA 3OT1B 1E5LA 2MSWA 4KQ2A 3GR6A 3C6QA 1CC1S 4OQMA 1MX3A 2VI5A 1Z28A 2Z9BA 3EARA 3V2UA 3WRWA 3C7AA 1GLGA 2JH8A 4G67A 3NC1C 1CFJA 4X5OA 4HB3A 2PRKA 3IMEA 3ZLVA 2DHRA 1RKXA 5E6UA 2XZDA 4TZ6A 1HMPA 3IO3A 4AG5A 3TL6A 4KNWA 2Q4RA 5AJHA 2XJ4A 1DPFA 1D03A 2R25B 4C1BA 1BNCA 2BZGA 4E88A 4M7WA 3K5PA 4B8YA 1AKWA 1K3UB 3LC7O 1TEZA 5F2KA 3L7AA 4L9WA 4AJOA 4C0LA 2GSWA 1DNPA 2YC4C 5EFZA 4UEQA 1UKVY 1YR9A 2W2LD 3F6RA 4J0IA 3O8CA 3JZMA 2QUJA 3BULA 1QTNA 3L7DA 1Y9DA 2VL7A 1VBFA 4GFDA 5CW2A 5I3ZA 4WCFA 2F3QA 1WVMA 3V46A 3V7YA 5IJ9A 2VDNB 4IHQA 4YRZA 1AURA 2PL3A 5EXXA 4REMA 4BZPA 3U9LA 3UAZA 4YNBA 5K3SA 4DPMA 1ZGHA 1Q1QA 4LSZA 4OSEA 3TW0A 3CPSA 1PI3A 4RZUA 1QLHA 9LDBA 1OV4A 4R7ZA 3QE3A 4K0KB 1UJ5A 1VCIA 1KMHB 2OEPA 2RGGA 3VNUA 5H9WA 7YASA 1ECFA 1ZUIA 3DYVA 1BDIA 2C7VA 2XKAA 3GEDA 3AUKA 4XUGB 1XLUA 5JSYA 4EBBA 3UJ8A 2BEWA 1QLWA 2G1AA 4HLQB 3H04A 1L5LA 1E2JA 2Y1DA 4Z4EA 3LHFA 4FFVA 2NP6A 3ICVA 3G0IA 4N49A 1B1AA 2G0AA 2YKGA 4HGNA 1SCJA 2JLCA 2ZU0C 3OLYA 1JG1A 3B9BA 4R83A 4AZTA 4F4DA 1W36D 1NFRA 1QV9A 2BPOA 2GWRA 3JVVA 5EXPA 4A8PA 4RAOA 4P53A 5KNBD 2Q28A 1YOVA 1T6ZA 4EW6A 2BFBA 1OH5A 3E5NA 2QZSA 1JJVA 4IIFA 4RUKA 4DV7B 3E58A 4DR1B 3O1HB 2X7JA 3DKIA 3VR4D 4D97A 1DZIA 2Z4SA 2WKPA 1QGOA 1TZKA 4EB3A 1QU2A 1QG6A 2YWXA 2NNWB 4FWIB 3UCEA 1CUDA 5AW9A 2IPOA 5T4FA 1QJCA 3QOYA 1IN8A 3ED5A 4JFAA 1SA0B 4MV1A 2ZITA 1R6UA 3LECA 3O8BA 3EFEA 4M0EA 2YIJA 1J39A 3P71T 4B3BA 2YXEA 2AUNA 3D4BA 1IJEA 4L2IB 4RNDB 1T0UA 1Z5ZA 3M6UA 5CK4A 4YRIA 3LT5A 1H2AS 1R4MB 5TF0A 4F6RA 3CWQA 3TM4A 5EUQB 3ZNPA 4C0WA 1CEQA 3BXEA 2RHBA 1TEHA 2Z4RA 4UVEA 4F06A 3PVZA 2KYRA 4AJEA 3FCAA 5ULLA 3K73O 4UEOA 3VH3A 2MR5A 1TYBE 1FFXA 1QZZA 3WJ1A 2XOXA 3FAZA 3BKWA 3I9V6 3JQFA 1CQXA 1JIIA 3DB2A 3VKVA 1OI2A 1R6BX 5ECDA 1T9AA 2Q3BA 3VX3A 1KI3A 4AM8A 4NMMA 4F2DA 3C7KA 1DQZA 2XAAA 3LQQA 1VZ3A 2AZXA 4YLGA 4A6EA 2WKWA 1WDTA 2I2AA 1Q77A 2WU8A 3HKCA 3PVCA 4UHDA 4IG4A 5SYNA 3WMXA 2I2WA 1J8VA 3N87A 5J2UB 1P8AA 2OECA 1T1SA 1TCUA 2I22A 1UBFA 2GBCA 2ZVJA 3VNQA 5B58C 3E1GA 2ZCUA 3WGNA 2BLNA 1C0KA 1YS6A 3FF4A 1WPRA 5BPHA 4AX8A 2QRGA 3BXZA 1V26A 2J5RA 2LXNA 5HILA 3TJZA 3G8DA 5TGTA 4O59O 1Z63A 4O2AA 4XQCA 4G5RA 2GZDA 3V8NA 2RK4A 3IXQA 3AF0A 3KOZA 2UZ4A 2GKSA 3CRZA 1QK5A 4Z7OB 5BW4A 3HJAA 1EFCA 1VSVA 5KTMA 2IU0A 5EZ6B 4RDXA 1B0PA 1V4BA 1QFSA 2HF7A 1TJ5A 1M7HA 2Y67A 3GT4A 3PQDA 4IVQA 4JYBA 1Z7WA 4RQBA 1DCKA 1K1EA 2FF5A 3F4BA 4PZLA 2IBMA 2XMZA 3HO8A 4E12A 3BFKA 1KY2A 4YROA 4KV7A 1EXMA 1YS7A 3F7MA 3H17A 2DUMA 2DQYA 2R6ZA 4KDEA 4S1OA 2PWYA 1D5WA 5JHHB 5F9FA 4B0OA 5JCJA 4PYNA 4P33A 3K3PA 2GAFA 3Q11A 4P4SB 5FOVA 3QBVA 1TGYA 1C2TA 1K2VN 4X8LA 2C20A 3VR4H 3GRYA 1IY8A 3I8SA 1SUWA 3FVQA 2UZ3A 4GHWA 3RYFB 3NPAA 3FVTA 1FU4A 1GRNA 1OXKB 2ODPA 2X6TA 2FXVA 3LPMA 4MRPA 4TMZA 2Q6VA 4DSNA 4L5IA 2PMBA 3OM8A 2H85A 2J7PA 1VLJA 2IPXA 5D6OA 1UZUA 3LOPA 5SYAA 1NE2A 2IDJA 5KQPA 3A32A 4US2R 3KR0A 3FWZA 3FLEA 1KL7A 3I30X 3OTQA 3HRKA 3ELDA 4UZFA 1JR2A 3OF2A 1U0RA 4GXRA 4XOIA 1NXWA 4KIWA 4LYGA 1MCZA 5LZ4A 1T8PA 2XGMA 2XMDA 2X4LA 3HN6A 3N8GA 4UCXA 3NIGB 1ECJA 3UMBA 1RZVA 1KSHA 5EP2A 4IV5A 1OQAA 1Z4LA 4YTEA 4YCCA 1BWQA 3R3HA 5F23A 1I7QB 2G07A 4D3YA 3AEQA 1R3UA 4FJ2A 1L6IA 1II8B 2FGJA 1XZGA 4OEHA 4M1QA 2JD0A 3AK4A 1T3GA 4XQEA 5E1OA 2QNIA 2R2GA 3H3JA 1X7ZA 4M9QA 5LLTA 4M0KA 4EHHA 2DSNA 1OFIA 5J3JA 5J59A 4A10A 1W5EA 4U5QA 1ZHHA 1QAQA 4PO1A 2H4JA 2IPAB 2FZLA 4QODA 4ZPXA 2OFXA 4DQDA 5FUQA 4AX4A 4RC9A 2HB6A 3PQ6A 2PXHA 4RSMA 5KMGB 1USKA 1MAAA 3R5KA 2OBMA 1L5GB 4IXMA 3RVJA 1JFSA 3D3JA 3HU2A 3L0IB 4NENA 4EG8A 1TO2E 4REQB 3U09A 4TUYF 2C9OA 2GBGA 2UUPA 1SKQA 2PKQP 3VI4B 1ZUWA 1B1CA 3OHSX 3CE9A 3TI9A 2X0IA 2OESA 4H7PA 2C4KA 4LF5B 4HUJA 4D0SA 3R9KA 4BN5A 2HSWA 1PEDA 4UMDA 1AQ6A 5EIWA 3ROZA 3SD7A 3WIDA 3GEEA 3MRXA 4LVNA 1V2HE 3OQBA 2P8SA 4IZHA 4EUHA 2A58A 2AX4A 2M6LA 3PUZA 4YV1A 5DGIA 3O84A 3ZS8A 4ENSA 4OD0A 1IPHA 4JQYA 4BRZA 5CFQA 2K4MA 2W9XA 2X9GA 2ARKA 2TMKA 4RV5A 2QG4A 5IJXA 3IBYA 1GQYA 1YZ3A 1OREA 2YYAA 5IC6A 5EWMA 4LCJA 3LPLA 5CCEA 2A5FA 2CLOB 2ZRMA 3B13B 3FPSA 2WMDA 5CYGA 1FSGA 3AL0C 1PW5A 4YQEA 1H4VB 1E9SA 3PQEA 4N5LA 1E6LA 1F3LA 1JN0A 1F38A 1YQ9A 2C03A 5GIOE 5C18A 1A69A 2RGUA 5KREA 5FEUA 1II8A 3MCTA 2NAPA 3BHIA 3ZE2B 3FJ1A 2CD7A 4DMRA 2ZEJA 1OTHA 1VDZA 2FCRA 3EMDA 4R1TA 3SP1A 4F4JA 3QVWA 4DMLA 1N2EA 1KHHA 3PRJA 5C3UA 3FMPB 3SHTA 3HR4A 2P2LA 1P5FA 4XOUA 5HA5A 1R10A 3E2PA 3QPVA 4X61A 4GOJA 5FUVA 5J5VA 3FLBA 2IBSA 3T0FA 1A9QA 2GKGA 3KQWA 1VGVA 2YYZA 4DUZB 3ZX4A 1VCHA 4WE3A 5JQGB 1EX6A 1R00A 4UUOA 2VJLA 4U3JB 1C4XA 1QBKC 1ISMA 4HRAA 4YMTA 1I32A 3AJRA 3QLJA 3HSKA 4HVLA 5J4HA 4Q4LA 3FOBA 2G8LA 4MW5A 5A6SB 3ZCXA 4EFNA 3BH0A 1J00A 2PYIA 3VVMA 1UMCB 3QKTA 3QA9A 4RTLA 1KO8A 4LJ4A 4QEKA 2Y77A 4D42A 3M3PA 1NG1A 4JI7B 4F86A 1K3TA 1SUBA 3DZ8A 3WMGA 2E9SA 4YP0A 3AB3A 5TQ2B 3T4UA 3HVIA 1ENYA 3ROTA 5I7RA 2P0AA 4EB8A 2IS1A 1LWOA 5JD6A 1G5HA 1L5YA 1EINA 2AGVA 2OBYA 3FNQA 3JYOA 1THMA 1TU4A 2QRVA 3DKPA 4CF5A 3U7GA 1MW8X 3I83A 2WOJA 1FTSA 5KMGA 3I2FA 3T3OA 4W5HA 1K6JA 1KMIY 1FU8A 1R5JA 2CVHA 3HPQA 4ALIA 4WEQA 1QYDA 8AT1A 2F43B 2ADFA 2QYHA 2D4HA 4ZU1X 2PRSA 1XXHA 4DIEA 3E1SA 3NETA 1NR1A 1UUFA 4URYR 3T7DA 3QEKA 4EHAA 1G6OA 1N4AA 4FS8A 1UBSB 4J07A 4OH7A 5FPPA 1Q0HA 2WJGA 3FGPA 3K1TA 4NBVA 1DDOA 1NUTA 1XQWA 3JPWA 4DM4A 1G3RA 4PV7A 2GOYA 2PXAA 1KP9A 3PJFA 2RHWA 3MGGA 5KDDA 3T6KA 3MTEA 3Q7IA 4WOPA 2QAJA 4RFSB 4ZQBA 3GFTA 4MK4A 3F3MA 2HMSA 3MRTA 4FHFA 4ARZB 1NI4B 1L7XA 3KDAA 2QLTA 4I08A 4UREA 5K6AC 2FH5B 1W5SA 4C14A 4DQKA 4P0PB 2DUNA 2BDTA 3RS7A 4CZ2A 4NYIQ 4KAXA 2I2DA 1IXRC 2P9CA 3JQFC 4JGBA 4UATA 4PSKA 3A6ZA 2OCPA 4UHJA 1Z5NA 5ITZA 1V3UA 4KRGA 3AVWA 4FK8A 1H8ED 1WZIA 1P4RA 3FRJA 3LL4A 3NASA 4L15A 1A77A 1DIAA 1GKKA 2AA3A 2VJPA 4DM7A 4EGJA 2O2JA 2JZOA 1UL1X 2OCYC 2WD7B 3DAFA 3KLOA 3ROKA 3VPHA 4QFBA 3AJAA 1OSNA 1A9PA 3L07A 3RUAA 4P4GA 4R7GA 1T36B 4TM8A 5JS6A 3QVKA 1CB0A 3IP6A 4BLPA 4ER5A 4CR8A 2BZ1A 2GEFA 1HDEA 1CNFA 2AXPA 3JV7A 4JENA 3TPZA 3LV8A 2OAP1 2OXCA 3GD7A 2QRVB 1L5HA 4EPWA 3WGIA 2NT4A 4QDXA 3ZEIA 4OLJA 4IIYA 1ZR4A 2I2CA 4QJ4A 1G0NA 2H4XA 3GQBA 1WCWA 3RS5A 1AKMA 1HE3A 2DECA 2VWPA 4WMLA 1CETA 1SC3A 4J0FA 3K1JA 2CJPA 3EIFA 4L0CA 4ZCSA 2A1IA 4EKDA 2XQGA 1KIFA 1JNXX 3L7MA 2Q1UA 1VP9A 5A7GA 2BGMA 2X9LA 4PE5B 1OVMA 1SB8A 1J09A 3RHSA 5K5EA 1AHHA 5A6SA 2VRCA 1JJFA 1ZMTA 3MHPA 1EA5A 1ZG3A 3ROEA 4IOJA 4LWQA 3A31A 3EZXA 4KXUA 1QLJA 4WXMA 1FLNA 2QPOA 1I1QB 4IYRA 2ZSUA 3D8NA 5AOBA 5EIAA 3RVOA 1GZ7A 3KEFA 5GZ1A 3BRWD 4E5SA 1GPUA 2P9JA 4LX0A 5LQNA 1NW5A 1TLFA 2AUMA 2FWNA 2FSPA 1TC2A 2A0FA 4FHGA 3LKVA 4I9FA 3VU9A 4BGUA 1ZNWA 3IAFA 1W4AA 3SK0A 3UWSA 5LDHA 1Q84A 5A2GA 2B2NA 1I4TD 1WS6A 1U28A 2J3HA 2Y1OA 3C98A 1DUIA 4E2FA 5DMXA 4ZO7A 4RPIA 1SK8A 1HDIA 1QH1B 3JD4A 4CQMB 4HUQA 1ORTA 1JFFB 4FC7A 5AD1A 4OVKA 3UJ9A 2X0NA 1SXPA 3BF8A 1RHKA 4I1SA 2QHXA 2ZIGA 3G0GA 4F1KA 2PGNA 3GB9A 4HZUB 4B6EA 3BSSA 3K6SA 3UM9A 3AF1A 3EJWA 3FGNA 4OB7A 5EYPB 1OH8A 4IDOA 2NG1A 1SN7A 2ZR0A 1U8YA 3SHOA 1V3QE 3URKA 2BEJA 2JGKA 3GGGA 2DULA 2O9JA 1OZFA 6AT1A 2WJ3A 3PPIA 3VJLA 2SCUB 3E35A 4L2IA 1NLMA 2EJTA 4D9HA 5A4KA 2G5CA 2B4QA 1WV0A 2J9YB 5EZ5A 3BJEA 3PUWA 5JAZA 2XRFA 6REQA 1QDUA 2QTNA 1I9GA 4Q3LA 4QQFA 3TGLA 3VKHA 5AQ1A 4HH4A 4QG7A 4NJOA 1O0BA 1X1SA 3W06A 2QLNA 4EUEA 2FK7A 1NMYA 2OC4A 1PJTA 2VSXA 1NXTA 3CKKA 1KQNA 3M81A 2QJFA 3AL3A 1Z38A 3PR1A 2XYHA 2Z1DA 3T4EA 2WD9A 3PSHA 4QULA 1XO1A 2HQ1A 3MTIA 3H2SA 1L5MA 2VSYA 4AZ0B 3LG2A 3WBBA 2JGIA 5IT0A 3IIKA 3DL4A 2GJ4A 1BDBA 4MYTA 2A9OA 3G2HA 5B2ZA 4BYMA 4UHEA 3AR4A 1Y7TA 1YZKA 4D9JA 2RGNC 1MJGM 3P97A 1L4UA 1NW4A 4FZRA 4EKEA 4YRMA 2I71A 5KSOA 2GETA 3CT6A 2JFGA 4QTTB 4R54A 3UJ3X 2BEKA 1OC2A 1Z6ZA 2DY0A 1YZVA 1EHYA 3AVYA 2YMPA 5CX1A 1YB2A 2JLQA 3Q72A 3V80A 4CQMA 1TE2A 3G17A 4CV1A 3WQRA 3BSWA 3LP8A 3INGA 4RU1A 1IVSA 4ZVVA 2AOTA 3FNIA 4JLJA 4BNXA 1QOPB 5CLJA 1RLOA 1TC1A 2XVAA 5COAA 4BUCA 4IOMA 3NIBA 2PA0A 4LUCA 4BOYA 1KNQA 4C6SA 4PC7A 3T54A 4TKVA 2YXLA 4LDRA 1M6HA 2O3RA 4DQ0A 1IYZA 3QJGA 4CG2A 4PNZA 3WQSB 3GT7A 4B80A 2X9NA 3U0VA 5ARDA 5LZ7A 3W04A 4CM5A 2V54A 5JNUA 1A1VA 1RXUA 1AQIA 2WZBA 2DKFA 2ZTMA 3BAZA 4BO5A 1DIRA 2GF2A 1JWLA 3TD6A 3CM0A 1M2WA 3RU9A 1X3SA 3CH7A 1VJRA 3KWLA 1CULC 3F8WA 4G5SA 4LV5B 1SCBA 4R3UC 3HY4A 3IE1A 1V7CA 2EHJA 2NXEA 3NUQA 1LI7A 2F17A 3HBLA 3SC2A 1LSUA 5HK9A 3OT4A 5G4KB 4F3TA 1FW6A 4Z2YA 1BHSA 3FWKA 5EYPA 2AEJA 3RUHA 2W5UA 3SZMA 3E3NA 2E0IA 4MITA 4B5LA 1KK2A 1ETHA 1EFPA 2ZZMA 5HDQA 1OPRA 3THXA 5KS2A 1G7TA 3VR4A 1G0OA 4MEJA 2J32A 3BRCA 1UP4A 4NAHA 5LMZA 1NBMA 1BMDA 3EWIA 3O83A 3EODA 3CRQA 3DA8A 1T2FA 3JWIA 1E61A 1K8YB 2WTBA 4JP1A 1QP4A 1EX9A 4L8YA 3B6ZA 1GZ6A 4LZJA 3FH0A 4N5HX 3UXMA 2FQ1A 5C8DA 4KN6A 3QFSA 5LLDA 2YOGA 3W5JA 3ELUA 2QN1A 1A9TA 3GJ7A 2AJDA 1QHXA 2GX6A 3VUEA 4KBYA 2GZAA 1QYIA 4G4IA 2LGJA 3H3XA 4RTMA 2UYHA 3CR8A 3LHSA 3HXPA 1ST3A 3JATA 1MO3A 1W88A 2J7KA 3O0DA 2MSKA 2W71A 5ENDA 2XZPA 4E5UA 2G67A 1Y33E 4A1OA 1CZRA 5DE3A 5C8YF 2TMDA 2B35A 1ZICA 2LV8A 1BXKA 1NM5A 3DLAA 3O6VA 2EFJA 3LGAA 4HQFA 4U2KA 4BFXA 1B4DA 3H5LA 3NTRA 1AY0A 4BLTA 3IVCA 3JQPA 4GX5A 3HDGA 3ZN2A 1Z17A 3WR5A 4RVCA 2WG1A 4Z2AA 2B4KA 2OCKA 3K0SA 2G28A 1Z06A 2JBAB 3MJDA 1STOA 5FBWB 2EX4A 3ABRB 3SICE 3WLSA 4Q1EA 4BNZA 2NPFA 2KB0A 4P5DA 4S2EA 5ECYA 2I34A 4I3HA 1Y6ZA 2Q3FA 1QO0A 4IIUA 4R9RA 1TKAA 2CVFA 5JZSA 1KI8A 1ZI9A 4AY2A 2BUAA 1T6BY 4FZJA 1MJHA 3JQ8B 4LSWA 1SKMA 1GFIA 2WQ6A 2M6KA 2XADA 3VR5H 4KPEC 2C3YA 4CM4B 2CNKA 1PZGA 4II7A 1KZYC 2WJVA 1LSJA 3DDZX 4XB1A 1QG4A 4GEKA 2Q0HA 2V6FA 2LVBA 1HT1E 2IH2A 1R37A 2JZNA 2Q99A 5JANA 4IDQA 1ZNYA 3WLKX 4E5MA 3C85A 3VQTA 1VE9A 5LP6B 1F1BA 1I14A 2G63A 1Z6PA 3DWIA 4OKNA 3U4IA 1JEYA 2QS9A 3DNMA 1JHUA 2HGSA 1RQLA 4MR9A 3SN6A 1UAYA 4RFVA 4D1YA 1ADJA 1WSDA 3MC1A 3N6XA 4I14A 4ZT6A 4AIIA 2PD4A 3LE8A 1XMVA 4HEJA 5JCOC 2YNMA 5E7QA 2YW9A 5JSUA 4PTLA 2XVZA 4CT0A 3MERA 4R4JA 4CHGA 5JYBA 5K4HA 3T5GA 4TL8A 4G9GA 4NS1A 1W34A 1FIUA 2OV3A 2RGXA 2JH9A 1V6AA 4KKVA 1VG1A 3HKBA 4C0SA 1I2AA 1TVKA 2DTXA 2OPHA 2VJDA 4AMBA 4F4IA 2BELA 1DQPA 1VRVA 1T0JB 2G1JA 4D0NA 5C5CA 4M1KA 3PC8C 1ZSYA 1P75A 5E9JA 5J23A 2C4UA 1EUDB 4OUKX 3F74A 5DGTA 4TV9A 4DWVA 3UBTA 3T7TA 5KYTA 5GTDA 6LDHA 2FLVA 3Q5DA 3ZYCA 2VJNA 2ZI6A 4Q4DA 2FW7A 3NGMA 4HDNB 4CLDA 3J81A 3JQQA 1V43A 2ZP1A 3P5SA 5K01A 1ZR2A 2W42A 4E31A 3LBHA 4EJSC 4WPGA 1QG2A 4L4ZA 1N5IA 2IUTA 3O73A 5AT1A 3FOWA 4ND6A 3D3WB 1ORIA 2R79A 2ZAOA 1OT5A 1XDSA 2B6HA 3K5HA 5DVZA 3UHFA 2O50A 1UWLA 2J5KA 3BDIA 4ZAGA 4ROTA 4B3IA 1QFXA 3ONWA 1NT2A 1Z18A 2LPMA 3OQIB 3SR3A 2GA9A 4DB4A 1U9CA 2IY7A 3NT5A 2EGHA 3OZBA 5LXTF 1N33B 1G16A 4UD2A 4YXWA 3DBHA 2FZKA 4ZALA 1KRWA 1RLJA 5FO0A 5A0VA 4IHAA 1WSAA 4WUVA 2BTEA 1H5NA 4OHYA 5KTNA 3MJCA 4X1KB 2RGDA 3HGQA 3MM4A 1Z9BA 2YBEA 4TV8B 4EPYA 4GBGA 1OX4B 3S7TA 3ZDXB 3IQWA 5J1SB 4O63O 5C51B 1ZNZA 2ENUA 4EG0A 2CL6X 1V35A 4C0QC 2AK3A 4BYGA 3GN2A 5DYYA 4YLYA 3N7UA 1TVKB 1DIOB 1KAOA 1PSZA 4JKIA 2QN8A 2HF2A 5BNWA 5LBUA 2BEVB 4ZVNA 4W5WA 1VL5A 2YZNA 5KI6A 4ABTA 4UZEA 1BOOA 1PUJA 1X8LA 3IV7A 3O2JA 2WK1A 2FR8A 5MFZA 3FVVA 4GUDA 3IH5A 1E62A 5KYNA 1M1NB 4YFVA 3E5RA 3GBVA 1SVNA 3M70A 1Z25A 4M98A 2IBTA 1LD3A 4MR9B 4R2MA 1EEHA 1JALA 2FLWA 3NP7A 4DEYA 1Y6FA 1EJ6A 3K96A 2WWVD 5D1NA 3CXRA 4JASB 4YAJA 2Y1GA 1X7ZB 3PBKA 1I1HA 3ILYA 3ASVA 3TCKA 1MTOA 1BW9A 2FMUA 5KC9A 2CLMB 4WZBB 5KYUB 1UWKA 1Z6GA 3E82A 3L7OA 3IJRA 3UMCA 2Q3HA 5FF9A 2GXUA 4I8DA 3MUNA 3ETGA 4UKDA 5ERGB 1L4NA 4X1YA 3S7ZA 2GCOB 3W5IA 1FMFA 2ZUEA 3BVPA 2XEXA 3KQTA 1AKVA 1E1QA 3BGWA 1G4UR 4RVNA 1ORRA 4G2TA 4QPJC 3RVKA 4F93B 3T7KA 3AEYA 2BM8A 5GY7A 4ZEVA 2F3RA 2VKQA 3GARA 4IICA 3GJ4A 4ETNA 5J2UF 2RH9B 3BXFA 3PGVA 3BCUA 3BJRA 1CHNA 2OV4A 3K9QO 2ZS7A 5GM1A 5IU6A 3MWGA 5LIPA 3N0TA 1G5TA 2ODEA 4IGEA 3LYAA 1MO5A 3Q7PA 3OFVA 3ZTTA 3PI7A 3FXAA 2QTVA 1CUEA 3R9IA 3WGVA 4D7AA 4E4TA 1G7SA 4PO8A 2NO9A 1U2TA 1KDVA 4D6PA 4LBWA 4QX6A 2NZJA 4H60A 5KX5B 1JSRA 4LZZA 3NZEA 3PE4A 5T3YA 1K89A 2A5LA 3IGFA 3WDKA 1YRLA 2HI0A 4H1VA 3TW8A 2R5FA 5CB8A 5JARA 3HXMA 3ETEA 5EL0A 4XLZA 5L3QA 1V8PA 4MYCA 2KX7A 1NV8A 3FDFA 4FHEA 4R3NA 3CH4B 3PUXA 5IVKA 2FN3A 3RYTC 2B7CA 4ZYLA 4NOLA 3Q9SA 3K31A 4K6CA 2ZQZA 2WF8A 4KYVA 1E1RA 3RVDA 5EJEA 2C82A 2X9VA 1RYHA 4GZ3A 5AJUA 1RWWA 4MQFA 3KQVA 4AJNA 3ZDAA 2EU8A 2E4AA 1AV7A 3PD7A 4HGQA 4WSOA 1MT0A 1BQEA 1HG1A 2IELA 2AG5A 4IIHA 4L7QA 1IUKA 3RG2A 4UNRA 4V24A 1BRTA 1DQYA 1ML3A 2CXSA 3DMPA 3LX5A 1UPTA 4NVRA 1KYWA 1NPYA 2Y2VA 3NS7A 4WFQA 4JVSB 2MHCA 3C5WP 2JAUA 5ILQA 1PR3A 4LKRA 3C8HA 3NBMA 5K3DA 1AB5A 1QH0A 2ENWA 3IJEB 3BFXA 4OQNA 1H3EA 5D85A 5DSTA 4DLBA 2HLPA 1G6KA 3OZFA 1ORHA 3E53A 5DW3A 2CVQA 5I9NA 2CJWB 2NYAA 1NR5A 1YA8A 2HEIA 3DZBA 1KJYA 4IJUA 2ZB3A 1MH1A 4KLZA 4LCBA 5AK5A 7REQB 4M1EA 4P98A 3T3PB 2F1RA 3NWOA 3QRWA 4FOLA 4FYPA 3IURA 4B81A 2PZJA 2FFAA 3PTAA 1OLXA 2PFGA 2AR9A 2H5IA 4QBHA 5F3DA 1K7CA 2GMWA 3G7UA 3W9UA 1ISRA 1VG0B 1MX1A 3FX2A 2ZBFA 3B6EA 3FTQA 3HMQA 4WNYA 2CFRA 1XJ5A 3GNLA 5DNVA 3ZW7A 5JTTA 3L8MA 2Y1EA 2XCSB 2QUAA 3IDAA 4TL9A 3QVGB 3ILXA 1U02A 3TKLA 1WEKA 3L8EA 5CW1A 1QH8B 3NALA 2BFCA 1YS1X 3CLUC 5DTEA 3C48A 1W2WB 4DDWA 2R8PA 3A26A 5FV4A 1EJ2A 1NI5A 2CUNA 1WQ3A 1QGZA 1YS9A 3AEZA 3INRA 4FINA 4WJZA 4YJHA 1YD7A 1QS0B 2DPHA 4WW0A 4JQCA 4G0QA 4F56A 3EG9B 3TE7A 4EMSA 1LK7A 1IQPA 3QPDA 1XWIA 1P1JA 1XMPA 3N58A 4YBRA 1G8YA 3DL7A 4JU8A 4HNSA 5CXXA 2PRZA 1PJSA 2YMLA 5E9QA 2AX3A 2VHVA 2QRKA 3WL5A 2F67A 3WK8A 3LQKA 1IZ8A 4NBRA 4CLRA 2FHPA 4LWPA 4GKBA 4AD8A 2J3MA 4I50A 2RBEA 2D7DA 1H6BA 4I4TB 5H1YA 4B6GA 1AGYA 1V6SA 3BSYA 2W4QA 4IM7A 4DT1B 5HP4A 2QTHA 4M9RA 4CM3A 1H2BA 3BK1A 1RZ3A 3H1TA 4HEA6 3ENQA 3ESZA 5G3ZA 1WF6A 1YK0A 4E30A 3H9QA 2GS9A 1CUAA 2VZLA 1DKOA 1PX0A 2FMKA 1SWVA 3QUAA 1OWLA 1IN5A 2JGDB 3HKBB 4K9NA 5JD3A 3AI2A 4RY0A 4PLZA 5NLLA 3GFRA 3VTAA 1SXQA 2JJQA 3U49A 3W78A 3H5TA 5E1MA 3PHBE 4RGQA 5JPIA 3NTQA 1WA5A 2F43A 2HO5A 3NH9A 1SBIA 4BPBA 3SQNA 1YNOA 1DBPA 1AD2A 2E55A 2QD5A 5LBIA 3ORQA 2MDTA 2G83A 3DDHA 5FJIA 1N1MA 3SJBA 4I99A 3DAYA 4CFSA 3BHJA 5CG2A 5BSFA 4WZAB 3H5AA 4LY9A 4G8DA 5K0FA 2YRWA 1I30A 1WXGA 2HSGA 1W88B 3IUSA 3IXMA 5K3FB 1SXHA 3VPFA 2D59A 2E7ZA 2R1TA 2BGNA 1QIFA 5K8LA 4U00A 4OOEA 5B3LA 5FBLB 4JYCA 3DE3X 4H27A 4G5QA 4A03A 5I5GA 2HNBA 1RQXA 2WT9A 4O4JB 4PBTA 4WBSA 5E7JA 5ARCA 3INTA 4DDTA 3DC7A 4ZCPA 4B45A 3ER8A 3QXGA 2IP4A 4JJZA 3I8XA 4NNJA 2VTEA 2Q0QA 2XXAB 4U9IS 1NP3A 2HWUA 5KAMA 1ZI6A 4HNQA 2XCQA 5KYUA 5KOJB 4BTLA 1NNEA 3OPYB 4M1YA 3A14A 3VSBA 4QGSA 4LJSA 3UMGA 2OPBA 3K6SB 1LW6E 1J8YF 2PU7A 1UKYA 5B5SA 3S2EA 2WB2A 4PCVA 3OPVA 2QL6A 2XWPA 2BHLA 4KE7A 1T13A 2E4ZA 2DPXA 1GPAA 2X3UA 4BMOB 2FEXA 1NDHA 4E09A 4CIXA 4YCLA 4CKBA 4MOWA 4FLEA 4IY1A 1U3GA 3SQLA 3WNDA 3A2MA 3VC1A 4EYKA 4LJYA 5T6MA 3C45A 4QOFA 4UOEA 3AUJB 1NJ8A 4LHZA 2EG9A 1Q11A 1B3BA 2QV7A 1O9GA 2C59A 3MTGA 4JC8A 5C8XA 1GCIA 4FBMA 4QGAA 1E1YA 3TQHA 1EVZA 5FTWA 3N2LA 1E3JA 1LX6A 1SQ6A 2PZBA 2V4ZA 2WD7A 4JEHA 4MWOA 5E38A 2HFKA 3W2TA 4IWYA 4Z0HO 1R7RA 3FSEA 2GJ9A 3I9V1 4I3GA 4KW7A 4CPDA 4F3RA 1Q0SA 1ST2A 3DNFA 5LQJA 1Y8RA 1ZZGA 4HPXB 4DLPA 4J76A 4NHEA 3HV2A 1U8CB 3VR0A 4AUMA 3K70C 4XGRA 3NFYA 3REOA 3QU9A 1W85A 3D6HA 5ALTA 1HSOA 2D0PB 3A3OA 4TV9F 4NOMA 4K1LA 4A0RA 3GBSA 3GNSA 3KAPA 3LCUA 1G3QA 4K9KA 4MLCA 3U62A 3WRXC 3U3ZA 2C7PA 3PFWO 1T8RA 1SFRA 2BOVA 5E6SB 1B74A 1RZRA 1NVUQ 1RWMA 3VBCA 1L7RA 2C9BA 3VPDA 4ZAWA 2AW3A 3QEMA 4XUEA 3TRIA 4BJ3A 4NARA 3OX4A 1YFLA 2QTZA 2VH1A 3QKRB 2CMHA 3BWBA 3CO0S 4ZVTA 3QEAZ 1Z15A 2YJZA 2G70A 1HM5A 1RFGE 4E08A 3GOQA 4F6LA 2IX9A 1A8IA 2BAGA 2HPZA 3AFGA 1VL2A 2CLIB 2WABA 1Y3IA 4M3NA 5IMSA 2ZUFA 3B1VA 3PIDA 3WNVA 3RGGA 2VTBB 5CAEB 3H2GA 5SICE 4EABA 1Q12A 3KQMA 3VTKA 4DR3B 1IXZA 3KJQA 5CA0B 1U2GA 4KWCA 4Z99A 3TNJA 1D2NA 1Y3DE 1EGQA 3BILA 3QKWA 3WL4A 1OIVA 4ER6A 1E7WA 1G64A 3G5AA 3PTLA 3F7TA 3EMVA 2WR8A 4UQOA 3Q3JB 1Y9ZA 2I3GA 3FY4A 1N0UA 4B7UA 1XVLA 1FRVA 5ALXA 2AQHA 3N07A 2IS2A 3Q2KA 2AR7A 3QTLA 4DZZA 1IVYA 4EFMA 4ND7A 5IC4A 2VYQA 2Y1WA 3M4ZA 4FNGA 3PUIA 1X6VA 2FZ4A 4KN5A 3TINA 4QDKA 1OX5A 4BQSA 4DQXA 4RVOA 2QGFA 4X63A 3SMQA 3EFOB 4A8HA 1D2CA 3QOXA 1DIBA 1U3DA 1VKNA 1DZ3A 4UOQA 2SBTA 5DHRA 5FR2A 3KD3A 5T5QA 3UG7A 4BVAA 3I28A 4GX1A 3E9RA 4CDGA 2FQWA 1YK1A 2PUBA 3IB6A 5JUWA 5FHQA 5TMEA 2YJGA 4MUKA 5EZSA 8ADHA 1Q57A 5KCZA 1WVIA 3WMFA 2O1SA 3RLFA 3ZCQA 3QVLA 1GG8A 2FJ0A 5JAQA 4MV5A 2IEGA 3DXFA