4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MJ0495-LIKE PROTEIN
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
3K9LA 1EFRD 2WJHA 2BKEA 5KDLA 1RYHA 5AJWA 1CNEA 3MHPA 3A36A 3VKHA 1QG0A 2J0VA 5E7IA 3WNCA 4ACAA 2QQEA 1NMYA 2ZI9A 3VO2A 1VQ4B 5GVSA 1IN8A 3V9PA 3MD0A 3CMAB 1QG2A 2BEKA 3A1TA 4BFXA 2BMFA 1U8YA 2MSDB 3QKTA 1KYIA 3CPHA 2WWHA 1I4LD 2J5XA 1G7TA 1GOTA 3AB3A 2YWGA 3B1VA 4JLPA 4LX0A 4PHFA 4N3GA 1S3SA 3RDPA 5JJIA 3FPKA 3CRVA 1Q57A 1MKYA 1A8PA 3QF4B 2PMDA 4Q48A 4TL8A 5SZKB 5KNDA 1G8YA 1DPFA 1UJ2A 3CCMB 1NL3A 1VG1A 1Z47A 3FMFA 3OEEA 5EQTA 2YWEA 5EE0A 3RSLA 3B60A 3X1YA 2GAOA 1NP6A 1YJNB 2G1KA 5SZIA 4DJTA 3OESA 2O8FA 3FMIA 1JI0A 4EDHA 4C0SA 3HDTA 1KAGA 3QE0A 1JAHA 3HJNA 4HATA 3QXJA 3TJZA 1UBCA 4CEHA 4LYFA 1IJFA 1OH8A 3CNOA 2GEVA 2RGBA 2JLVA 3N70A 4PPNA 3UWKA 4LHXA 4E22A 4ZDJA 2JEOA 2Q9CA 1FNMA 5DSZA 2CCKA 4JYBA 3AVUA 1XMSA 2ANBA 2FH5B 5AJYA 4F4JA 4ZPXA 3CMEB 2XSZA 4QBFA 5FUVA 3TW4A 2W0MA 3B8HA 3IHWA 4DCUA 2O8FB 1JECA 2XZLA 2C78A 2OCBA 4OHZA 3W5VA 4QHTA 4LJ5A 1EG7A 2A5JA 2R6CA 1E63A 1GSIA 3CH5A 3TUJC 3QFSA 1V43A 2GJKA 4PSKA 2CCJA 2FX3A 2AK3A 1U0JA 2YVUA 2YWHA 1DVRA 4DXAA 1A5TA 1NKTA 2CE7A 3E5HA 1E2MA 2DWQA 3IGFA 4WZAE 4YAUA 3RS0A 2P6NA 1YQTA 2NZ8A 3CPWB 4PSVA 4LUCA 2ZRCA 3GLHA 4OK3A 4EJSB 2BN4A 5JEEA 3UG7A 1EESA 2XB4A 4PAMA 1UF9A 1SXJA 3X1DA 5F3WB 1KMHA 3HYRA 4L9SA 2I1VB 1CR4A 2VHUA 3DPUA 4US2R 3LLUA 1B0UA 1IB0A 1EX7A 1KD1D 2IT1A 5DH9A 3AM1A 3EXAA 3OJXA 1E9FA 3K9HA 4US0R 4US1R 3ZZTA 4D4KA 1GRRA 2NG1A 3QG5A 4B43A 2ZYTX 5AWFC 2OV2A 521PA 3KQKA 3QKUA 3CRMA 3NH6A 3FMPB 1A7JA 5FBQB 4B71A 4XVRA 4EPWA 4MRRA 3SYKA 3PR1A 3SBEA 3ZH9B 2QG6A 3PQCA 4GZLA 4URUR 3DZDA 4FN5A 4LHZA 3ZD7A 1KNXA 3KDSE 4NYJQ 4R2IA 4IOMA 2XSZD 2V9PA 2YINC 1KNQA 5JS8A 3BORA 2VHJA 3Q5DA 4PZYA 3TUIC 3UK6A 3TAUA 2H5EA 1WB9A 3CX8A 3MWKA 3SFVA 1ZNYA 2KB0A 2REXB 2QMHA 3NBZC 4C43A 4MUAA 1Z8FA 4DLTA 2IYVA 1NN1A 4EPVA 2WM9B 1LTQA 1SVIA 1L8QA 4BFSA 1H8HA 5FH9A 4P3YA 4A9AA 5HZHA 5KDOA 2ASEA 5TARA 2RGNC 2HLDA 3F5FA 1GR1A 1RE0A 5TB5A 4PPFA 5JECA 2DCUA 4QBGB 1P2VA 2IXFA 3I4LA 1W46A 1DTSA 4V0OA 2XGJA 1XXHE 2XXAA 4JJZA 2MMGA 4UJ5A 2NO1A 5FI1B 2Q0HA 4CEJB 2PEYA 2XEXA 2ZQ5A 5FTNA 4F4CA 2JASA 1W44A 3W5UA 1X8KA 4E5UA 3OIUA 1AQYA 4ZIRB 3EG5A 4EFLA 4L15A 3R9XA 1FX0A 4CF7A 2ODWA 2QRNA 3VMFA 1I2MA 4OQFA 4NCHA 1HT2E 1UMKA 1R5OA 1MO6A 4KU4A 4AI6A 1N5LA 3K0AB 3T34A 3G5UA 3GJ3A 2MMCA 2VHQA 1XZQA 3L0PA 3X1ZA 4EKDA 1EP1B 3RHFA 3FPAA 2AXNA 3E70C 3TLXA 2VO1A 4A0HA 1RZ3A 2YZ2A 2WOOA 4L16A 3B1XA 4BFTA 2HT6A 1BYUA 1SGWA 1XTJA 1HTWA 1Q1EA 2P6UA 3QY0A 1Q44A 3M0EA 3O8CA 5K8IA 4DLRA 2WMNB 4JSTA 1ZD1A 3LW8A 3UIEA 1AN0A 2ZETA 3OIWA 4XD7A 2AN9A 1CR1A 2ZJ5A 2DB3A 2JJ1A 3BB3A 5FPSA 3ZZ0A 1TF5A 3G82C 4OYHA 1XEWY 3OHMA 2H8KA 3UMFA 2RGDA 4AKEA 4A92A 3TNFA 1W36D 3RC8A 2RGAA 4IEIA 1SHZA 3DL0A 4Q7JB 4RFSA 3RS5A 2O8BA 2GDJA 2QA4B 4WW0A 1GRQA 5TV2A 4IKEA 5K8TA 1MO5A 1P2UA 2QTFA 4HDCA 3V00A 2FSIA 4ARZB 4QM7A 1S8FA 3H1TA 1PUIA 5GJWC 1GAWA 1IONA 3QFCA 2Z5FA 1J2JA 2W6ID 4Q4HA 4EUNA 1LF0A 1KI1A 2C5LA 1YHQB 4PX9A 1E1QA 3PITA 3WYGA 3T06B 4X8HA 3OF5A 2R6DA 721PA 3QE2A 4M9SA 2VF8A 3VKWA 1UADA 4TMZA 1BYIA 2PL3A 3C16C 3QPWA 4KV9A 4OBEA 3VX4A 2PCLA 4TZ6A 1T0HB 1E2HA 1OYYA 4AURA 1TL7C 2JDID 2GXSA 5D3MB 3K70B 2B7CA 1OH6A 4BFVA 4Q01A 1G20E 1GIAA 3VAAA 1K73D 1P62B 3DMNA 2KWIA 2GBLA 3CH4B 4LHWA 3FB4A 3EASA 4LBVA 2GK7A 3SE0A 2GXUA 3VTKA 4D25A 3WMFA 2F1HA 1N2CE 4D82A 1JA1A 4BFZA 3G0HA 2QBYB 4DZZA 3PV0A 1E4VA 1IQPA 1EK0A 2WKQA 1KJYA 3V4RA 5JS7A 3ZD6A 4GT1A 4BPBA 5EUQB 1E99A 2IUSA 3VFDA 1KAOA 1OFUX 2JLQA 3FMOB 3DOEA 4DDUA 3G4SB 3CR7A 3GLGB 3NDBB 2RCNA 3HPQA 1QFZA 1NY6A 2IYWA 4FMCB 3ZQJA 4M1MA 4DSNA 3ZBUA 1CJVC 3PEVA 2BSAA 4TYNA 5TY0A 5LBIA 4M1TA 1YRBA 2GETA 2ZRLA 2F9MA 4YAWA 3W2IA 2JIZA 1QVAA 3FGNA 3N2EA 4LPKA 2KJQA 3KJIA 1E1RA 4GPTA 1TU4A 2EVWX 3GQBA 3D31A 3U3JA 3VX3A 1IN4A 2FZLA 3Q7QA 3WMGA 1T4GA 1OIWA 1GL7A 3OZWA 4HZUB 4IHQA 2GEDA 5DYIA 4ESVA 1G64A 4A82A 3QBVA 1KI9A 1E79A 4QFMA 2FOLA 2YOHA 3AF2A 3SDZA 4B3BA 1CLUA 2A3RA 2DFLA 1NKSA 4RD0A 4JLBA 1X8LA 2JJ2D 5EZ6B 5HTKA 4GDFA 1XBTA 1FP7A 1SVMA 2IUUA 4MKFA 3THWA 2XOKD 5EE5B 1TTTA 4Q19A 2QAGC 2Q6TA 5CK5A 1IAQA 2ATXA 1XTIA 4CZ2A 5CJ2A 1K9MD 4DDWA 1DAFA 3ADDA 2VBCA 1E2LA 2VNKA 2GNOA 1KDOA 4LJ9A 1JALA 1Z08A 1XEFA 2HV8A 1EFRA 1NMXA 2FEMA 3KKQA 5D3MA 2L0XA 2W6IA 4G3XA 4XIGS 5FOSA 1BS1A 2JJ1D 2JLZA 3GD7A 4TYQA 1C4OA 4AD8A 1G16A 1P9NA 2CHGA 3U60B 1N5JA 3LDAA 4Z8XA 5HKKD 3R9IA 2IS6A 1E2FA 3X1WA 2DBYA 4I1OA 1G18A 3SNHA 2QT1A 2QMOA 4DDTA 2OUKA 4Y0AA 5AUOB 2CNWA 4IEEA 1X6VA 2WAYA 4QG7A 1QFJA 1WF3A 3CPEA 4GOXA 1DELA 4LGMA 1KO5A 3MWJA 3TGPA 2WJIA 1E94E 1KZ7B 3GLIE 2O8DB 1E62A 1NIPA 1N0WA 2P0EA 2ZSAA 3AKEA 3AVQA 3G71B 3T5DA 5JWRA 2WWIA 2OFOA 1PLLA 1R0WA 1N6OA 1NIJA 2DY1A 4P31A 1MRNA 3ECCA 1OFHA 1G19A 4TT3D 2DR3A 4EJSA 4BLSA 2AL7A 2XTZA 4OL0A 4URWR 4PSAA 1IN6A 4TYWA 4P4TA 1P9WA 1HE1C 3BGWA 1OXVA 3FDIA 1FMLA 4JMPA 1M7GA 1W2HA 1X1RA 5EMNA 3ZVNA 2VL7A 3FHCB 3OAAD 1US8B 2WAXA 4LV8B 3BWDD 3K09C 4F7WA 3SI7A 4PC6A 3U3MA 1Z0KA 3SOPA 1FNDA 3I56B 3SC3A 4QOSA 3QFTA 3DM9B 3NH9A 5JI2E 4B44A 5C46F 5FTLA 2I1QA 2WBLC 1R10A 1QRAA 3GJ6A 1Q3HA 2X19A 2A7QA 1ZM2A 3CWZA 3A8TA 1T3HA 3PUXA 1JXMA 4WA7A 1E2NA 3K8YA 1FTSA 1YZTA 1W36B 2A9KA 1KY2A 2EYQA 2K5UA 4NL4H 4MGIR 3QFRA 2PMKA 4BRUA 3I8XA 1J99A 1U9IA 1IM2A 3VKGA 4TLEA 1CQXA 3A1SA 3EA5A 4M2LA 4C2UA 1R0YA 3LVBA 2ZRAA 2XTNA 3MG9A 1ANKA 1WDTA 4DT1B 2R6AA 1XJQA 2OCAA 2WHXA 3HU2A 2WJYA 2ZJYA 4HAUA 4CRWB 4Z1MD 2W6JD 1UKVY 4CEJA 4MYHA 2B8TA 1HT1E 1CP2A 3I92A 4URYR 2ZS7A 1DAIA 2MSEB 2F1RA 3NWJA 3W34A 1FUUA 2DEUA 2W2TA 2ZU6A 4DC9A 3R9WA 1VQPB 1F3OA 1M7BA 1U90A 1BO6A 3TAHA 4A8JA 3QSYA 4ARZA 2W2VA 4JLJA 1MT0A 3PFIA 4RVCA 4HB4A 3UMSA 1N0VC 2V4ZA 4DUGD 4K81B 3K70D 2DFTA 4BLOA 3AVYA 1E9RA 5FOWA 2OFXA 4DLXA 1B23P 5E4FA 1VYUA 1K5DA 4NCKA 2P5SA 2GWHA 3PEYA 3W5JA 3ICEA 3U6BA 2BWJA 2ZU0C 1QGAA 1TMKA 1D2EA 4DIDA 3LXXA 1PV4A 2C2HA 4JVMA 3E20A 4Q9IA 4A8JC 1BOFA 1F2UB 2QTVB 1E9DA 3AKDA 1U2RA 1TQ6A 2WICA 4XSHA 3KFVA 1DE0A 4NPHA 1UKEA 1DS6A 3CRQA 3CRW1 1KHTA 1BIFA 3GJ5A 1E1QD 2OAQ1 2XNDD 3A6PC 5EXTA 4R7ZA 4BECA 1CR2A 1Y3AA 4M1WA 1T5IA 2R65A 4IXNA 4OK5A 1E64A 3CW2A 2X2EA 1Z22A 4R2HA 4YHBA 1X1SA 4ZKDA 2A5GA 1MRSA 3QI2A 2ZTSA 3LH5A 3MGCA 1ZM3A 2F3TA 3CO5A 4KO8A 2GF0A 4IDOA 4EPTA 1LW7A 2JATA 2WV9A 1ESMA 2QT0A 5M04A 2BJVA 5EP1A 2AD5A 2CJWB 4RD2A 1ZUHA 4NYJR 1OH5A 3W2EA 2BBWA 3OEHD 1T3LA 2ZYWX 1Z07A 2QRZA 4A8JB 1OH7A 4FD2A 1P60A 4Z8YA 4NDZA 3U7FB 4LBWA 1SHKA 3EZ7A 2GJ8A 1DO2A 1ONBA 1XZPA 4BZQA 3K9NA 2VP4A 4H9GA 4O2RA 5FBLB 3ZYCA 4C9BA 3QBTA 221PA 3PUVA 3RYTC 2PJZA 2V6IA 1HE8B 3CIOA 4FW9A 3C4JA 1QHNA 4Q02A 2B5OA 3T1QA 4ZKEA 1O3YA 5IT5A 3T5GA 4RZ3A 4TTPA 3W9YA 2KBFA 1CKEA 1F2UA 2QENA 3Q5EA 4O3MA 4CEHB 2NMVA 3QENA 1CF4A 2H1LA 1RJ9A 4KBFA 4O2LA 3IBGA 5F9FA 3RWMB 1JQJC 1PUJA 1H8HD 1E2QA 3LX8A 4HLCA 3O8DA 2GQFA 4BEJA 3GP8A 2HCJB 1AKEA 2JCSA 1GKIA 5KSPA 3AP3A 4XTCS 3CB4A 1FPMA 2VHTA 1UAAA 3IPYA 5EZ5A 3K0FA 5B64A 3NEJA 2PBRA 2P6RA 4BLPA 3KJHA 3B78A 2WIAA 3W2GA 1HURA 1KKMA 1G3RA 2F6RA 1GNPA 3AF4A 3BJIC 1MOZA 3I5YA 4NMMA 1Z6YA 4IW3B 1W1WA 4RSGA 2QP4A 2VNJA 2NO6A 3AKYA 1NVVQ 3HWSA 2QAGB 1S3GA 3BH7A 5JCPA 2ZUDA 2Z4RA 4TZ0A 2ZJ2A 5JMTA 4WIAA 1KO8A 2QA5A 3CNLA 5FPKA 1P3JA 5GADl 2E87A 3AF3A 1XTSA 2HF9A 1YVDA 1ZUIA 1BH2A 2YYZA 4HDQB 5DYGA 3NHBA 1F20A 2ZM5A 1RPZA 4D2IA 1FQJA 4HI0E 1P9RA 1AQUA 4Z54A 2OCPA 3BFVA 3ND8A 1AS3A 4UNSA 1QZXA 2YJTD 4KHZA 2JLWA 1XNJA 2PIAA 1JPNA 4DCTA 3LA6A 4YMUA 4WBSA 1F60A 2CNDA 1YI2B 1UBGA 3V76A 4PHHA 3GLGE 5AUQA 4JLMA 2ZRPA 3ZZUA 1YE8A 1YKSA 2IK8A 3VHLB 2G77B 4C30A 5BW8A 1KSJA 1Z2CA 4P32A 5L3QA 4WOPA 1G4UR 4B6EA 4YALA 3BFKA 1RKBA 1US8A 2FGJA 1X8JA 3T35A 1IXZA 1ZRHA 1P72A 1AS0A 3EPKA 3GFOA 2C77A 2IF0A 621PA 1QHGA 1M6NA 4I1VA 4JKIA 4O25A 4KFTA 4K8OA 2QP3A 4BWYA 1Z6TA 2V6JA 1OV4A 2YOFA 2R6HA 3AF1A 3IUYA 3LNCA 4ITRC 4DT1A 3FFBA 4Q1CA 3HR7A 1XJ0A 2ZSBA 4TTRA 5P21A 1NLYA 2ZI4A 4S2EA 4Q9JA 1RJ9B 3F8TA 1UDWA 2ZSFA 4IFBA 2O8EB 2ZE6A 5FFMA 4MDFA 1KK1A 3D6TB 3ETLA 1W35A 5HE9A 5FL3A 2EFDB 1S1CA 5FUYA 2ZR7A 4UJ3A 2W2XA 3AF0A 5H8WA 1OKKD 2GBLC 4B35A 1D2MA 1WCV1 1ZNWA 1XU4A 3EPJA 2AFHE 2RH5A 3CC4B 2C98A 2ODBA 2F1JA 4P4UA 3ADCA 2IWHA 3VU9A 1Z3IX 2AKYA 2OESA 5D3QA 5JJLA 2KE5A 1Q0UA 2IS2A 3OFNA 5DGXA 1EX6A 4OJKA 3B1YA 4A0GA 2HF8A 1H8EA 2BCGY 3I61A 2B7BA 3JQPA 1I7PA 3PUWA 3WMEA 1EWQA 2BCJQ 1VYVA 3KKPA 3GLIA 3H86A 4P6VF 1FZQA 2HXSA 2D7DA 2XJ9A 5AK0A 3ZGXA 1P2TA 2ZVPX 3OIYA 3IPXA 3WP0A 1ZM9A 1NVUQ 1GNRA 1M34E 4P0TA 2VP5A 1DARA 1N6KA 1WP9A 1G17A 3PENA 1QBKC 1ZNXA 2RKOA 4GSYA 4PANA 2J0SA 4C4PA 1E2JA 4LY6A 2VP6A 1P75A 4XVUA 1LY1A 1VQNB 1Z0DA 3GLHE 4BLQA 1HEIA 1ZU5A 3RAPR 3ND9A 5JCZA 1OIXA 2IYTA 3K0CC 4LC1A 4A2PA 2J9RA 4D6PA 4B4DA 1FRQA 1IY1A 1FFHA 2CVHA 4NH0A 1E0JA 3AVPA 1R0XA 2OCYC 2WVJA 4TL6A 2AWOA 4OQXA 1KQSB 1Q82D 3M1IA 3VO1A 1YZNA 4YXWA 3TMKA 5DNYB 3F3YA 4JVSB 4LZZA 1SKYE 5FL7D 3SYNA 1G7SA 3RS7A 4OI2A 4PC1A 5B57C 4MYUA 4B3DA 2ZIAA 4HDOB 3WYAA 1Q21A 3B13B 5J4LA 2N1BA 2C9YA 3L0OA 4HAXA 4ASUA 3B9PA 3ZVRA 2EFCB 2D74A 4M1SA 4QXAA 1E0KA 3NVAA 1NI3A 2DFKB 2NO0A 5LPNA 4HZIA 1KGDA 3NHAA 4I1SA 5BYJA 3EW9A 2GAAA 3I8SA 1CXZA 1ESNA 2B92A 1XPRA 3JQRA 3CZPA 3QXHA 4B3GA 1KK0A 2JAQA 3UG6A 1WA5A 1TEXA 1W36C 5JBQA 1W0KA 1R6BX 1T5LA 2ATVA 4LHVA 3QKRB 1WQ1R 1VQ8B 1ZBDA 5LD2C 4V0NA 4OK6A 1L4YA 1N6IA 1XD2B 2VP9A 3VQTA 4DSUA 2FSGA 4Y9UA 4DIEA 3H0KA 4CEIB 3CCVB 1OHHD 4PC2A 1OF1A 1QVGB 2ZUCA 3WHLA 1W2GA 4FCVA 5CIQA 4R98A 4MQBA 2WWYA 3EA0A 1DAHA 2JJ8A 4JLVA 2PZEA 3HU1A 2G1JA 1FL9A 1OPXA 3WNDA 4W9MC 2NPIA 3T1VA 1ZNZA 5LDDC 1Q22A 4GP6A 1I2DA 1OXUA 4DEYA 4Q18A 1PLJA 1ZD8A 4DKXA 2JLUA 3PIRA 1VPLA 2Z83A 821PA 1NN3A 3F0TA 1VQ6B 4HAWA 2ZS9A 1JB9A 3IILA 4XSGA 3NEYA 1JR6A 4I4LA 3KQUA 4JL8A 4E03A 4G5SA 3CRZA 1E2EA 1EGAA 2GVDC 2QM8A 4AY2A 2PLFA 3EZFA 3NXSA 4M8NE 3FYHA 3CF6R 3C15C 5FI0B 2UKDA 2XZPA 3I72A 1DDIA 2FWRA 2AWNA 2X2FA 3NIBA 1YJ9B 1Z06A 4PQYA 5H1YA 2XTMA 5LD2B 3EARA 2WSMA 1IY0A 2IC5A 1VQMB 3N2IA 1KK3A 4B48A 1G3IA 1GDDA 2RB4A 1G6OA 121PA 2VP0A 3Q7PA 4IVPA 2CLDX 1E2DA 4UXHA 4NHOA 4LV6A 5FBVB 3U6KA 3THYB 5JLJA 1Z6GA 3BIFA 3S1AB 3EIQA 3QXXA 1BMFA 1NG9A 1ZM7A 1VECA 1R8QA 4IVQA 3NG1A 2JGNA 1EFUA 2VNIA 2QGNA 5EXPA 3UKDA 3FHTA 4G1VA 3W6OA 2IS4A 4JL5A 2I3BA 4G1BA 5H70A 1W0JD 3SU8A 4ZDIA 4U00A 1JAIA 2MSCB 2ZRHA 5BWMA 4JT4A 1CNFA 2O0KA 4URXR 3L0SA 1J70A 4PAOA 1J8YF 4LYHA 1SKYB 4UNPA 5FUXA 3U3KA 4A36A 5KSYA 2A78A 4D80A 2J7KA 4AKGA 2H57A 1HQCA 4YMSA 1NVXQ 4Q4AB 1QHSA 1T8UA 4LSGA 2NOAA 3GCGA 1E96A 4YDHB 3TQCA 3DDCA 2PLRA 3A1UA 3NBXX 1IOZA 3IDQA 3SJBA 1OSNA 4BPRA 2EU8A 1XRJA 2UZ3A 3C8UA 1SVKA 5E7JA 1I4DD 2ZS8A 1W4AA 2IXGA 5CDFA 5IHPA 1LNZA 1H65A 3W5IA 2ZR9A 1BMFD 1YU9A 4LRWA 2IW3A 2QU8A 2RHMA 2FFBA 1TQ2A 2Y8EA 2IEYA 1GVHA 4MDEA 1FRNA 4B47A 1S1MA 2V54A 1JQLB 1KSHA 2R8RA 3KTAA 3SYLA 3U5ZB 2AR7A 2VRWA 3TIFA 4JYCA 2CLSA 4L5BA 5EE3A 3AVXA 2ZITA 1L7VC 1AMOA 2ORVA 2FPKA 4UNRA 3B1ZA 3GLGA 3I73A 4TSFD 3I55B 4XJXA 3CPJB 2PZGA 4LWZA 1G7CA 1KY3A 4PAQA 1BQEA 1ZD9A 2EYUA 4W5HA 3IQXA 3WRXC 3TUZC 4QHYA 5CIWA 1W2BB 5C2JB 2RC6A 1Z0JA 3B5JA 4WQMA 5AUNB 5JJKA 1E0SA 2QTHA 4BE7B 3AP1A 4OI0A 4XWOA 2HCBA 5KYKA 3SN6A 3GLFA 1NBME 2ZVQX 2EW1A 3K70C 5HZKA 1A2BA 4YC7A 3PJRA 1RRGA 2ZI7A 1VG9B 3AVTA 5EP3A 2PZFA 5SZHB 3GMTA 3WXMA 3H84A 4ZV4A 2GA8A 3UPUA 3VR4A 2HXYA 5CITA 4YONB 2QN6A 1N6RA 2QEXB 3LFUA 3QG1A 4TMTA 4QKQA 2ZRJA 2ZYUX 4JLAA 5TXGA 3CR8A 3EWAA 4PFSA 4LPSA 2CK3A 5EXSA 3CC2B 2ZXUA 3QKSB 4B2IA 2XX3A 1LVGA 4JJKA 3SJZA 2V1XA 2VZLA 4GMXA 2ZEJA 1TADA 4LHYA 2HJVA 1K8RA 4BLRA 3DMDA 1KIMA 4AKHA 4AK9A 3ASYA 3JVVA 2ZI6A 3DO6A 1YR8A 2NO7A 3W2HA 1NVVR 3Q8XB 1CTQA 5E3HA 2QSYA 2J7PD 4AWXA 3QNUA 1BX0A 4II7A 3TK1A 1N6HA 2BJWA 3DEFA 2QPAA 1YZLA 3Q72A 5BQ5A 2H16A 3NBYC 5GVRA 4FCWA 4CW7A 1FNNA 5KTYA 3FHOA 4UQOA 3VU9B 4IFEA 2D7CA 1U0LA 3KKOA 1OXXK 5J5CA 3ICQB 4M53A 1ODFA 2OK7A 2BIFA 2QAJA 4IDHA 2OT3B 2J1LA 3B7GA 3RABA 2GPJA 3LV8A 2ZR0A 4KYUA 4NU0A 4TYPA 1FDRA 5JSZB 4HE6A 4L9WA 2C96A 5A4JA 1VTKA 2WPDD 1GAQA 5C18A 3CXCB 2D2FA 4Z51A 4U9UA 3FOZA 4IDQA 4Q1AA 2WJJA 3NTUA 3N5CA 4TL9A 1P4SA 1A4RA 2O8EA 2X3UA 1VCMA 1KMQA 2IA5A 4DUGA 1D2NA 3ZBTA 1II0A 2WWFA 3AEZA 1VG0B 3R8CA 4FMCF 1RRCA 1AA9A 3ZIAA 3QUSA 2WTUA 3V4FA 1TNDA 2CDNA 3OFND 1R0ZA 4WZ6A 3O8RA 4JZKA 1RYFA 1SVOA 1XE1A 2WZQA 2JJ2A 4NCIA 4DQKA 4Q9HA 1M2OB 3U4QA 5DN6D 3KQLA 2EWWA 1EP3B 5DHAA 3GFTA 1AGRA 3CONA 1VQ5B 3ASZA 3P32A 3GEIA 4Q47A 4Z1MA 4AKIA 4AF6A 5B30A 1YR6A 3IIKA 2F43A 4GFDA 1N6NA 4QL3A 4BLTA 2VTKA 5BN4A 5K8UA 1KO4A 3L2OB 4WVFA 1VHTA 2A5YB 1T8TA 2CJWA 1OB2A 2REBA 2R9VA 1AZSC 1GRNA 1CJTC 1YZUA 3UXMA 4HB2A 4H1VA 2CCGA 4WZBE 5TDHA 1TUIA 2A30A 2FV8A 3KL4A 4DHEA 2BKUA 1O87A 5GJBA 4TMVA 2YC4C 2CL6X 5THXA 2RGCA 2ANCA 1E2IA 1OFTA 3QOFA 5A5GA 4DB2A 4V0MA 1Q81D 2OAP1 1G21E 2RGGA 1J9ZA 1Z0AA 4QGAA 4ESHA 4V0LA 1YRAA 4N3NA 1G1MA 2BF4A 3EPHA 1TF7A 3DVLA 2GZAA 1XB2A 1SXJC 2Q3HA 2ZJZA 3BFXA 3TKLA 4Q1DA 1XPUA 5F2EA 1XTQA 4LJYA 1R8SA 2F55A 3OW2B 2BOVA 2LWIA 4PR0A 4PO1A 1KJWA 5L3RA 3IBYA 5DI9A 1Q7YD 4ABYA 3FJOA 1PVOA 5H5JA 3CCEB 4PTLA 2B8WA 1W47A 1OGIA 4JVLA 4KLZA 1AZTA 1GL6A 2R44A 4CVNA 1QHYA 2RC5A 1G5PA 2A2ZA 2R6GA 1MO3A 2BMEA 2V7QD 3K0FB 4Q03A 4C0QC 4UXIA 5KPDA 5ELXA 1D5CA 4YXWD 2CHQA 1MO4A 1SZPA 4IOJA 5C1BA 5IRCD 3BS4A 5EE9A 5C4GB 1CULC 2PCJA 3JQQA 3C41J 2FSHA 4UNQA 4PHGA 4DB4A 4XWAA 3BB1A 2QPTA 2ONJA 1XEXB 3TQFA 1XEXA 1GKUB 2IF2A 2FU5C 1CS4C 1SM4A 2P67A 2R2AA 1UEJA 2RMKA 3REGA 1KI8A 3K9GA 2Z0MA 2ZE7A 4J0QA 4I1UA 1G8HA 3K0EA 4G01B 2WJVA 5FTJA 5G40A 2IYQA 3PG5A 3VR1A 1AIPA 3E1YE 3RWOA 1Q3TA 1RW4A 5KHOC 1EFTA 2V8OA 2YHSA 3T15A 4EQ6A 1OE0A 3C5HA 4TLCA 3IIMA 3ADBA 4RZUA 1G291 3GJ7A 1QHXA 1TEVA 2CLCX 1CBUA 4A2QA 2AHOA 1UPTA 5G3YA 3K0SA 2YC2C 4RY2A 2GHIA 1C1YA 1W4RA 2BBSA 2WWXA 3BAFA 5KU1A 1M1KD 1UKYA 1Z5ZA 3H4MA 2QROA 1PLKA 5JSZA 3C14C 4GI7A 2ONKA 3CX6A 3WRYC 1F2TB 4PHTA 2AD1A 4TYYA 2JLRA 5J4KA 1CJKC 1TVCA 2OSBA 1Z6XA 1DDGA 4AYXA 4UKDA 2OILA 2G88A 5EUMA 4HSEA 5KUTA 5CM8B 2VQSA 1OB5A 1OXSC 4NCJA 3MFYA 4Q1BA 5FBRB 4ZDWA 1Z0FA 4EPRA 5B58C 3CCRB 1IN5A 3CCUB 1S9DA 4X8MA 2PT7A 3BE4A 1ZVQA 1TQDA 2ZRGA 2CHVA 1ZC3A 4G5RA 4FWTA 4DCSA 1XEWX 1BJKA 2QMUA 3OE7D 4DQLA 4BASA 4DLWA 1WBDA 1AJEA 2OZEA 5J4YA 3KTAB 2GCOA 4OQLA 4RFVA 1XP8A 3EIHA 3T61A 4AF7A 4ZGQB 1XTRA 1GL9B 2CL0X 2NPFA 1N0UA 4M1YA 1HY3A 4TQAA 2J41A 1N5KA 5ANRB 5JWHA 2ZSDA 1B2RA 1WMSA 2CL7X 3B9QA 5CDFE 2EFEB 5DO9A 3EPLA 4M21A 4D4JA 4KSBA 3EZ2A 3KQHA 2B6HA 3K53A 3Q85A 3TVDA 2VSXA 1GM5A 4A4DA 1VDZA 2ECKA 3CM0A 3TSOA 3BBPA 3U4QB 2AKAB 2QL6A 1ZC4A 2WKRA 2GZHA 2BBOA 3KQNA 4TQUS 3TRFA 4Y0VA 3NBFA 2C04A 3RRYA 2GJSA 2Q21A 3QXSA 3OEHA 4PXAA 3AGPA 2O8DA 1QHIA 1QGZA 1E2KA 2Q3FA 2E9SA 2ERXA 1ZIPA 1ZP6A 3I3SR 4JBWA 1NSFA 3GPLA 4IDNA 4BFYA 5G41A 1DG1G 1XFAA 4H1UA 4BRWA 4B3XA 4FMDF 3A4MA 4NCNA 1OKKA 3MRSA 3THXA 5HXBA 3IO5A 3ZS9A 4C0JA 1UDXA 1P61B 2LP6A 4B2LA 3JVUA 4ZGNB 1Q12A 3L8ZA 4P33A 3RNLA 4CYMA 1J8MF 4Q1EA 2C99A 4HB3A 1NJGA 3I5XA 2BMDA 2W0SA 3DKPA 5HR5A 2PEZA 3D7MA 1N6PA 4XH9B 2XNDA 2F1IA 1YR9A 4MGZR 1G9XA 4AC9A 1ZAKA 2JDIA 3BOSA 3DHWC 3IO3A 1Q86D 4M0LA 5FA6A 1CU1A 3D8BA 3NKVA 5C4MA 5GV7A 3FKQA 4QJ4A 1G3UA 1SVWA 2QE7D 4FINA 2D2EA 4HAYA 4RZXA 1QH0A 3QVUA 5GJCA 5J40A 4DLYA 1GAJA 3SQXA 4E07A 4W5WA 5JZVA 2GRJA 5L3VA 4ZO4A 2J45A 2NO9A 2DPXA 2FFAA 5E95A 4XD7D 2O8BB 1DADA 4EFMA 2ZAMA 1KDPA 4IRUB 2D06A 1SQRA 3LWNA 3QEJA 4PZLA 4ASUD 4DSTA 4GZMA 4JKYA 3WBKA 3M4YA 4ZI2A 5J47A 3CC7B 5JWOA 1DAEA 2FEOA 3AQ4A 4N0EA 1SQ5A 4M1KA 4JLNA 3W3ZB 1UFQA 1QVRA 2FJUA 1SVLA 2QE7A 5TMPA 2ZRMA 1S0UA 1TAGA 4JLKA 2JIZD 3DZ8A 3EWSA 2VH5R 3CUEF 4AIIA 2O8CA 2O8CB 4OI4A 4TLBA 1JNYA 4D4MA 3VR2A 3CWQA 2C03A 2BMWA 4FIDA 1Q1ZA 1QG4A 5BN3A 3THYA 3KJGA 3PCRB 1FNBA 2W6JA 3KX2A 2J0UB 2J0UA 1FP6A 3CRRA 4Q4JB 1R2QA 2VYFA 4QJ5A 4Q7LA 3NC1C 1MR3F 3FWYA 3T1TA 4FI3C 2ZJBA 1MABB 3EC2A 1II8B 4LI0A 1K6MA 2DWOA 3IEVA 3DOFA 4URZR 3RS2A 4B3CA 4D0GA 3PVSA 2CEAA 4TLAA 1ELOA 5EP2A 1Z28A 3AVOA 4MH0R 2P5TB 1KTVA 2GCNA 3VR5A 4N1AA 1VIYA 3TVTA 1QGYA 4P4SA 4K1XA 4QGHA 3L82B 2GVZC 2QTLA 5KO2A 4YLGA 1NVWQ 5IK2A 1T0JB 5JHHB 3IHLA 1CRPA 1SKQA 1JPJA 4DVGA 3MCAA 1Z6AA 4EPXA 1IJEA 2ODNA 2BM1A 5DISB 3SJAA 1SVSA 1VQ9B 2GJ9A 1XF9A 1W87A 3OIVA 4QNMA 3SHFA 4K46A 1VQOB 1R5NA 1GITA 1NN5A 2J59A 3EZ6A 4V03A 1KI4A 2D3WA 2GILA 1E9EA 1P5ZB 1L4UA 1W34A 2FFQA 2IYUA 1UEIA 2DHRA 3SBDA 1XD2A 1ZU4A 2O52A 3P20A 1N5IA 1RC8A 1QUFA 4NYMR 4HLDA 1Z2AA 4GRAA 3HPRA 2H7VA 3A4LA 2Q9BA 1NJFA 4WAUA 2QBYA 2EFHB 3P1JA 2Z4SA 3AVVA 3MWLA 4MYCA 4Q21A 1K8AD 1JR3D 2LKDA 3K09A 4DDVA 4F93B 4TMXA 4XWKA 4ZI3A 1WRBA 4TN1A 1MH1A 4R9UC 4DCNA 2OTJB 1CJUC 3GJXC 1VCNA 4G5GA 1ZYUA 1IBRA 4Y7CA 2BDTA 3PEUA 1ZW6A 2X8AA 2PT5A 2XNJA 1LS6A 3QIAA 1Q20A 1U9IC 3QKRA 4Q4HB 4L8GA 1MV5A 1W4CA 4KFSA 2G3YA 2OFWA 2N46A 1MABA 2OK8A 1JEEA 3B1WA 1GWNA 3AP2A 1GNQA 4M1OA 3HU3A 3S1AA 3M6AA 4A2WA 1VQLB 2G9NA 3KXIA 2CMKA 6Q21A 4CGZA 4FMBB 1XCMA 2IL1A 1G41A 4MRPA 3C5CA 5GV8A 5E7MA 1CEEA 1Q1BA 2OG2A 1P6XA 2PX0A 3KKMA 3P4XA 1G5TA 2CXXA 4IOLA 1LFDB 4C7OA 1EWRA 3LVRE 5AJXA 4BGDA 4M9QA 3UANA 2QQ0A 4TTQA 4ZIRA 1X86B 1W7AA 4I99A 2P2LA 4KJZA 3B82A 2SHKA 2UZIR 1ZJ6A 1OGJA 1AS2A 4PPGA 5FR2A 4PO8A 2QORA 1XMJA 2G0NA 1W0JA 4B75A 1YIJB 4JL6A 2VLIA 4EJSC 4U7DA 2OE2A 3SEAA 1G8FA 1ZCBA 3R7WA 1G6HA 3I1FA 1QX4A 2C9CA 1Y63A 4MGYR 1Z29A 3OZVA 1XCPA 1II8A 3REFA 3EC1A 1RRFA 1XD8A 1OXTA 1P2SA 4EPYA 1H85A 3P26A 2VP2A 1XMVA 4BZPA 3ZLJA 1R7RA 2IHBA 1GZSA 2B21A 2WKPA 1LF5A 1VHLA 2H18A 3T1OA 4IDPA 3TW8B 4C0LA 1FOEB 1KMHB 1WXQA 1NNEA 2O0HA 3Q9LA 4MYTA 1GG2A 3QVVA 3K0AA 1IN7A 4S35A 3THOA 1Z0IA 2G83A 3BK7A 4NP6A 3ZJYA 1W4BA 2ZJ8A 4TSFA 2Z43A 1HA3A 1NMZA 4OHWA 1GP2A 2W00A 5KNCA 4LYJA 3CZQA 3HR8A 1E6CA 1KRHA 2BHRA 5LB4A 4TMWA 2DETA 1F2TA 2FMXA 3LW7A 1G4AE 1M7HA 4B74A 5HCIA 5CYPA 4R71A 1VQ7B 5DN6A 4PO9A 4PC3A 2QY9A 4DBLC 4ACBA 3LXRA 1HQYE 2QNRA 3CKLA 4NTZA 2X1VA 2BVNA 4V0KA 2ZRDA 3ZQ6A 2BBTA 2J3EA 3L8YA 3K1JA 1PJRA 4LJAA 4D4LA 1IHUA 4YMTA 1GKYA 4A0FA 4B32A 1W0KD 2XB2A 4D81A 5FOVA 4GOJA 4XOIA 2QI9C 4B6FA 3IEUA 5L3SA 3AV0B 2V3CC 2QMEA 3LAWA 5DI3A 4KVAA 1R4AA 4IJMA 3SHWA 1DOAA 1IXRC 2QGZA 5KPJA 2HDNB 3TH5A 1U94A 3QXCA 2ZYVX 2R6FA 5FUWA 1KDRA 4UXJA 4HAZA 1G5RA 4BFUA 1GFIA 1GJRA 1V5WA 3I32A 4KXFB 5HE8A 3X1XA 1NLFA 1BKDR 2IYRA 4YAOA 5JRJA 1XJCA 1SXJB 2ZI3A 2YV5A 1NN0A 1UBEA 5LB2A 3PUZA 1QUEA 3W6PA 3FFAA 3UMRA 1RIFA 4BUJA 5HPYB 3QPVA 5K8LA 3AH8A 4FWIB 1VQKB 1OT3A 3TBKA 5CK4A 2QUZA 5DIFA 1Z63A 5CM9C 3RC3A 4LCBA 1JJ7A 2F7SA 2XOKA 3R8FA 1E2PA 3RSOA 3GEEA 2IX3A 3THXB 3CLVA 2C9OA 4TWZA 5CLLA 1FUKA 3BD9A 4QRHA 4G5OA 5L3QB 2KSQA 1ZIOA 3EZ9A 2GZDA 3ZDQA 4M22A 5FR1A 3WBJA 3QF7A 3P27A 2GK6A 2IBMA 4HEJA 3W6NA 4C2TA 2FPMA 2ODEA 1YR7A 2CNWD 4F4IA 1FX0B 1W49A 2NIPA 2KBEA 3IIJA 4Q5IA 4NONA 1PZNA 2ZROA 2VF7A 3QPUA 3J81k 4A1FA 4IVRA 1TQ4A 1QHHB 1XMIA 3FKSA 4AG6A 2EWVA 4F38A 1S2MA 4WXRA 2ZJOA 5KNBA 4C3ZA 3MLEA 4Q1FA 2OEPA 4TMKA 5IK2D 5J4HA 3DM5A 3R20A 1T6NA 3RS4A 4C0AC 4LJ6A 2WSSD 4LDJA 1A2KC 4OQNA 4X8LA 2YKGA 3PEWA 3ADKA 4Q9KA 1E9AA 1H8ED 1EFHA 1DBSA 5F9HA 2D4HA 3KB2A 1J7KA 4KFUA 1KI7A 1QHHA 4V0ME 3KKNA 3OAAA 3Q3JB 4RD3A 5J4VA 3LX5A 1C9KA 3W8RA 1H42A 2WMOB 1NJID 4RD1A 4ZDKA 3FTQA 1AM4D 3U3OA 3ZVMA 2J46A 5EXXA 2J87A 5FPTA 3CCSB 2WIBA 3BRWD 3GJ0A 5B2ZA 4MKGA 5A0FA 4LYAA 1U99A 2F3RA 3OE7A 3CNNA 5CLQA 2VA8A 1HUQA 2FZ4A 3AGQA 2QSZA 4QJ3A 5KSWB 3U7GA 1HV8A 2QDXA 3O47A 1N25A 2A5DA 3KZ1E 3NC0C 4L4UA 3L43A 3RRMA 2JA1A 4JLDA 1DO0A 4OQMA 3SZRA 4PQFA 2W58A 4Q9LA 4NE2A 4POAA 4OHXA 3SJCA 5H59A 3QKSA 4HLUC 3NDPA 1EP2B 1E9BA 5FL7A 4EQ6B 2XZOA 4ILEA 5DHFA 1GTVA 4QBHA 3JZAA 4EIWA 5HCNA 4ERNA 5IF9A 2ZRKA 3QF4A 2CBZA 3MSXA 2Q9AA 5JFGA 3BERA 2P3SA 3W2FA 2YOGA 3OZUA 3RRZA 2F43B 1FTNA 4QHSA 4Q4LA 5AN9A 2DERA 4GBMA 1XD9A 4JLOA 5JHGB 2QTZA 4YMWA 4C7OB 3EX7C 4ZCLA 2IXEA 3LO8A 2VEDA 3P4YA 4KFRA 2IWRA 1ZUNB 1M1YE 3ES9A 2OBMA 1DAKA 1DG3A 2YNMA 4GP7A 4WXPA 5AJVB 2I4IA 2V7QA 3GLFB 1NSTA 3KB1A 2PH1A 1G3MA 1M8PA 5H68A 3PXGA 4OHYA 3K0CA 1COWD 5CYOA 2O5VA 3CBQA 4PZZA 3U44B 2V1UA 1G7RA 1XWIA 1SXJE 2RGNA 3C7KA 1TF2A 1KK2A 2Q3MA 1E32A 4JS0A 3G6EB 2FPLA 2RAPA 4EFNA 2DWPA 1E69A 2HT1A 5KDDA 2J0QA 1JR3A 1KI6B 2UVQA 3VR6A 2G0TA 2ZUBA 1YHNA 3E2IA 3QEOA 4U02A 1A82A 1JJVA 2AXPA 4C0KA 3O8BA 3U7EB 3B6EA 1YZKA 1HH4A 3LY5A 1NLZA 3CCLB 1DAMA 1U8AA 4KI0A 1WBBA 4KITB 1KDTA 4HUQA 4B3FX 4DRZA 2ZAOA 4QNRA 2CK3D 2FNAA 1SULA 2X77A 4C0HA 3KJEA 2H92A 2EQBA 1RVDA 3VR3A 3SR0A 2BMJA 2IEZA 3B85A 1E79D 2XAUA 2GTPA 2JLXA 3TSZA 4I81A 1AK2A 3WY9A 2XITA 1YJ5A 3R7WB 4DLVA 4ZCIA 1G3QA 1XTKA 1OLOA 4BZXA 3GLFE 5GJVC 3CX7A 2LCFA 1ETUA 4KSCA 4DLSA 2AFIE 4QGFA 1E98A 4M4SA 1FNCA 1KKLA 1E9CA 4OKSA 4DWJA 2NQ2C 1RRPA 4IOKA 2ZJAA 3U61B 1U98A 1T9HA 3LBNA 4LV5B 1OJLA 3ZIAD 1D8TA 3AUYA 1Q1QA 1TU3A 4LJ8A 4D26A 3A1WA 1S96A 5DE3A 2OTLB 1OW3B 4RD4A 2E1RA 2NZJA 4B33A 4G1UC 4M9ZA 4F91B 5L8VA 1JBKA 2ZI5A 3KXKA 5DI3B 1J90A 4OJQA 4OI1A 1KI2A 5JEDA 1AKYA 3GJ4A 5UKDA 4CT4B 4RCYA 4FCTA 1GO2A 4KAXA 2OO7A 5JI3E 3AUXA 4KBGA 1CR0A 4RKEA 2AK2A 1U81A 1VG8A 4QC2A 5SZJA 8OHMA 4D0LB 2HYDA 2GXAA 1W5TA 5KOYA 1UM8A 4DCVA 2AX4A 4OHVA 3CF2A 4RJLA 1OYWA 1EXMA 1KI3A 1XDBA 2BC9A 2VNHA 1JA0A 4FK8A 1KC8D 3SQWA 4LJ4A 1XX6A 2GESA 2ORIA 2VHCA 3L0IB 2VPPA 4CT5A 2G6BA 1FMJA 3SS8A 2XNSA 3WHKA 1GUAA 5BN5A 1LV7A 2BGJA 4G5QA 4W5JA 3GFPA 4PQRA 1N8RD 4IXMA 1E4YA 4HLQB 3BXZA 3CF0A 1WE2A 5CB6A 3FVQA 3HYTA 4YQFA 2ZRBA 2V55B 4JIMA 1EFCA 2ZPTX 3TSWA 1Z83A 2IHYA 1P73A 3TR0A 4UNNA 2BPOA 2CE2X 4Q4AA 2FE4A 4KLNA 5L3SB 1X3SA 2LKCA 4NKRA 4MITA 4U5XA 3VHXA 4HZUA 3KFXA 4A15A 3TE6A 4HE5A 1JR3E 4MA4A 2N42A 2IYSA 3MAAC 1KO7A 1S9HA 1QVFB 1OIVA 2ZRNA 1F5NA 1JB1A 1VMAA 4MRVA 4D0NA 2ZE8A 1TPZA 3ONWA 4B76A 3W5HA 2BV3A 2C8VA 1D6JA 1RFLA 3OZXA 1E2GA 1KZGB 4AYWA 1KOFA 1U8ZA 5JRZA 3UWOA 1NBMD 3BH6A 2HUPA 3W8NA 3TR5A 4MRNA 2NTYC 5FTKA 1E0AA 1S4QA 4BQSA 3LBHA 3VNUA 1T91A 2HMAA 1YZQA 3QJYA 5BXQC 3CD6B 1ZINA 1IXSB 2XNCA 2KI5A 4RKFA 3DKVA 5G53C 1LS1A 3MWYW 2QEQA 1ZCAA 1XXHB 5IDVA 4AG5A 2ZREA 4F7DA 1CRQA 1E1RD 3A1VA 3ZVLA 2DFNA 1GVNB 1QDEA 4O0MA 1KO1A 2ZE5A 2TMKA 2FGKA 4JT2A 5FBWB 1UKZA 2OLKA 2BGIA 4FXPA 4CIDA 3U2QA 3LBIA 2D62A 1BX1A 3D3QA 2OLJA 1XCGB 4QM6A 4LBZA 4ZCMA 3FE2A 3OEED 2GXQA 1KSGA 4HYYA 4RCZA 3E1SA 4JBXA 4AYTA 3AVWA 1FQKA 1N3BA 2HEIA 2ORWA 2IYLD 3W3AA 3UATA 2GKSA 2WSSA 4TLDA 1CJMA 2ZANA 2HJGA 2EFGA 2ZRFA 2ZRIA 3WP1B 4C0BA 1FW6A 5G3ZA 4YAFA 4DLZA 1NBMA 2REOA 2CVFA 2IYZA 2C95A 1XXHA 4RZ2A 4F92B 4MUBA 4E09A 5AJZA 1A1VA 4M9XA 1IY2A 5FPHA 4LOAA 2GF9A 3LLMA 3W90A 4CEIA 3EIEA 3U7HB 3X2SA 2IYYA 1G8GA 1W48A 3RLFA 4EH1A 4GNKA 4JVNA 3EAQA 5HKKA 4JSYA 4MKIA 1P7CA 4DEXA 2IS1A 1F48A 1U0HC 2GEUA 4Q66C 4DLUA 2QZ4A 3BC1A 2RGXA 4NYIQ 1AGPA 3OJWA 3AKCA 2Z6VA 5BYKA 4PGOA 2CRVA 1COWA 2IUTA 3RS3A 2FG5A 3GJ8A 3SFZA 2VYQA 1KI6A 4TL7A 4A6XA 421PA 5EJEA 1TLLA 1TUEA 1QF9A 5FOTA 1F6BA 4B34A 1NRJB 1CIPA 4A0RA 3PUYA 2QPOA 2BEJA 5FPYA 3THWB 1YZGA 4HB0A 5TR9A 5TVKA 3BH0A 4NBSA 3MUFA 4GMDA 1ZMXA 2GJAA 4YDSA 4BEBA 3LD9A 4MGKR 1M90D 3GLHB 3IKJA 2FF7A 3RRNA 4PC7A 2FFHA 4RFSB 4BFWA 1HYQA 3A4NA 2JLSA 3LO5A 4P4SB 3A58B 2IYXA 3A37A 4URVR 1E3MA 2F9LA 5EP4A 3HP1A 4DSOA 5KSZA 1S72B 2XXAB 3RANA 5F98A 4CDGA 1D9ZA 2FN4A 2FA9A 2NGRA 2OHFA 1D1NA 2VIIA 3H2YA 1ZM4A 2A5FA 4V02A 1TX4B 5FOXA 2GCOB 4FMDB 3I62A 4MRSA 1VIAA 4LK2A 4Q4JA 2ZSEA 3IQWA 4HUQB 3ZS8A 4KVGA 3MMPA 4MKHA 5FTMA 2OBLA 4GL2A 1M74A 2QP9X 2EIXA 4ON9A 4NYIR 3T12A 2HLDD 4KCGA 1G8PA 4A6PA 2GCPA 4HLUA 1N6LA 1VCOA 1GILA 3JZMA 3LVQE 2OM2A 2W83A 3GLIB 2WWWA 3CCQB 3BB4A 2RHDA 4PPQA 1NG1A 1DAGA 1OHHA 3KXLA 3LQRA 1EWYA 2R62A 4Q00A 5EE1A 3CCJB 4B2PA 3RVBA 3MJHA 4RD6A 3FKSD 1XPOA 3VNVA 5CJPA 2ERYA 4Q7KA 3B2EA 4G0NA 4Q7MB 3QQ5A 1VYTA 1YITB 2XJ4A 1VKJA 4YMVA 2RGEA 1R5BA 1NY5A 2WWGA 1K5GA 1NF3A 4NYMQ 4X8OA 2WOJA 3LRPA 1I4TD 5AR1A 1DEKA 2YWFA 1T3SA 4TT3A 3WYFA 3LQQA 4HAVA 4N0DA 4LC0A 2H17A 4UAJA 2OXCA 4B73A 4LBYA 5KSOA 4W7SA 2VSOA 2FDCA 4EAQA 2FSFA 3MJRA 4JBYA 1L2TA 1W5SA 3U44A 4XVQA 4HUTA 2HYIC 4Y9RA 4KYIB 2P65A 3KUDA 2BM0A 5FOUA 4TQ9A 2QM7A 3WNBA 1LB1B 3ZC3A 1OFIA 1VCIA 5DLQC 3U3RA 3GEHA 4QBIA 1YJWB 4KODA 4GOKA 1JEDA 1SXJD 3KUCA 2PX3A 2WJGA 1KSFX 2VSFA 2PJRA 1QFYA 1D9XA 2OXRA 2DYKA 4QGGA 1E9SA 2QAGA 1KJZA 2J7PA 2JLYA 5CB8A 1II9A 2O0JA 2WPDA 4NZYA 2OBNA 1JJ2B 5AUPB 1NDHA 1JXOA 4XTRA 1UBFA 4LJ7A
chains in the Genus database with same CATH superfamily
4BWGA 4LYGA 4BQEA 3U3DA 3P9NA 5K8VA 2RK4A 3VO2A 1UK4A 2YMSC 5CLGA 2MSDB 3QKTA 1EVYA 4I50F 5HK9A 4Q82A 1NWCA 2J3DA 3AFGA 4Q48A 2ANWA 4UBLA 1DL5A 3LQ6A 5AVZA 2RHRA 3QVMA 1WXHA 1W30A 4ZCSA 1KAGA 3OX1A 4ENTA 3P2IA 1WAYB 5EMHA 1AQIA 5LQKA 3FBWA 4LHXA 4IPTA 1O95C 4Q7EA 2P9FA 1MD8A 4JYBA 1XMSA 4ZOLF 3TNYA 1BLIA 1SL3A 2XMQA 1IOEA 4G1MB 1V1RA 2W3KA 1PCXA 4TXMA 1ZICA 4RIEA 4J43A 4K9MA 3CSUA 5CFMA 5K0CA 4M76B 3AFMA 3BXPA 4OYYA 1WXGA 2I9KA 4BX8A 4N7BA 1NZDA 1NNSA 4DMKA 2EDAA 2TGTA 3SC4A 1A7JA 4MRRA 2DCMA 3UK1A 2CLOB 2JGIA 1VE1A 5IW8A 5JS8A 1A9SA 2H5EA 3MWKA 1G60A 2QMHA 5ALHA 2OV3A 3ELBA 1Z8FA 3GT0A 4TVOA 3SSNA 1L8QA 1LTHR 5BV8A 2HLDA 1TUBB 4ODIA 1RM3A 3O21A 1W46A 4FOSA 1BFDA 1GGKA 2AEMA 3K4QA 1HZZC 1B73A 4UJ5A 2WHRA 1GA1A 2O7VA 2CV1A 1NJ8A 4B1FA 2FEPA 5ETJA 3VMFA 4E08A 4WY3A 1KTIA 4GS5A 4RTNA 3B1XA 3U19A 2BTEA 2VJIA 4EENA 1KYYA 2E5WA 3OHSX 4XD7A 2AN9A 3ELUA 2SICE 5DTQA 4TUYA 2BR5A 4ZYWA 1NFFA 4JBIA 1JSRA 1HYBA 3L7JA 1J49A 3V00A 1W5AA 1J2JA 4QBTA 3B38A 2PM8A 4PX9A 3T7DA 1BVYF 1E43A 3ZR4B 2IFTA 1QM5A 3EC7A 3M3DA 4KV9A 5JD4A 3EQ9A 4BAMB 3RYHB 1OH6A 1JX6A 1AO0A 4XLLA 4LHWA 5I25A 1Q84A 2D13A 4BYMA 4CODB 3VHXB 4RSPA 2OXIA 3G4SB 4OVKA 5CD1A 1NY6A 3U98H 3PEVA 2BSAA 3IYLW 3N2EA 3QVGA 4MWEA 3GQBA 3AHGA 1OIWA 1P3DA 3FYDA 2HQOA 5J43A 1FP7A 1P39A 1P0PA 1SVMA 2AOUB 4XD2A 4J7CA 1P2BA 3OQPA 1YIDA 2C93B 1JEQB 2GNOA 3DNMA 4NOMA 3RBAA 2R5NA 4DREA 3RVOA 4D9NA 3P9IA 1R6AA 4MW5A 3SX4A 4F9TA 1XZFA 4UEWA 3NOOA 5FPPA 1E62A 2G55A 3NGXA 4PZAA 3G71B 3RWBA 5BT9A 2XH8A 2CF5A 1K2I1 3Q3EA 1UANA 3KEOA 2ZFPH 3HP7A 1V7PC 3ZOZA 4DIKA 1PT5A 5CU7A 1G55A 2RAUA 5KNBH 5EMNA 1YDMA 2WAXA 5KC8A 3T62A 5IC5A 3SOPA 4Y2SA 3PDCA 2PX2A 2OXFA 4B9AA 1TZKA 1QRAA 1GA6A 1ZM2A 5FP0A 1T3HA 4U3JA 4YREA 3QHAA 3D26A 4MGIR 3UAYA 4TLEA 1WSRA 4DILA 1CQXA 2B8NA 4C4RA 1MTNC 4M2LA 3KETA 3DUXH 2OCAA 3MXTA 3P5SA 4RPGA 2W6JD 2GN2A 1UXOA 1A04A 2Q2WA 4DC9A 4DLBA 4X1IA 1N1GA 2MYTA 3M82A 1M2NA 3GRKA 3EQ7A 1KQFA 1M2EA 5E4FA 4QU9A 3HPTB 3W5JA 2C8YB 1V8ZA 4BNWA 4R8KA 2FW7A 4NPHA 2I66A 2O5CA 5EXTA 1VHWA 2R65A 3OZRA 4EJ6A 1Z22A 4RV9A 3MWFA 3H0CA 4ETNA 2YIVX 2A5KA 1ZOIA 1OWJA 2Q4DA 4FB5A 1HC7A 4IUBS 1QYDA 1E5TA 2B4QA 2BFWA 1RHRA 3WLEA 3ABOB 4I4CA 1AHHA 1TIOA 4YCBA 4BTTB 2O59A 2VIOA 5AW4A 1Y3CE 3UNXA 4XW2A 3RYTC 1V4BA 3JU4A 5AD1A 1RQXA 1IZYA 3O7MA 2KBFA 3Q5EA 5ICEA 2FIRH 2H1LA 3MGGA 5HM2A 4JQCA 3PFKA 1I10A 2G71A 1H8HD 4HLCA 1Q3XA 2YL2A 2KHZA 1O5DH 3CB4A 1FPMA 2JG3A 4XKVA 4BLPA 1NM5A 1DU4A 1Z56C 3NFYA 4OA5A 3BH7A 3ZHRA 4ESTE 3FZZA 1IU9A 2R8ZA 5ALFA 3NHBA 5AHOA 5HF5A 3Q3GE 3MF4A 4HI0E 3GI1A 2BFDA 1KLTA 3ZZAA 4BO9A 1EFPB 2IVFA 3ZZUA 1QCYA 3VHLB 3ONYA 5JFTA 4EY7A 4IBOA 1BXGA 3HMKA 1LFAA 2R9PA 2OTVA 2O8MA 2V6JA 3MNFA 3HBFA 2JK1A 1OR8A 5IXSA 5P21A 1DXWA 2A92A 4OX9Y 2BP7B 3SNBA 3D3JA 4UJ3A 3STTA 3EA9A 1J0AA 2Z8ZA 3EPJA 2YJZA 4HMOA 4I86A 4EYQA 4P4UA 2JLAA 2Q1WA 3A6GA 5FBKA 2QQFA 2QR3A 1X19A 1P7WA 1T9KA 1C14A 4P6VF 1FP4B 3AEYA 5AK0A 1LPAB 5L53A 4NJMA 4QXMA 1C4U2 2XCFA 1TVKB 3SC2A 4RDXA 3ZQKA 2ZTNA 2VP6A 2QMQA 3RAPR 5JCZA 3ND9A 4AP6A 1AKVA 2CD7A 3K0CC 3G2PA 5H9VA 4D6PA 4H4DA 5BT8A 3BF6H 1C3OB 4K8RB 2I2CA 5BNIA 4JZ1A 4MYUA 4Z3OA 3WOHA 2Z6UA 3AM3A 4N48A 3OPOA 4ZEWA 2XD9A 2Z9JA 3G05A 5ESDA 4DGJA 1H2AS 4CIAA 3QWHA 4IHAA 4UULA 4UPDA 3QKRB 4LIPD 4A1XA 4J0KA 4UCXA 2J0EA 2QAIA 2PA3A 3UJDA 3GSIA 4YO8A 3T1VA 1PJ6A 4D46A 1ODTC 3RUHA 3QITA 3COPA 5AVXA 4HQFA 4Z4UA 2Y80A 4IYJA 5F1OA 3IXQA 4KPUB 3CF6R 5BW6B 2XZPA 2OHXA 2I6FA 2XI4A 1QB7A 1GFWA 2BGMA 3DMTA 2RB4A 1NRKA 2C4FH 4LV6A 1OLUA 3QBJA 4OHPA 1ZM7A 4BHTA 1FP1D 4JL5A 1A8QA 3SIXA 3IEMA 1J70A 4LZJA 4UNPA 1DKUA 5FQOA 1GYQA 5F7XA 2C8ZB 3LT5A 4AKGA 1XNHA 2ZAYA 3H99A 4DG8A 2I3DA 4BPRA 2PPLA 3OPQA 1DANH 3V8BA 3ICPA 3QWCH 3URMA 2BE7A 4NMWA 1Z16A 1NVBA 2WJAA 2XIQA 3R3SA 1X0XA 4EWLA 3I3OA 1QKKA 4QU5A 2CLSA 4E5YA 1L7VC 3I01M 3ER6A 1UZLA 4QA9A 2OO3A 3CPJB 2C2OA 4BKMA 5D1HA 4WQMA 4RDLA 2HCBA 3PQ3A 2ZTXA 3P95A 1ZKMA 2FODA 2HXYA 4YONB 4JUDX 4EVQA 3ZU2A 2VJBA 4M88A 5E2OA 3WGGA 1KIMA 3BG4B 2AUMA 1U0BB 2JAWA 3BG5A 3H9EO 4II7A 4PWYA 3U69H 2A67A 4WLEA 3S68A 3LV8A 2PRSA 2Z6BD 1O54A 3S2SA 4U9UA 5KHAA 1PFUA 3GEMA 3GH3A 1PV1A 5HM6A 2HB6A 3U39A 1RRCA 1RHJA 4XWTA 2YR0A 2R1VB 1GNTA 4NCIA 2EWWA 3UZUA 4KLRA 4AKIA 5B30A 1NPTO 3VR4D 1N78A 4RL6A 3CT6A 3A3YA 1T8TA 1GRNA 4LXUA 3F1LA 2FV8A 3ZNOA 2XMZA 5HHTA 3BCHA 1Q0LA 3MHWU 2RGGA 3R09A 3UQOA 2H3EA 2ZHQH 2PT9A 3WKEA 3M6VA 3RXHA 2WHQA 1CE5A 1Q7YD 3ZTTA 3JASB 1XV5A 2A2ZA 2J9GA 2BMEA 3KSDO 1SZPA 1QZUA 5EE9A 4J0CA 1A5GH 1CULC 1GKUB 1CS4C 1PG5A 1ZMJA 1ZISA 1M1ZA 4J0QA 3ORSA 1DWEH 3RBZA 4ZHSA 1EUCB 3UTDA 1Q3TA 1VJCA 1NVKA 2R6ZA 3IIMA 5J2TF 1FMTA 2YC2C 4ALMA 3U1BA 1UKYA 3UOWA 2YCBA 1YRHA 4QD3A 2JLRA 5DULA 4B83A 4KH1A 4ND1A 3TNTA 3OZBA 4M83A 2OBTA 5B58C 1AVXA 5AW5A 1GR0A 2ZQ1A 1IBCA 4RK6A 1XEWX 3OE7D 2PRJA 2YS7A 4OQLA 4E05H 2VQEB 3CTAA 4BJ5A 1Y5AT 3HJUA 3U4GA 3BBPA 2AKAB 4P8RA 4RMHA 2ZBQA 2PE5A 3TRFA 4OM7A 2OINA 4GI1A 4TYDA 10MHA 4PY2A 1HAOH 1QCZA 4JI3B 2QV0A 1Z18A 1D6NA 3GPLA 5JZMA 3E6PH 5CA0B 2FTKE 1GL0E 5FHRA 1P9OA 4Z7OB 3OTQA 4CBNA 4B2LA 1FN6A 5FBZA 3RHSA 4Y6PA 5J63A 3LBFA 4XH9B 3AHHA 4DLTA 3BOSA 3IO3A 4NOJA 4EHBA 3CSDA 5KEIA 1EE2A 4J29A 4B6QA 3N76A 4ZC8A 1H0KA 4Q3BA 3NUQA 2WG1A 3WV4A 5EW1H 2VBUA 3UAOA 3ONFA 4DFDA 5J47A 1YJAA 1UBSB 3L6PA 4AXXA 4M1KA 4G85A 1UFQA 3DL4A 5GOZA 3DOOA 2P9QA 2BMWA 1SGQE 1QG4A 1F0UA 4QDXA 3KX2A 3D7LA 3Q7RA 3NC1C 2AB0A 5DXFA 3T1TA 2ZJBA 1MABB 4N4AA 2Q3BA 1HIAB 2CEAA 3L05A 4K69A 3AVOA 4MH0R 2JZCA 2GCNA 2IUFA 4IIBA 4QGHA 3UHPA 3VZQA 3U9SA 4Q6WA 5ABPA 5KO2A 5KJCA 1YH3A 3SG0A 1IJEA 2BM1A 4RZQA 3FWKA 4KVZA 5EQSA 3LKZA 1GITA 3OT4A 3TJVA 2GILA 2PBLA 3PD1A 1DX9A 3TJOA 4YROA 5LYJB 3IAXA 2EQ5A 1A7AA 3SBDA 1YS7A 1OX4B 1N5IA 4H7DA 4HLDA 2QVLA 4TS3A 2HNTC 1JR3D 4PXYA 2EBHX 5BN5B 1EFDN 4G5GA 2VVUA 2X8AA 1AY0A 3OHPA 1VF7A 2G9NA 3JWGA 3TFOA 2IHUA 3NFRA 1Q1BA 4QNNA 5AKYA 1P6XA 4I8GA 3CVJA 4CKEB 2PXHA 2XBYA 1PZEA 4M9QA 4KJZA 2ZVJA 5I3ZA 4JL6A 2O9QA 1KJ8A 1G6HA 2BHGA 1II8A 3GT4A 3P26A 5DEIA 4MS3A 4IS5A 2V6GA 1O95D 5B5SA 1KMHB 3H9NA 3Q9LA 1BQ4A 5AQ1A 4XOJA 3BK7A 2K87A 3P9YA 4YRTA 1J16A 5IYWA 2H9EH 1HYLA 2X0RA 4PO9A 2DF8A 4NTZA 3ND7A 2QGFA 4D3SA 2VPXA 4DIBA 1T7CA 5L3SA 2QGZA 3WGLA 2XDQA 3OSUA 3SHQA 3VVCA 2BEWB 1NN0A 1LLQA 2Q07A 1JIJA 3PUZA 4ZVRA 3IR6A 3O8OB 3TBKA 1DLEA 7ESTE 4E13A 3EODA 1OC4A 3KPWA 1ESTA 1GI1A 4NFEA 2DQSA 5LL6P 3RF6A 1OFUA 2GK6A 1YR7A 3OIDA 1K9SA 1DKLA 3IUQA 2R751 3FHLA 4IVRA 3HBJA 3ZE8A 3GPCA 4DEVA 2O8VA 3T4UA 1Z8RA 4JN6B 2O2YA 1LPOA 3GT7A 4RVNA 1RD4A 2PD4A 3ADKA 3I6YA 2D4HA 5LMUB 2OV8A 1QOZA 3QE4A 4RMJA 1H42A 2WMOB 1NJID 4YA6A 1EGQA 1JKJA 4KQIA 2UUBB 3LQ1A 2FXVA 5DTMA 5LP6A 1DVAH 5EJIA 3S9CA 1MQ8B 5JXHA 4HGNA 4RF3A 4LOLA 1T8OA 4G2NA 2M5SA 3C85A 1JMOH 2C4TA 4M6WB 1RQ7A 1P19A 4XFDA 4NZNA 1ACBE 5JHGB 3FFWA 3PF8A 3RCBA 1IVYA 3HLTA 3PXGA 4WBNF 3OZIA 3UFBA 1KAEA 8ESTE 4BTUB 3VR6A 2J3JA 1YHNA 1SUBA 2VTBA 3O8BA 2W6MA 3Q2IA 1HH4A 3G5AA 1ZGGA 2IEZA 2EZUA 5B37A 4C88A 4P08A 3O2JA 4QVGA 1KSNA 3U8OH 5AIAA 1WLSA 1EJ6A 1OLOA 1I9GA 1HSOA 1QK4A 4BZXA 4FX5A 3CX7A 1XU9A 2ZT6A 3RC2A 3FFTA 5DHRA 2CW5A 4IJVA 3M9LA 2UUPA 3A1WA 1MAHA 4B33A 1DFGA 1QV6A 4CMEC 4F91B 2HBRA 1B3RA 1MH9A 1LQUA 2CHEA 3R74A 3I5MA 1FFEA 3NHWA 4Z4YA 2Y5HA 5JAIA 7ADHA 2AX4A 1RKXA 4FK8A 1KR2A 3A4IA 3D0OA 5ICSA 3M1LA 2C3YA 1N8RD 1E4YA 4REQB 5IVKA 2OAEA 1A5AB 1NB0A 1TZBA 1E66A 1Z83A 2BPOA 3O73A 4XM1A 1XCBA 2K1QA 5CB4A 4GOMD 2Z4TA 1FIUA 5CX4A 2GM3A 4FOTA 2D9RA 4D0NA 3BSFA 2VYNA 2Y7ZA 5ITZB 3OZXA 5LOVB 1A95A 5CHAC 4FU0A 2GQ0A 3ETNA 4M0MA 4G0ZA 4S1PA 3WX0A 2FM2A 1QL8A 5BXQC 4Z4SA 2IHTA 2KI5A 3OX7U 2WILA 4LFAB 4MQMA 1I1HA 3AX6A 2F83A 2HRQA 2A88A 2I34A 1FU7A 3LBIA 3QYAA 1ZIDA 2JC3A 3OEED 1NULA 2O8UA 2ORWA 1Q0RA 1RLTA 2HJGA 2EFGA 4L8VA 1SC3A 1WHSB 2EKPA 1I5RA 5KVSA 1X74A 2BGUA 2H3HA 3ZEIA 3BMXA 2G1AA 3IE2A 3D2AA 3U7HB 2Z09A 3AY0A 2NYUA 2QX7A 1S2LA 1F48A 4Q66C 3EW7A 2MYPA 3GELA 2ZUVA 5HGGA 4MVJP 5LLDA 1TI7A 1RPNA 1KXJA 3T7KA 1NSYA 4JYZA 1QF9A 4AWAA 1FFBA 5HZAA 3UJCA 5B53A 1X87A 3L6OO 4GQAA 3STXA 1BA2A 4N3AA 1PW5A 4FFBA 4BFWA 3KOUA 1NE7A 1ZN9A 2Y71A 3TEJA 2KMLA 3A1EA 2XXBA 5CLFA 3V8NA 2VZ0A 4B2CA 3DB2A 4PNPA 3HI6A 2ZSEA 4KVGA 3FOFC 3W5CA 4RF5A 3R6JA 4XOTA 4NYIR 2B4TO 4XM0A 4YT2A 5A5FA 4A6PA 3RY8A 2GCPA 5IKEA 1U3TA 1BTWA 3GLIB 2OG1A 1XRNA 3PTLA 4Q80A 4RANA 3LQRA 5G0WA 3C6YA 9ATCA 3AZQA 4YQEA 3QVXA 2QPLA 3ZCXA 5CD9A 5LWHA 3WGIA 2QJOA 5EWLA 4UAJA 4LBYA 2AG8A 4FOLA 2FWWA 4IMQA 2QXIA 4Y9RA 2WUGA 4KYIB 2ZW9A 1EQ2A 3ZIUA 1S84A 3N58A 1OFIA 4L9AA 3ITKA 5T4FA 2PJRA 3TRDA 4JJGA 2KLHA 1U7HA 1YRLA 3V6LA 1L1NA 3MWEA 4QXRA 2AMVA 5KDLA 2IV3A 2JVKA 4YRZA 8ATCA 3A36A 2ZAIA 4Z0TA 2QN3A 3QTOH 4FILA 3DUFA 4P86A 3MS2A 2VS1A 1DXQA 2HWYA 4WK6A 3IXLA 4PHFA 1HE5A 2V0CA 4N8SA 3T5BA 3H2HA 2NWQA 3H2BA 1LD3A 3ENVA 4L7QA 5KNDA 3GNSA 5AW9A 1QO0A 2XWPA 2G1KA 3TVJB 1C7RA 4I7YH 2DFDA 3A3PA 1NAIA 3I28A 3TJZA 3A87A 5TPWB 2WUEA 1K7CA 5HRUA 2DQ4A 3UWKA 5DW0A 3KELA 1JG7A 4NF2A 4ZPXA 1AKWA 4QBFA 1EP5A 1BB0B 5C7LO 2YMMA 3O4HA 4P9SA 5EQQA 1R4NB 1A5TA 3E5HA 4UC0A 3IGFA 3SUFA 2HM7A 3LPAA 5KQSA 2QNBA 1EESA 4JB3A 1IQUA 1CRLA 4ZAZA 1KP9A 3DPUA 1UP4A 3QLVC 1XVLA 2XF8A 3PYLA 2RI0A 1ABIH 2VWGA 1O2RA 1JR2A 4GX0A 5AVWA 2WF9A 5IMBA 4MYSA 1YBHA 3I2IA 1NYTA 5J2UA 2V9PA 4ALNA 1I36A 4NAUA 1XN4A 1W0CA 4BV9A 3H8VA 1K6JA 3NK8A 1TONA 2OAGA 2IV2X 3MRXA 2JFWA 2X9VA 2G5NA 1V2PT 2EAUA 4DSAA 1YQ9A 1QB6A 2CLHB 3D4LA 3FVTA 3OURA 1EM8A 2C92A 3MCVA 2A5IA 2H51A 3LE8A 1VI2A 4R1QA 3PK0A 4KQFA 3GH1A 5CDTA 4B3RB 3E4CA 4UHHA 3L7BA 3GJ3A 3S2IA 4PAGA 4ZAWA 5J2TB 1BCRB 4ZOLB 1BYUA 4DLRA 5KINB 1JH8A 2MT9A 4KZKA 4P35A 1O77A 1UJBA 1PJLA 1CY6A 3Q6MA 1BEUB 2P30A 3ROMA 1LHEH 2JGJA 3HXLA 3RIYA 2WUWE 1BU8A 5K8TA 1AE8H 1MO5A 3EJ6A 3O38A 1Z39A 4CCYA 4UFNA 3H1TA 1URPA 5GAJA 2G5CA 3QFCA 2E5FA 1OPRA 4MQUA 3DE6X 3VPHA 5A8ZA 1OYYA 2GXSA 2W2PA 3C5VA 3H8WA 4AVYA 2GK7A 4OS2A 1XM1A 1Z26A 3TQHA 2WWTA 4EUEA 1BMQA 3ZY2A 3HVUA 1T4BA 2KJQA 1WMFA 2G63A 3P2JA 1W3CA 1P02A 2BGTA 1Y6ZA 2DFLA 2F1OA 1ZH6A 3KJFA 2P2CA 1UM9A 2PWYA 3CCCA 2JJ1D 4PBSA 5KNCH 4V1CA 1ESZA 2H65A 2VH1A 5A9TA 1HF3A 4MW9A 5GNDA 4P2NA 3LPLA 5CPFA 5BR8B 4IEEA 2ZL7A 4QG7A 2IXBA 4CCWA 1KS2A 4YASA 3WE7A 1T2DA 2EG9A 1N5OX 3ICCA 4DAOA 3FP8E 3DYVA 1NIJA 4J07A 1FW8A 2DR3A 3JQBC 2O2JA 4OH7A 4TYWA 1QRUA 4P4TA 1HE1C 4FD3A 1NU8A 1M2GA 3O5AA 4B0OA 3URKA 4X9XA 5A0BA 3LKDA 4F7WA 2O2XA 3IIEA 4IQ8A 4PC6A 2I2XB 2OD2A 4BY9E 2WBLC 2C2YA 3PUXA 5IAOA 1KY2A 3F74A 3RXBA 1YRYE 1SHLA 4UMDA 2NTEA 4II3A 4ZXYH 4K9OA 3VISA 1GJCB 5C2ZA 3L0DA 5ECWA 4MGEA 1U90A 1N7GA 3IEKA 1PJQA 3VU1A 1PFKA 1ZEMA 1FP2A 4NWKA 1C0LA 3K70D 2QQGA 4BNTA 1N0VC 2ZUFA 1JN0A 3ROPA 5KKNB 1WOOA 4DKJA 1KDYA 5AI8A 4QXQA 2P1RA 2ZJ1A 3T41A 2H9TH 5IYZB 3EMBA 3WQRA 1TQ6A 3L04A 3AR3A 3SC6A 3ASVA 1XKXA 3RI3A 5SYNA 1E1CA 5G4KA 3GWGA 3P70B 1ZA1A 3CW2A 2PRKA 4IZIA 8GPBA 3UY9A 2OCLA 2GFHA 1L4ZA 2FW8A 2JFHA 4FHGA 4HFJA 3FPHA 5BOSA 1P10A 2ZKSA 2DUWA 2B20A 5J5VA 2Q6IA 3OEHD 1BNCA 4QYIA 5LM3A 1DBWA 1ONBA 4QARA 2QTWB 2VP4A 5FBLB 1ZJKA 1RBYA 1RYBA 3ZVFA 1O0CA 3NNDA 3D8NA 4KKVA 4FR2A 1NMEA 1B00A 2JRLA 2NV2B 1RJ9A 4O2LA 3TX2A 3MERA 2JCSA 1UAAA 4PICA 4GZ6A 5EI5A 4LISA 3KR0A 3B78A 4RT1A 1FXWA 1XDZA 1Z6YA 2C82A 2XNHA 2VNJA 3AKYA 2JD0A 5I9BA 4Q39A 2A0FA 3OG9A 5ALWA 2RHOA 4NIXA 3HLYA 1I1NA 1R0CA 2XB6A 5EWMA 1OPHB 2VVCA 4DLNA 2BD9A 2GD6A 4EARA 5DNEA 3DDNA 1BXKA 4YMUA 4PZ0A 3OLZA 5ENZA 1UBGA 3TH3H 4JLMA 4N9WA 1IBSA 4B6EA 3FPCA 5FAHA 3S5UA 3MZ0A 4I9HA 1T13A 1Y80A 5IAGA 3PPIA 2L82A 2UXDB 4IFBA 5HE9A 3RDZA 4CJXA 5H8WA 3U4CA 1G20B 1OAAA 1V6CA 2R4QA 3E9ZA 2AFHE 1BDHA 1H0SA 2IWHA 2AKYA 2J6BA 3B1YA 2P4QA 2JNWA 2SKDA 1KORA 2DE0X 4G63A 4MYDA 2VUTA 1C7FA 4JZFH 3HP4A 3M6WA 4J1SA 1YLCA 4OMFG 4GSYA 4QPDA 1R3DA 2QL7A 3WLTA 2J9RA 4UD2A 3D6UA 4WA8A 1FIZA 5DRTA 2CVHA 1CQJA 2I7VA 2VQ6A 3CVWA 4AO6A 2PUDA 3VJKA 7MDHA 4LRSB 3VV2A 3RT7A 4OI2A 1EDZA 2FX6A 4K5QA 3UJ6A 1EBUA 2N1BA 3R3VA 1YS2X 5EJ4A 4ASUA 1D03A 2XUFA 3W8DA 5BYJA 5JBCS 5CDYA 1NVEA 3V4SA 3A25A 2H7XA 3K71B 5ALJA 4GUDA 5DWQA 1K4KA 4YAJA 1A7SA 4INZA 3UJ8A 2WTEA 1ORHA 1EUFA 3HFSA 1E18A 5FB3A 2UXCB 4MNXA 1OA1A 5C1OA 1YE3A 4DEYA 3OKCA 3VPKA 2O4CA 3G5TA 1PJ2A 2W6OA 4JL8A 2RHGB 3EZFA 4ARVA 3EARA 2IC5A 1O96B 4LY3A 3UHAA 2OXEA 1XA0A 2X8WA 1ZXLA 3DGEC 4EHJA 1IZZA 3JWHA 3THYB 1GHZA 3QXXA 1VECA 5HTOA 3SUDA 3HK2A 1X7WB 4RADA 3P19A 5AW7A 2VTBB 1CY4A 1P31A 4XLZA 3ZEAA 2QL9A 3U3KA 3UXYA 3GX1A 3F0OA 1GLNA 2GCTB 2HSDA 3RXPA 1QU3A 1NPYA 4E70A 4PZUA 4K1EA 3ONEA 1YU9A 1K6EA 3UFXB 2RHMA 1DC6A 1S1MA 4HCJA 3DYBA 1XXLA 2FX2A 3UVEA 2WP0A 4UNRA 4BIMA 5ECGC 3SGQE 4GYWA 2BI8A 2E6UX 3W4JA 1KY3A 3O9MA 4PAQA 3FVFB 1WUTA 3WK9A 2G7MC 2GEJA 4OI0A 3QO6A 3DAHA 3W7AA 1A2BA 5B1SA 1VG9B 2PSJA 5DEOA 2C1XA 3QTVH 2MYUA 2W6QA 1KRXA 3C3AA 5A3JA 2FI4E 4NV3A 2VZLA 5BV2P 2HWXA 1GI0A 5ELLA 4MV1A 4HDRA 1Y9ZA 2G06A 2V7WA 2B69A 5REQB 3E0PB 2JCVA 2OKCA 1GMCF 4FT4A 5HIYA 1N6HA 1I4EB 3FHOA 3I45A 4RL4A 2QAJA 4ZVVA 4WZTA 3N59A 1QNLA 1HCGA 4TYPA 1XVTA 3VZDA 3GY3A 4WLFA 1O5AB 2WJJA 2Q2NA 5C0TA 2O8EA 4IEFB 1T5EA 2Y93A 4K9DA 4RT0A 4FMCF 1XDSA 4BFCA 2CDNA 1OWDA 5BN1A 3KPJA 4EDFA 4XPIA 3RUEA 3GMIA 1VZ3A 1P5JA 3C8MA 5GWXA 4Q47A 5TVGA 1PQYA 4YLQH 5FWYA 2F91A 1OWMA 1CUJA 4X20B 5C67A 3SNEA 1QR3E 2ENUA 4KXXA 1G21E 3B1KA 3LJOA 4HWTA 3OE4A 1UK9A 3DVLA 1XIVA 3MUEA 3OTJE 2YRWA 3DTYA 5F2EA 2RA0A 3AQIA 1UMCA 1CV2A 4PTLA 1C9TA 1RQ2A 1X7GA 3RTCA 5A0AE 2R6GA 5FLKA 5AXBA 4X45A 5H7XA 3BS4A 1XEAA 5JBIA 4XWAA 1H2YA 3DNFA 1IDN1 5DJ5A 2I67A 3LTNC 4JZYA 1CZLA 2O2ZA 4JAVC 3E1YE 1KVRA 1M1YA 4URHA 4XLHA 1UPTA 1AUOA 1ZVVA 3GGJA 3Q3YA 3BAFA 2G9RA 3FTCA 1L6RA 2ONKA 2QG9A 3RVPA 5EQFA 1X7HA 3SHVA 3DT9A 2AFHA 2JVJA 2QRGA 2YQZA 2IZ6A 1QANA 3DAPA 1Z0FA 1HDCA 2SCUB 2FX5A 4KXQA 2DR2A 2IHZA 3I4CA 4TS1A 1ZMTA 1GZ3A 3D43A 3CS7A 5LA6A 3FJ1A 4RU1A 4ZGQB 2X22A 2YFYA 1VDZA 4YJHB 2WKRA 3KQNA 5FUMA 2E9SA 1VB3A 3HXMA 3V1UA 4MQEA 3NO4A 4RJ2A 4E14A 3ZJ4A 4WXMA 4B3XA 4YUYA 2R00C 3ET4A 1XZIA 5HXBA 4B5LA 1P61B 4ZYYA 2R6R1 3PKJA 3A4TA 5IUKC 4WZLA 3DFKA 1G2MA 1G9TA 4BDSA 4Q93A 1YR9A 3JQAB 5IFLA 1G3UA 2IY9A 3TW8A 3QIVA 1H2WA 4HAYA 3TLBA 4YJ2B 2Q62A 3ZI0A 1F5RA 4XD7D 5IJ0A 3AFOA 2FPPA 4BEWA 1XALA 3MBIA 3UH1A 3W3ZB 1E3LA 5K01A 3O31A 1MJ5A 1I94B 2GCIA 2FR1A 1FNBA 3RIXA 1H2XA 1AF7A 4BWFB 3QVKA 2H9AA 1XHFA 3WLPA 1V1JA 4OQYA 2CFCA 1QJ4A 1UPXA 1C3EA 5AXAA 2DR0A 3NYWA 1O5OA 3PTBA 1REQB 4XR9A 1SLVB 4RE6A 1MKXH 4RN6A 1W34A 2FFQA 4E5SA 2JFNA 4D96A 3P20A 1EG2A 4JA0A 3TEMA 3FZYA 2AFQB 1ZJ4A 1XNQB 3PZBA 1W4CA 2OK8A 1DG9A 4IH4A 3FETA 4CMKA 1ZZEA 3WNQA 1UAGA 2V5VA 2IL1A 1KOJA 4AYVB 5E7MA 1SUWA 3KKMA 4WLVA 3LVRE 3W06A 2B6NA 4RHFA 3LLSA 2G0NA 3SPXA 2FOMB 3BIOA 3SEAA 2NU6B 2YN4A 3R7WA 4BNZA 4CMGA 2QF3A 3RFXA 5HVNA 1BH6A 3B12A 3S99A 1Z29A 1XCPA 3REFA 2OSVA 1OXTA 1A46H 4RAOA 1Z25A 5AKGA 4K6MA 2Q7DA 3NORA 5BSGA 2V3HH 4HNVA 5K0TA 3ZOKA 1Z4QA 1PAUA 3TECE 1OFGA 5CYPA 3CKLA 1QVZA 3IBSA 3K1JA 1M0SA 2YNAA 2AG6A 3SHWA 2VIVA 3AM4A 1K6XA 2B5WA 3KZOA 4BFUA 3COWA 2O7NA 4S1TA 1KEKA 3OWXA 4YAOA 2YV5A 4FDVA 1SVUA 2WC1A 3BMNA 2FWNA 5HA5A 5C80A 1E2PA 1SELA 2XCLA 4NE9A 2C2WA 5FR1A 1OOKB 1ZDMA 1HXEH 1D8AA 4IO0A 1ZUWA 3H2JA 4A1FA 2J5UA 2AFRA 3PO1B 3KYFA 1O1YA 4O29A 4AG6A 1L3CA 4OQQA 3EIXA 5EUBA 1QTNA 4F8JA 1GJ5H 1GJ7B 3MJ4A 4Q9KA 1CVRA 2OBYA 3VSEA 3HGQA 4A10A 3TQSA 3EHDA 2E0IA 3BC9A 2J87A 4FUFA 4ARAA 4KZPA 5B2ZA 3MN1A 4IBLH 1TKBA 5ESRA 4KKXB 1QQTA 1Z1IA 2E4AA 4CLEA 1MZAA 1I4WA 2WP8J 3SD7A 4PG6A 2HMVA 5JU6A 5EJ7A 4YEDA 2NUAB 1EXVA 1UBKS 5KZMB 4LQDA 1GN9A 1CDEA 3PIDA 1GBTA 3P4YA 4BNXA 1X2BA 2IXEA 3IH5A 3MUNA 2OBMA 4B84A 5LP6F 3DC2A 5H68A 3G6KA 3H6KA 5HJ7A 2XMDA 1WMAA 5IM4F 1E32A 5FLXA 2DWPA 4HOYA 4FW8A 3E2IA 3H7TA 1P7ZA 3IWMA 4X0CA 3PFNA 4KITB 1SQSA 3VB6A 2ZAOA 1E60A 2C61A 3KJEA 4JZDH 1EUDB 4K9QA 2J3KA 2CWWA 1YCPH 4UZFA 3C2QA 3TSZA 4P38A 2ZYHA 3R3YA 4RTMA 1ECBA 4KOEC 1BW9A 3H2KA 2EL7A 1AK9A 3GP5A 1O3EA 1UKCA 2ZJAA 2A0WA 3GZTB 3DL2A 1N57A 4RD4A 2FSPA 1DTWA 4OI1A 1Z4NA 3GAFA 3KAKA 2HOBA 2C3PA 2XC4A 1Y81A 3F2IA 4EI9A 3UGJA 4IJKA 1NMSA 1CP3A 2H8GA 4P5DA 1H6CA 1OYWA 4BJ6A 1M2VA 4AF8A 1PX2A 2IU3A 4INHA 3DSPA 2BGJA 4TRJA 4JI0B 2LV8A 3CMMA 3HACA 3UWSA 4O5OA 2VJOA 1H3FA 5DYTA 5TCCA 4I32A 4ER5A 4F2DA 4MA4A 3SIRA 2V9CA 2ZRNA 2Q2VA 1C1NA 5KWJA 5NULA 3BY2A 1NQXA 1Y1SA 2CVQA 3FSGD 3AY3A 4RKFA 1MC8A 1O2VA 3DKVA 1YM0A 5HYVA 4RY0A 3T3MB <