4ACBA

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
469
structure length
448
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 97
structure length 448
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acbA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acbA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acbA01
4BEJA 2GVZC 3DEFA 3C4JA 4Q9HA 1XTSA 3WMEA 2B6HA 2BHRA 1EFHA 1T3LA 3E20A 1G3RA 4PPGA 3AF2A 5CYPA 1DAEA 2ASEA 4YLGA 3LVBA 4CEJB 4ZDIA 3CF0A 2XNDA 3HPRA 2IX3A 3DKPA 2IYTA 5JWRA 5EE0A 5C18A 2RCNA 3PQCA 3H2YA 2ZYWX 3ZIAA 521PA 1P2SA 4DT1B 2ZYVX 1OHHA 2ZRDA 1NMXA 1TQ4A 2WWHA 4UJ3A 3GMTA 5CM9C 5K8IA 2GJAA 5CDFA 1JB1A 1ZC4A 1NVVR 4G5RA 3R8CA 3RVBA 4A1FA 1G8GA 3SJCA 3GCGA 3VNVA 5BXQC 1F3OA 2J0VA 2Z4SA 3UK6A 4BLRA 5CK4A 2NTYC 1CJMA 3BAFA 4JVMA 1GILA 1XU4A 2VP2A 1G7RA 4HI0E 2JATA 4DIEA 5AUPB 3ZS9A 3LNCA 4KODA 4HAYA 1R0YA 1SVLA 2GF9A 2LKCA 1G8FA 3AKDA 3HYTA 1E79D 4DC9A 4WXRA 3RRZA 3AF0A 2I4IA 1NSTA 1US8A 2FSIA 2J0SA 3W2EA 4GI7A 2DWOA 2QM8A 3FKSD 1YJ9B 1P62B 1KHTA 4KLNA 4NE2A 3F8TA 4B73A 3W5VA 1YJ5A 1FUKA 1OFUX 1FRQA 1OYYA 1XXHA 2QMOA 2QE7A 4C9BA 1M7HA 2ZI9A 1YZTA 2AXPA 1A7JA 1OIVA 1N5LA 2VQSA 3R7WB 6Q21A 1ZW6A 4M9ZA 3W3ZB 2BBTA 3IEVA 1EFRA 2FEMA 2IXEA 1YZNA 3KXLA 3NDPA 4MH0R 4PHGA 1W49A 2BF4A 3HR8A 4IXNA 4A0HA 4B71A 1E62A 2BMEA 2GILA 5DI3B 3U3RA 3OIVA 3QBVA 3ZLJA 4HLUC 3CW2A 1G3IA 1JPNA 2JAQA 2ZROA 3A4LA 1VHTA 1P9WA 4EQ6A 3FKQA 1N0UA 4ZDWA 3U6KA 2FPKA 4ZKDA 3ZVRA 1OFHA 2NZ8A 5TV2A 3OFND 4B3BA 1BS1A 1S1CA 4B75A 2C5LA 2FSHA 2LCFA 5J5CA 4DCTA 1GFIA 1TVCA 2QT1A 2C04A 2F43B 3GLFB 4DCSA 4HLQB 4MDEA 1MRNA 5CK5A 5AJWA 1AGRA 1XEXB 4JBWA 3K9LA 4MYHA 3CNNA 4K1XA 1GDDA 1NBME 3WHLA 4TL6A 2IWHA 2CNWD 4C43A 5EXTA 2DWQA 3KFXA 3RSLA 1G4UR 4E03A 1ZJ6A 1IN8A 2F6RA 2QN6A 2KE5A 4DEYA 3IDQA 3CXCB 2C2HA 1MO4A 5JWOA 1FQKA 4Q9IA 2ZRJA 3LQQA 4OI4A 4XWOA 2D3WA 4N0EA 4UXIA 2KWIA 1OH7A 5FPSA 2OM2A 1RRCA 5JHHB 1QGYA 1UMKA 4Q02A 2KJQA 5AUQA 2D7CA 1HUQA 3QIAA 2OK8A 1FFHA 2RGEA 4DB2A 4GPTA 3DVLA 1GTVA 2C78A 4WA7A 1B0UA 2IWRA 5SZJA 1T6NA 4TMZA 2VF7A 3K0SA 3WYAA 3PVSA 4F92B 4AG6A 4QM7A 3BERA 4LUCA 1OXSC 2DB3A 1E2MA 4JYCA 2RC5A 2WAXA 5FA6A 2WVJA 3KJGA 3KKMA 3ONWA 3QI2A 1ZU5A 2PCJA 5F9HA 4IRUB 1ZAKA 3LBNA 4OQXA 3OEEA 1Q3TA 4KJZA 2RGNA 3VFDA 3TUJC 1Q81D 2OCBA 2WKPA 5FUWA 4BLSA 1KAOA 5AUOB 4HB4A 4TTPA 3KQKA 2Q9AA 2WBLC 3HPQA 3SFZA 1FNDA 1FMJA 3SZRA 4MUBA 2WIAA 1AA9A 4CF7A 3ADCA 2QPOA 4PZLA 1VG1A 1II8A 2ZYTX 2V55B 4PPFA 4AF6A 1E9CA 4GFDA 4PR0A 1PLJA 5LD2B 4EPVA 1PVOA 2OK7A 1CTQA 3A4MA 1ESNA 5JI2E 5BQ5A 4B74A 2G77B 2JLSA 2C9OA 1OGIA 2N1BA 2BV3A 4O2RA 3UATA 3SYNA 1CKEA 1N0WA 1P3JA 1YZLA 1J90A 1OB5A 2X19A 4PC6A 1T8UA 1Z08A 3O8DA 2J5XA 2ZJOA 1FNBA 4G3XA 4WVFA 4C0AC 1FP6A 3S1AA 2QTFA 2ZR0A 2AKAB 5LDDC 3DMNA 3NEJA 4G1UC 3FKSA 1CNFA 1M7BA 4OHVA 4TT3D 1EFCA 2WAYA 1DAMA 1YZQA 3GLGA 2B5OA 2F1HA 1D9ZA 2FH5B 1GL7A 2PMDA 1DTSA 4FCWA 1GNQA 1SHZA 1N2CE 1NKTA 2OFOA 3Q7PA 4LV5B 2J1LA 4Q19A 2CK3A 3E70C 4V0LA 3WMFA 3U3MA 1E4VA 2AWOA 4I1OA 4BLPA 2XXAB 4DLXA 3W2FA 2V3CC 1EWQA 2PX0A 1LS1A 1SULA 1TQ6A 1XEWY 3OF5A 4C30A 3D8BA 2HUPA 1PUJA 3ECCA 3KJIA 4Q5IA 5KU1A 1XJCA 1XCPA 2R9VA 3GLFE 2UVQA 4PC1A 4JKYA 4B3FX 1KK0A 1AS2A 2ZSFA 4HLCA 5G40A 4LBVA 4OJKA 1UBGA 1KJWA 4OI1A 2WPDA 4JL8A 2ZEJA 2W2TA 3CBQA 1KQSB 3R9IA 5UKDA 2CCGA 1X1SA 3FHCB 1FNNA 4TLAA 4XWAA 5IDVA 3RS2A 1XPOA 4D4KA 4M2LA 4FMBB 5BYKA 1UF9A 1KY3A 2GZHA 3JZAA 3ZQ6A 4U5XA 3SOPA 2OSBA 2ZRBA 1VG0B 2IEYA 2FE4A 5KTYA 4ZIRA 3LY5A 4ZIRB 4URUR 3QF4A 4FWTA 4CEIB 2VP9A 2GEDA 3ND9A 4KXFB 2RC6A 2XNDD 1FTSA 3TUIC 2QTLA 3RS0A 4MRVA 2WIBA 2XZPA 1ZD8A 1EXMA 1QH0A 1UPTA 2VP6A 3QKSB 3KTAA 2VSOA 4HDQB 4MQBA 4R71A 3JVUA 3RS3A 1HE8B 1MO3A 1H42A 2J87A 4Q4AB 2CNWA 1W7AA 3EPHA 2VNHA 3GEIA 2QSYA 2FFHA 4M1KA 2IXGA 1NBMD 5FOSA 3V00A 4KCGA 3THXB 4D2IA 3UMRA 2BJVA 1P2VA 3Q72A 3RS4A 1NL3A 2ZPTX 2W6JD 5J4YA 1BMFD 2NOAA 1HH4A 3BBPA 3EWSA 2YWGA 1JALA 4B35A 2FV8A 1J8YF 1UKYA 1Z22A 5CIQA 2WZQA 5BN3A 1CBUA 4AYXA 3GLGB 3K9HA 2ODWA 5HCIA 5F2EA 1II0A 1SKYE 3FMFA 2XAUA 1W47A 1R5NA 3IKJA 4W5HA 2BPOA 3V4FA 4Q18A 1S9HA 2PZGA 2Z5FA 5TMPA 3MHPA 1HYQA 3MJRA 5HR5A 1G1MA 3ASZA 1S3GA 4OQLA 3CD6B 5JS7A 2HF8A 1QHNA 1S1MA 3SYKA 2CEAA 2BC9A 3M1IA 2WJGA 3RLFA 1TTTA 4C0SA 2A5JA 2KI5A 4D25A 4K8OA 2ODBA 1E64A 5EE1A 2HLDD 5TXGA 3N2EA 4F93B 1MABB 1G7TA 4FMCB 2BBWA 2IHYA 2R2AA 3W8RA 2JDIA 4XWKA 3GJ0A 1G7CA 5JEDA 1Z2AA 3ZD7A 4ZGNB 1E2PA 4RCZA 3TW8B 1XP8A 2Z6VA 1FX0B 2ZR7A 3KQUA 2YWFA 1RZ3A 4NZYA 4M9QA 1SVKA 1LFDB 2B21A 4KLZA 5FOUA 3EIQA 1AMOA 3B8HA 1MH1A 3B9PA 4UQOA 1K6MA 4I1SA 4B2PA 2YV5A 2IXFA 3SFVA 4A4DA 4EPYA 2QNRA 1A4RA 4BLOA 3QFSA 1NVXQ 4CT5A 3BIFA 3C16C 4C3ZA 4GZLA 2EU8A 2OBNA 3EZ6A 3SJBA 2WJIA 3CR8A 5AR1A 4YMWA 3PEVA 5FPHA 3TR5A 1RRPA 5JI3E 1W87A 4UKDA 3HR7A 2J0UB 1XRJA 2W6IA 3CZPA 3WYGA 1X8LA 1Z0IA 2AKYA 1E2GA 1X6VA 1S8FA 3CCMB 1JB9A 4P4TA 4ERNA 2AFIE 2PT5A 2GAAA 3CCRB 1S96A 3U7FB 3K09C 5HKKA 2IL1A 3B1VA 2JLVA 2GVDC 5F98A 1R6BX 2VHUA 2XJ9A 1E9RA 4QHTA 2P5SA 4RD3A 3U60B 5KSPA 2BMJA 3L0OA 4IVPA 4JLJA 3TW4A 1FX0A 1ZIPA 1E32A 3AF3A 3GEHA 4I99A 4DCNA 1QX4A 2FFBA 4IKEA 1XD2A 4YALA 4RFSB 1CU1A 4JZKA 2A3RA 3CCSB 3ZDQA 5JHGB 4Q00A 1YZKA 3CPHA 3NC0C 1VQMB 4LCBA 2MMCA 4BPBA 2JCSA 2WMNB 4AD8A 3W6PA 4G5OA 3B1XA 5DSZA 4D4MA 2ZRHA 3GJ8A 4QGGA 4AK9A 2ZI4A 4EQ6B 3ZGXA 2WOOA 3VKGA 2BIFA 4TSFA 5BYJA 3SNHA 3QKUA 4CEHB 5BWMA 5J4KA 1UBEA 2GXSA 5JRJA 3PEWA 1KOFA 4HB2A 1WB9A 4XSHA 1FMLA 2QRZA 3TMKA 5GJWC 3UG6A 1YR7A 3P4YA 3BH7A 3CNOA 2W83A 1NF3A 4HZUA 5B30A 3QEJA 2GCOA 3PEUA 1GKUB 4PPQA 4JSTA 1XPRA 1SQRA 1V43A 5AJXA 4BUJA 1N5IA 4Z1MA 1A82A 2O8BB 4NP6A 4POAA 1BYUA 4I81A 1SVSA 2F9LA 4F91B 3IPYA 4UAJA 2RGCA 4DRZA 3SBDA 4DJTA 3DOFA 3GJ7A 4I1UA 4G0NA 2OCPA 1YHNA 4B2IA 4J0QA 1J9ZA 5EUMA 5FBRB 2Q6TA 3SBEA 3CRZA 2C03A 4MKHA 4KBGA 2RMKA 1II9A 1YRBA 4CRWB 3TAUA 1RW4A 5A0FA 1FZQA 1CR0A 2ZREA 4PX9A 2KB0A 2REXB 1QZXA 1EX7A 1N5JA 2R62A 2G88A 3RHFA 1H65A 3I5YA 2ZSEA 4KYIB 2EFDB 2AK3A 3L82B 2VH5R 4C0HA 2D4HA 2FZ4A 3GQBA 4P32A 2BEJA 4LSGA 1RRGA 2GRJA 2OEPA 5FR2A 4D26A 4KYUA 1CULC 1Q1BA 2P2LA 1E1QD 1U90A 2FN4A 1U94A 2G0TA 1WCV1 4HE6A 1E9FA 5AWFC 3NXSA 3OIYA 1VQ9B 3NC1C 4GMDA 4Q21A 3X1DA 1AJEA 1OV4A 3TK1A 4M8NE 4RSGA 5P21A 3T61A 3GJ3A 3JVVA 3VAAA 4OL0A 3K0EA 2WJYA 3BXZA 5FUXA 5E7MA 2HCBA 1AS0A 3SDZA 4PFSA 2FNAA 1Y63A 4OK5A 1MRSA 3PIRA 5GV8A 4PAMA 2IYXA 4A9AA 1UAAA 1D2EA 3UPUA 2GBLA 4DDVA 4C4PA 2FF7A 4XD7A 2C9CA 2A7QA 2FFAA 1G6HA 1KSJA 5E7IA 2BKUA 1YJNB 2X8AA 1U8AA 2F3TA 4MKIA 4TLBA 3V76A 3BFXA 2CVFA 2O8DA 4JLKA 2RGXA 2IYLD 3E2IA 3NG1A 3AKYA 1DEKA 1X3SA 2VSFA 4V0MA 2ZS8A 4IDQA 5FTJA 2BMDA 1Q44A 3EIEA 4BQSA 4NYJQ 5KNDA 3WNDA 4JT4A 2CBZA 4FMDF 4PZZA 4L9WA 3P20A 5CYOA 1H8ED 4GOXA 3LD9A 4R2IA 2VLIA 1VQ4B 3AGPA 2QAJA 1CQXA 1J2JA 2OFWA 3C41J 2WHXA 1E6CA 2JLQA 3KJHA 5KSOA 2YWEA 4ACBA 2WWXA 1R8SA 2ZI6A 4V02A 2GTPA 5TDHA 1ZBDA 1W44A 4Q9LA 5FTNA 4XSGA 1I2MA 2X1VA 3LBHA 2A30A 1II8B 4JLMA 2EFEB 3QXCA 2BM0A 2G3YA 1KI2A 3QFCA 5IRCD 2WWYA 1I2DA 1ZCAA 2BJWA 4PQRA 4BGDA 1ODFA 2VHJA 3GFPA 3MFYA 2CHVA 4ZI2A 2ZRFA 4HB3A 1CEEA 1RJ9B 1NBMA 3NH6A 1WBDA 4V0ME 2H17A 3FGNA 3GLIE 4TN1A 4RZ2A 3LAWA 4BWYA 2QROA 2R6DA 3F0TA 2XSZA 3OESA 2VP4A 1G4AE 3RYTC 4Q4HB 3GP8A 4OQNA 3EC1A 1KJYA 1E98A 2KBEA 3H4MA 1DE0A 1XWIA 4WBSA 2RGNC 2QAGA 2ZJ5A 4WZAE 4P6VF 4FK8A 4H1VA 5J4LA 2A2ZA 4M4SA 3I32A 1JEEA 2OFXA 5KSYA 3K1JA 4QNMA 3QFTA 4QJ5A 4WZ6A 3TQCA 1QVAA 1BYIA 2BN4A 1KZ7B 2WICA 4XVRA 1ONBA 5DO9A 2QRNA 1P4SA 4HB0A 5JCZA 1UBFA 1MABA 5AN9A 3RSOA 4NYMR 1EESA 2ZE6A 5CIWA 4YMVA 1GKIA 1UBCA 3TKLA 3CCJB 4ARZB 5HE8A 1G8YA 4ILEA 1VCMA 1VYVA 1YU9A 4DBLC 1TNDA 2GZDA 1OH5A 1OH8A 4BLQA 4G1VA 1TU3A 2XNJA 5H70A 4B3GA 2FU5C 1G20E 3GFOA 3IQXA 4M0LA 1YHQB 2H16A 3NEYA 1BOFA 4FD2A 4US1R 5AJZA 5FUVA 2YC2C 2D2EA 1TADA 1J8MF 5H1YA 4A15A 2BSAA 2DPXA 3SEAA 1KDOA 4RZ3A 2QM7A 1E2FA 4ZKEA 3KUCA 5J4HA 2L0XA 4HAUA 1EFUA 3A1VA 3QFRA 2A5FA 4U7DA 2NPFA 2PZEA 1GVHA 2J3EA 5JMTA 2GXAA 2JIZD 4JIMA 1TEVA 2BBSA 2JA1A 4HUQB 4TT3A 1IN5A 2P6RA 2QTZA 1G9XA 3VR1A 3B13B 1WDTA 3CRVA 5JLJA 3G0HA 2BWJA 1XB2A 3WMGA 2O8FB 2QGNA 1W2HA 1T8TA 1X86B 1C9KA 3THWA 5M04A 3FWYA 3OIWA 5CB6A 2FJUA 3AUYA 4BRWA 4B32A 4LJ6A 1EG7A 1QF9A 2OZEA 3TAHA 5BN4A 5CB8A 3X1YA 1YRAA 2F1RA 4IVRA 4DLVA 1CR4A 3I4LA 4LHYA 4GL2A 3CH4B 3ZVMA 4NDZA 2VRWA 5SZHB 3RRMA 1U2RA 3DO6A 4C7OB 1CJKC 1EFTA 5JSZA 4C0KA 3LXXA 4DZZA 3T5DA 4TMTA 3V9PA 4BRUA 4LBYA 4LV8B 4X8OA 1FTNA 3AB3A 1G5PA 1AIPA 2QP4A 4OQMA 1TX4B 3EASA 3BOSA 1U99A 5GJVC 1F2TA 1E2HA 5IT5A 1QBKC 2EFCB 2WSSA 3VR5A 2JGNA 3GLHB 3AVVA 4DXAA 3EPLA 1YIJB 3FE2A 4QFMA 2Y8EA 4W5JA 3VMFA 4DLUA 3GJXC 4DDWA 2RAPA 1MO5A 1XD8A 2H8KA 4DDUA 1X8JA 2VA8A 2HV8A 3C14C 2ZSAA 3CRW1 1P5ZB 2GK6A 1XJQA 3THOA 121PA 1NJFA 4G5GA 1SVMA 4C0QC 4NCNA 1GRRA 1VTKA 2PBRA 1VQ8B 4LZZA 3UIEA 4MGYR 1E2LA 4LDJA 1E0SA 4BFYA 4CW7A 3QSYA 1AN0A 1OF1A 2GPJA 2OXCA 2Q9CA 2D2FA 4LYFA 2G83A 4KFRA 1W1WA 3M4YA 4PHFA 2ZXUA 2GCOB 4IFEA 4C2UA 4HAVA 3TIFA 1M6NA 1E0KA 4ASUD 4BFVA 4QGHA 1C4OA 2J46A 3CKLA 1IN6A 1Z6XA 2VPPA 4AG5A 4F4IA 1KO7A 1LY1A 1A2KC 2ZSDA 4U9UA 2DEUA 1GWNA 3N5CA 1SXJC 5SZIA 2ZRPA 4KV9A 3ZVNA 4OHWA 3AH8A 3B7GA 4RD6A 3B9QA 3RS5A 1F60A 4GZMA 2DR3A 2YC4C 3H84A 2WJVA 2XZLA 2OHFA 4D80A 4QBIA 3UMFA 3U44B 1XTQA 3UANA 2QORA 1GAWA 2W2XA 3QXSA 2J7KA 3W3AA 1Z3IX 4JT2A 1G41A 4GRAA 1KO4A 1CNEA 1SKQA 4BZQA 2FFQA 2OAQ1 4W7SA 1ZC3A 1ZU4A 2JJ2D 1MR3F 2E9SA 3B5JA 3MD0A 1RRFA 2IUSA 4RFSA 4M1MA 5KO2A 4E5UA 1CXZA 3H0KA 4GP7A 1GL6A 4R9UC 1OIXA 2OLJA 1S9DA 4Q7JB 1P73A 4DSNA 4B47A 1GM5A 1UKEA 2IUTA 5FPKA 2ZJ2A 1HA3A 3LW8A 4XIGS 2YZ2A 1J70A 3DM5A 1U9IA 3MWYW 4Z8YA 1G8HA 1Q1ZA 4MRRA 3WP0A 2C9YA 4EUNA 2VO1A 4S2EA 3E5HA 3DOEA 3CNLA 1LF5A 2H92A 3LXRA 4JLDA 3KXIA 3TVDA 3TR0A 4V0NA 3PUYA 2GDJA 2AR7A 1E9EA 1WP9A 3L43A 1JR6A 1Z8FA 2OV2A 4DEXA 1ELOA 8OHMA 4AKIA 1XDBA 5FUYA 2P3SA 2Q0HA 3HU3A 3RNLA 3L8ZA 1FL9A 3SC3A 3I62A 4LJ4A 1VPLA 5DNYB 4CIDA 3OZUA 1ZNZA 4MYCA 1XCGB 4I1VA 3EC2A 1NNEA 4MITA 3ZJYA 1G291 3U4QB 4HAZA 3B1YA 5IK2A 4HE5A 2QTVB 4PC7A 1KO1A 2O0KA 2OAP1 1QG0A 4IFBA 4MRPA 1E9DA 1Q82D 1I4DD 2ORVA 3BC1A 4OBEA 4KI0A 5C1BA 4DCUA 4BFSA 3DMDA 1S4QA 3R9WA 2V1XA 1W0JD 1SM4A 1Q57A 2DFNA 2RGGA 4F4CA 3NTUA 1Z0JA 3K70C 2DFLA 1TF2A 3N70A 1XEXA 2WKRA 4YONB 4URYR 1S3SA 3GLHA 1JXOA 5JRZA 1LVGA 4Q4LA 3HYRA 2W00A 3FMIA 4UXHA 1JJVA 1G5RA 4EH1A 3Q7QA 4ZPXA 2ODNA 3R8FA 4KITB 4BEBA 1YR9A 3U7EB 3BH6A 4FMDB 3T1TA 3QE0A 3U2QA 1NG9A 4KO8A 3LX8A 1G17A 1DAHA 4B2LA 1HE1C 3QY0A 3ZVLA 2F1IA 2CJWA 4JLAA 3CIOA 3Q8XB 2CMKA 5GJCA 3LO8A 3W2HA 2ZETA 2CLDX 1SXJB 3CCEB 1KKLA 2XSZD 3A36A 1R10A 1KJZA 2XNSA 3UWKA 1L4UA 1Q20A 4LJ8A 4NTZA 1IHUA 2IS2A 5G41A 3VTKA 1L4YA 2CCKA 3CWZA 2V6IA 3QEOA 2OTJB 5HKKD 5DYGA 2DETA 4YDHB 3EX7C 1W0KD 2DBYA 5EMNA 1IY0A 2GK7A 3NWJA 5EP4A 5EXPA 1E4YA 1HV8A 2GJ9A 2YHSA 3AQ4A 3CX7A 4YAOA 2PJZA 1TMKA 1EGAA 2IYZA 5EE3A 2BMWA 2DHRA 1DAFA 3OEHD 2PX3A 5JEEA 4L4UA 4YMUA 1CRQA 3OIUA 1W0JA 3PR1A 4JVNA 4DSOA 2VYFA 2QT0A 2VBCA 1ZUNB 3T35A 4F4JA 1SXJA 2BCJQ 3AP3A 2PH1A 3K9NA 1T9HA 3MSXA 1VCIA 3C15C 4QJ4A 3QE2A 3O8BA 5KDLA 4A2QA 3A6PC 2CJWB 2FA9A 2V7QD 5IK2D 4RD4A 4MGIR 1ZIOA 4YAWA 4DLSA 4US0R 1NN0A 1OH6A 1IQPA 2VTKA 4TQAA 4W5WA 3MGCA 3MWLA 4A0GA 3OAAD 2EW1A 5LB4A 1L8QA 3I8SA 1HQCA 3K0CA 1CP2A 2BGIA 1OYWA 3IO3A 1W34A 4MKGA 5HPYB 5H8WA 1VYTA 1AGPA 3T34A 1GSIA 2O8CB 4X8MA 1EP3B 1NN5A 1H8HD 1IN4A 5BN5A 1LF0A 2RGBA 1Z6YA 1ETUA 5JJKA 2F55A 3K0AB 5H59A 2WMOB 1CR1A 3K70B 4Q4JB 1TAGA 3QENA 3ICQB 1TQ2A 2WJHA 4M1SA 1GIAA 3PEYA 3G4SB 1T91A 4ACAA 3VX4A 4DLWA 2VL7A 2HJGA 1Q86D 1GAQA 5GJBA 4M1TA 4WQMA 3P26A 1D1NA 1GOTA 1T3HA 4PSVA 1GR1A 2RH5A 4P4SA 4EPXA 1QHIA 1R0XA 4O2LA 5F9FA 3QG5A 4DLYA 2BCGY 1EX6A 1NY5A 3CMEB 3GLIA 1ZYUA 1E1QA 2NIPA 3TSZA 5HXBA 5KPJA 1OKKA 4ZCLA 1E2JA 1QFJA 1TL7C 1BMFA 4KVGA 4ZGQB 2VNJA 3S1AB 2AL7A 3EPJA 4PAQA 1W0KA 3O47A 4PXAA 5IF9A 4QGFA 1QG4A 2VHTA 1WQ1R 3KZ1E 2FX3A 1QVRA 1XEWX 1NKSA 3CC4B 1Z83A 1IOZA 1Z47A 4WW0A 1T5LA 4L16A 4JLNA 4M21A 2JLWA 2Z4RA 3W5HA 4G01B 2ZM5A 1MKYA 1U0JA 2FSFA 4HSEA 4HUTA 5FPYA 4ASUA 1ZD1A 2V6JA 1ZMXA 2FEOA 2ZJYA 3TRFA 421PA 3KDSE 2GA8A 3QPUA 1I4LD 1SZPA 2WWIA 4A0RA 2NG1A 3LO5A 1GNPA 1Y3AA 4B33A 4CYMA 4Q9JA 4AKHA 1OB2A 5K8LA 4DB4A 2BBOA 4FCTA 3BB1A 3SHWA 4WZBE 3U44A 2XB4A 1CLUA 2ZRNA 3QKRA 1VG8A 4BFXA 1XMIA 4U00A 3RC8A 4LJ9A 3CM0A 4LJ5A 3VR4A 2CVHA 3PUZA 2ZI5A 5ANRB 3WXMA 1Z0AA 3KB2A 2WWFA 4TSFD 4IOMA 3K70D 3BORA 1PJRA 1T3SA 4A0FA 5TVKA 1LB1B 1SXJE 2C77A 5JBQA 1WRBA 2A78A 2FGKA 1OJLA 2ZI7A 2VNIA 1WF3A 3TE6A 4B6EA 5FPTA 2HF9A 2FG5A 1SVWA 1NRJB 1YI2B 5THXA 3I56B 2VSXA 1OFIA 4UJ5A 3A8TA 4EJSC 4MYUA 2RGAA 5B64A 4JJZA 1HT2E 2Z0MA 1D9XA 2R6CA 4D4JA 4LC0A 4JL5A 1VHLA 2ZE8A 4QKQA 2JLRA 1YR6A 3U61B 1MV5A 4URWR 4TMVA 3U4QA 2AXNA 2AD1A 1LTQA 2EFGA 3AKCA 5EXSA 2WOJA 4HLDA 1KI1A 3ND8A 5EE5B 1M74A 3B1ZA 1W5TA 4N0DA 1JNYA 3P4XA 2Z83A 5KNBA 1A2BA 1DPFA 1LS6A 2QP3A 3T1VA 2W6ID 4DDTA 4DKXA 4ESVA 2ZU6A 4Y7CA 3WY9A 2F43A 3GLFA 1DAIA 3CB4A 1EWRA 3CX8A 3D7MA 2W58A 3WP1B 1G3QA 1JQJC 2ZJZA 3C7KA 4L15A 4KHZA 1F6BA 2WWWA 4TL8A 2ONJA 2ZU0C 5JSZB 4C7OA 4QRHA 4D0NA 2O8BA 4M1WA 1E3MA 4TZ0A 4LY6A 1CIPA 1KSFX 3W6OA 4GDFA 1J7KA 4L9SA 4PANA 1BX1A 4HZUB 4EPWA 2HYIC 5AUNB 1XF9A 2ONKA 3WRXC 3FHOA 4LGMA 3VNUA 3AUXA 4JL6A 2G0NA 2CCJA 2HT1A 1QVGB 2ANBA 4RZXA 2ZS7A 1XMVA 2DWPA 3OZWA 3CLVA 5EZ5A 1K8AD 2WKQA 5GADl 1W36B 1WMSA 3UXMA 5FBWB 3IGFA 2HDNB 2GHIA 4MRNA 1YZGA 1W36C 2G1KA 4TL7A 4HUQA 4BPRA 2HLDA 2WTUA 1ZM9A 4NCIA 1XNJA 4PSAA 3LVRE 2GESA 1E9BA 4US2R 4EIWA 1E96A 3BH0A 3TH5A 2CHQA 1SHKA 2IA5A 1M8PA 5GVRA 3PV0A 2R6FA 2HJVA 3NIBA 4B48A 1TF7A 2FOLA 2IYWA 3MJHA 2UZ3A 3IPXA 3KKOA 5E7JA 3WYFA 3U5ZB 1TEXA 4KAXA 5L3SB 4M22A 5ELXA 3AVPA 1UDWA 4KFUA 4ARZA 4A2PA 3AF1A 2ZAOA 3PUWA 4TTRA 1R4AA 4MYTA 3I8XA 3SHFA 1IBRA 2ZAMA 4HEJA 1CR2A 3WBKA 5FTKA 1TUIA 3NBZC 3SQWA 3R20A 2WSSD 1W46A 3QVVA 3OE7A 1Q0UA 2AX4A 3OE7D 3NBXX 2W6JA 1RC8A 3IBYA 1KSGA 1TF5A 3SQXA 1U81A 2CE7A 3GFTA 2IW3A 3ZBUA 3E1YE 1N6HA 4PHTA 4U02A 5EQTA 4RKEA 2IUUA 3ZD6A 1ZNXA 3EA0A 4K46A 1GP2A 1Q12A 1KI3A 1GUAA 2ZI3A 4CEJA 2GETA 1OXVA 2FMXA 1W4BA 3WRYC 2JLUA 2OCAA 2YKGA 3QKTA 3DKVA 4S35A 4NCKA 4Q4HA 3TVTA 4DUGD 1K8RA 2J7PA 5DISB 3W5UA 2IT1A 2QP9X 2IC5A 2X77A 3AVTA 3K0FB 2JEOA 4YDSA 1E2EA 1XTJA 1XTIA 1Z2CA 2A5DA 5DH9A 3QQ5A 5FOTA 2QE7D 4Q48A 5JWHA 1UKZA 3ZQJA 4NHOA 2OUKA 1DAKA 3LWNA 4URXR 4RJLA 2QG6A 3VO2A 3WNBA 1QUEA 1AS3A 3ZBTA 2QBYA 4Z8XA 3FMPB 4NCJA 4BFWA 3ZZTA 1KRHA 4MKFA 4XD7D 4DSTA 5JS8A 3D3QA 2PL3A 1P7CA 5KOYA 3GJ5A 3KKPA 4KSCA 1NIJA 2B7CA 5FOXA 3CZQA 4LI0A 1JAIA 5FTMA 4NH0A 3AVXA 1E94E 2CE2X 4IOLA 4R2HA 4NCHA 2FDCA 3DM9B 3SU8A 2YJTD 1D5CA 5KDDA 3KFVA 1FP7A 221PA 3VR3A 4QOSA 2JLXA 2CK3D 1OW3B 4Q1AA 4UNPA 2ATVA 1GL9B 3REFA 4TMWA 3W34A 3WHKA 2XTMA 3VO1A 1W35A 2P65A 1Q1EA 1W4RA 1VQKB 3JZMA 3W5JA 3KXKA 3CH5A 3I5XA 1YQTA 2GZAA 3AVYA 1E2KA 1GJRA 1NJID 1U8ZA 1U9IC 1A1VA 1JR3A 3TLXA 4A8JC 2V8OA 1KC8D 4M1YA 3CX6A 4NL4H 4PPNA 4X8HA 2KBFA 4BASA 3PITA 2YNMA 4O3MA 3FB4A 3Q3JB 3IIKA 4XJXA 2IYYA 5FL7A 3A1WA 2SHKA 3SJZA 2VHQA 2EYUA 2K5UA 4B3CA 1F48A 1QHXA 5CDFE 2NMVA 4GNKA 2QSZA 2QL6A 2EIXA 3B82A 3K0AA 3OJWA 1LNZA 3Q85A 4DUGA 2NO1A 1S2MA 4XH9B 1NSFA 4Q9KA 4C0JA 4PC2A 3REGA 4N1AA 4FN5A 4FW9A 4UNSA 1N6OA 1KKMA 4JSYA 621PA 1RPZA 4ZI3A 3GLHE 4OHYA 2PJRA 5FBQB 1BH2A 4Z1MD 4OHZA 2UKDA 2B92A 3QF4B 1IAQA 3HJNA 2ECKA 1GG2A 3C5HA 3FPAA 3I72A 3A58B 2KSQA 4KSBA 1NLYA 3EWAA 3AEZA 2QA4B 4LYAA 1QHYA 3DZDA 1VIYA 1NIPA 2J9RA 1NLZA 4F7WA 1EP1B 5B58C 1YJWB 1P72A 1UKVY 2IF2A 1NI3A 1J99A 4GMXA 2I1QA 4YMSA 1NVUQ 1DDIA 2XX3A 4DHEA 5KHOC 2JJ8A 3CPJB 5C4MA 1K5DA 4KFTA 3PG5A 4NYIR 3UKDA 3QXXA 2EQBA 5J47A 3MWKA 1F20A 2FZLA 4P4UA 2IYRA 5AJYA 5HTKA 4A6PA 3GJ4A 2AHOA 4Y0VA 1P2UA 4NPHA 4AWXA 3THYB 3AF4A 1H8EA 1IY2A 2QI9C 1G3UA 4PTLA 1VECA 1G5TA 4IW3B 1E9AA 1JAHA 4XTRA 4KVAA 4XTCS 3AM1A 1Z06A 2FWRA 4B34A 1GAJA 2V54A 2ZRIA 2GJKA 4P33A 2DERA 3QVUA 4IJMA 4AF7A 1E63A 3EXAA 4G1BA 1T0HB 3IIJA 2WJJA 3JQRA 2BDTA 4PO9A 3FFAA 4CEIA 5KNCA 2ZJ8A 2DYKA 3QUSA 2ZQ5A 4JVSB 1VIAA 5C46F 1TPZA 1QHHA 3QPWA 4E09A 1JEDA 2CDNA 1R5BA 1M34E 2J45A 3OZXA 2GEVA 1KDRA 3U3JA 3X2SA 4B76A 1Z0KA 4CEHA 2QEXB 3RRNA 1DO2A 1D2NA 3VKWA 2XNCA 3I92A 1IXSB 2A9KA 1VQLB 1DO0A 3O8CA 2E1RA 1Z6GA 4D4LA 1DELA 1QGZA 1OKKD 2Q3MA 2QEQA 2RKOA 3LLMA 2ZRKA 5CJ2A 1P6XA 4AKEA 5HZHA 1W36D 2HXSA 5FBLB 1T5IA 2VIIA 4EDHA 2AD5A 4LYHA 3OFNA 4FI3C 3IUYA 5EP3A 1OGJA 5KUTA 2WSMA 5BW8A 1TLLA 1OSNA 4LC1A 1OXUA 1HQYE 821PA 3UG7A 4CVNA 1N6KA 5FL3A 2HXYA 4PHHA 5L8VA 5K8UA 1CJUC 1QHGA 2RB4A 3B1WA 2B8TA 4YHBA 1W48A 2HT6A 4UXJA 5E3HA 1FPMA 3RC3A 1KK3A 5D3MB 1XFAA 3ZH9B 3KL4A 1UM8A 2QDXA 3Q9LA 3EA5A 5JJLA 5K8TA 1ZRHA 1CS4C 1VQNB 1JA0A 1H8HA 1NN1A 3G5UA 5JJIA 1O3YA 1KI7A 4MGKR 2GKSA 4KBFA 4Q7KA 1DADA 2JDID 2J0UA 3EZFA 3DL0A 3PUXA 1IB0A 1L7VC 2QPTA 3B60A 4MUAA 4UNQA 4ESHA 1E0JA 2ZUCA 5EJEA 2QGZA 4TZ6A 2NPIA 1QUFA 3OAAA 3KJEA 3U6BA 3LX5A 4LBWA 2GXQA 4URVR 1P60A 4N3NA 2D06A 3LDAA 4TQ9A 3MLEA 3KQLA 2EVWX 2FGJA 2F7SA 2OLKA 4RD0A 4TMXA 1S0UA 2QPAA 1PLLA 4HYYA 3L8YA 2UZIR 2EFHB 1KO8A 4E22A 2N46A 1ZP6A 4JLOA 2ZRLA 1NY6A 1YZUA 1SXJD 2ORIA 2REBA 1KMHA 3A1UA 3KKQA 1AZTA 5D3MA 4YQFA 4JBXA 2ZSBA 2GCNA 4Q1BA 4ABYA 5L3SA 1R0WA 4Y9UA 1VQ5B 2OG2A 4X8LA 4QM6A 2P0EA 4NMMA 4PO8A 3VX3A 3VR6A 2FPLA 4HZIA 2BKEA 1W2GA 3NBFA 3C8UA 1KNXA 1CRPA 3BB3A 3DDCA 2F3RA 2VP5A 3R9XA 1L2TA 1LV7A 3M6AA 2GJSA 2B8WA 1P9NA 3LW7A 4P0TA 4TYQA 3EPKA 2AN9A 3RABA 2BVNA 1E2QA 4JLVA 4LRWA 1DS6A 2QAGC 4Q1CA 1A8PA 4A8JB 3LQRA 4E07A 4KU4A 2XGJA 4AURA 2BM1A 4LHVA 3SS8A 1N0VC 1DG3A 2QA5A 5DE3A 2J41A 1AKEA 5KSWB 5KDOA 1G8PA 1M2OB 4CDGA 4G5QA 2GBLC 5DYIA 2DFTA 5DI3A 1SVOA 1QFYA 3FDIA 3FYHA 2IYUA 1NJGA 2PIAA 4EFNA 4RFVA 1XTKA 4WOPA 1IONA 5FI1B 4YXWD 1AK2A 4Q1FA 1VQPB 1DDGA 5DLQC 1DBSA 1RFLA 3T12A 4XVUA 2P6NA 2VF8A 1W5SA 2YOHA 2OO7A 2ZE5A 3ETLA 3P1JA 2OTLB 4ZCIA 2REOA 3EZ9A 1FQJA 3ZZUA 2CLCX 5DHAA 3SJAA 2XB2A 4KFSA 1NN3A 5DHFA 5TARA 4LK2A 4IOKA 4FIDA 4FWIB 2QMUA 1RKBA 4FCVA 4HAXA 3TSWA 1ANKA 5FH9A 4ZO4A 1Z29A 3F5FA 4UNNA 2NO6A 1P75A 3EZ2A 4BE7B 1W4AA 1Z07A 1R8QA 4LBZA 3I61A 4Q4AA 4AYWA 5EP1A 4IXMA 2ZYUX 3PXGA 1KMQA 1NG1A 2IBMA 2ANCA 2C96A 1ZM4A 3G82C 2OE2A 5G3ZA 3FTQA 1EWYA 1IXZA 2R6GA 2CRVA 2OBLA 4XOIA 3TGPA 1VQOB 4QGAA 2XITA 3KX2A 4IDNA 4P31A 1UDXA 2XTNA 4EPRA 4QHYA 4L8GA 4TMKA 1GITA 5CLQA 1G18A 2H7VA 1JBKA 5EUQB 3FMOB 1C1YA 2YVUA 3T5GA 4DVGA 4LWZA 4CGZA 1E2NA 2TMKA 3N2IA 4OQFA 4B3XA 4M9XA 3CPEA 1H85A 1OT3A 2PMKA 1SGWA 1XMSA 2GAOA 1FNMA 1ZM2A 2VZLA 4ZCMA 2RGDA 5FOVA 3SI7A 1KNQA 1MOZA 3QPVA 4IDPA 3W5IA 2MSDB 1U98A 3NDBB 1UADA 3OZVA 5LD2C 1R5OA 3LLUA 4D0LB 1FW6A 2GJ8A 2ODEA 3W90A 1M1KD 3G71B 1NVVQ 3FVQA 2VHCA 4GOKA 4OJQA 2NGRA 4EJSB 3CMAB 3QG1A 4RVCA 1OLOA 3D31A 3P32A 4LV6A 3PCRB 3A37A 4O25A 2Q21A 1UEIA 3QKRB 3M0EA 2XOKA 4DQKA 4NYIQ 3FPKA 3OEHA 4AKGA 4A8JA 4JYBA 5HE9A 1CJTC 4JBYA 1AQUA 3K8YA 4LJ7A 4B3DA 5JFGA 1QHSA 1DARA 1UFQA 2ERYA 2YOGA 1EP2B 2BMFA 1R2QA 2O0JA 4PGOA 4CZ2A 1JJ7A 3L2OB 1D8TA 4QL3A 4OHXA 4DIDA 2O52A 3EZ7A 3J81k 4GT1A 1Q3HA 1DG1G 2O5VA 2ZS9A 3MAAC 3RWOA 4A36A 1KMHB 2W0SA 4QXAA 3Q5DA 2GXUA 5FFMA 1VCOA 2ZJAA 4JVLA 5TY0A 3CRQA 4PAOA 1VG9B 4II7A 4HAWA 4TWZA 3IIMA 4H1UA 1AQYA 4QNRA 1N3BA 1BJKA 1N6LA 1M1YE 1BQEA 3Q5EA 3CF6R 4DCVA 4V03A 3UMSA 1KD1D 3NVAA 1VYUA 3BGWA 2ZRAA 4ITRC 3NKVA 4N3GA 2ZRGA 5JECA 1TUEA 4TLEA 2RHMA 2ZJBA 3RS7A 3U3KA 4V0OA 1G6OA 2FSGA 3L0SA 1IN7A 3AVQA 3IILA 4RKFA 2G9NA 1DVRA 4GSYA 2VEDA 3W9YA 5EXXA 3FHTA 2QAGB 3CPWB 3KQNA 2DY1A 1GNRA 1D6JA 1NP6A 2OBMA 1KI8A 2WPDD 1N6IA 3VU9B 2OESA 2Q3FA 3TBKA 1YITB 1IXRC 1NLFA 2EWVA 3SN6A 1Z28A 2IEZA 1KI6B 1G7SA 4OKSA 2V9PA 4DQLA 2GNOA 2P5TB 2NQ2C 1WE2A 2CHGA 4LJYA 4DLZA 4AC9A 4IDHA 2H18A 1BIFA 3WNCA 3HDTA 1KYIA 4LHWA 1E0AA 4BZXA 1OPXA 3AV0B 4RD1A 2DFKB 1ZINA 2Q9BA 3QBTA 3RWMB 3ZS8A 4BZPA 1KI9A 2R6AA 5G53C 4DLRA 2PZFA 3X1ZA 1YR8A 2MSCB 3BWDD 4Q66C 5G3YA 4V0KA 2C95A 4DSUA 1IJFA 1NDHA 3F3YA 5L3QA 1FNCA 5FL7D 3UWOA 1VKJA 4Y9RA 1QHHB 4WAUA 3NH9A 1W2BB 4JKIA 2V1UA 3KUDA 1PUIA 1YE8A 2JASA 1JR3D 4TLCA 2JLZA 1F5NA 3H86A 3PUVA 4JLBA 4JS0A 1P9RA 2ZTSA 1CJVC 3BD9A 5FI0B 2GWHA 4RZUA 5H68A 4EPTA 4M53A 1HTWA 3BJIC 3CUEF 5L3VA 1BX0A 2NO0A 3AVWA 3HP1A 5EE9A 1QFZA 3HWSA 3QF7A 1ZVQA 1RIFA 2JJ2A 3SE0A 1E79A 1FUUA 4WXPA 4A82A 2IF0A 3OJXA 2EWWA 2XJ4A 3GD7A 2D74A 3H1TA 3LRPA 1G64A 2VP0A 4HATA 3THYA 5E95A 1IY1A 4EJSA 4AYTA 2QENA 3CCUB 4TYNA 4MA4A 1HT1E 2X3UA 3FJOA 4M1OA 3CRRA 2CNDA 2FPMA 3RRYA 1SKYB 1V5WA 2QU8A 5FBVB 3OEED 3BB4A 3R7WA 2H1LA 1K73D 1E2DA 4AI6A 1O87A 2A5GA 1OHHD 4URZR 2LP6A 1G21E 3IBGA 3U7GA 2O0HA 1WA5A 4Q47A 2B7BA 2YOFA 4IHQA 3ICEA 2Q3HA 1NMZA 1RE0A 3ZIAD 3EAQA 1MT0A 2JJ1D 2GCPA 1T0JB 3A1TA 3MWJA 2O8EA 4PO1A 3W2GA 4IVQA 1OIWA 2C99A 4NBSA 4B44A 3DHWC 1QVFB 3I1FA 2ZRMA 3L0PA 5FR1A 1TQDA 4OK6A 3QJYA 2N42A 2ZVQX 3OW2B 4A2WA 4EFLA 2DCUA 2W0MA 4GP6A 1FOEB 5LBIA 4H9GA 4QC2A 1JXMA 1XX6A 1Z6AA 4PZYA 1XXHE 4QBGB 1ZM3A 3EARA 4RD2A 3IQWA 4BECA 2IS1A 1U8YA 4Q03A 3FOZA 2A5YB 1COWA 3GLIB 1HURA 4MDFA 3BK7A 1KK1A 2PLRA 5DI9A 1E1RD 2R8RA 3NBYC 3P27A 3U7HB 4C2TA 4P3YA 1Z0DA 1GVNB 3D6TB 2XXAA 4D81A 1G16A 4I4LA 2E87A 1E1RA 4R98A 1UEJA 3CCQB 1IJEA 1Q22A 2LKDA 1UJ2A 4YAFA 5C2JB 1M7GA 3DPUA 2ZUDA 1COWD 2W2VA 2CXXA 1KGDA 4TTQA 3I73A 2YYZA 4LX0A 3DZ8A 3B2EA 1JJ2B 3W8NA 1KAGA 3B85A 1B23P 1B2RA 2XZOA 4AY2A 1P61B 5TB5A 1XZQA 1EFRD 4LYJA 1YKSA 2MMGA 5FOWA 5F3WB 1XZPA 3I55B 3CRMA 2ZITA 4PQFA 1IM2A 3GEEA 4TYWA 4IEEA 2JJ1A 5DIFA 4BFZA 1XCMA 3CF2A 4A92A 5LB2A 2PT7A 3K53A 1KDPA 4D6PA 4DLTA 4R7ZA 1XMJA 1XD2B 4TLDA 1BKDR 3NHBA 5CLLA 2XEXA 2JIZA 4Q1EA 3AVOA 4TYPA 5EZ6B 4A6XA 1VCNA 1Q21A 4DWJA 2WM9B 3FFBA 1E9SA 5KSZA 1JR3E 2G6BA 4UNRA 2ORWA 4JMPA 1AZSC 2IHBA 1KDTA 5E4FA 1KIMA 2G1JA 1E99A 1ZD9A 3A1SA 4Q1DA 1N6NA 1QGAA 2QY9A 3WBJA 1E2IA 3MRSA 4K81B 5AJVB 3QXJA 4F7DA 2R65A 5HZKA 1ZNWA 1N6PA 3MMPA 2LWIA 5FTLA 2VNKA 1ZM7A 2HYDA 4QJ3A 3T15A 3AKEA 4YMTA 4B4DA 3JQQA 4QG7A 4Z54A 2HMAA 1X8KA 4ZV4A 1XEFA 4Q7MB 1ZUHA 1I4TD 4P4SB 3MCAA 3LA6A 5A4JA 3W2IA 4B6FA 1XJ0A 3ZC3A 3K9GA 2D62A 3SYLA 3TNFA 1NMYA 2J0QA 4BLTA 1N25A 4C0LA 4RY2A 2CL6X 4PSKA 2YWHA 3LV8A 4FINA 2CL0X 1PZNA 3CR7A 4Q4JA 1E69A 2R6HA 3EIHA 4D82A 5J40A 2QZ4A 4ON9A 1U0LA 2J7PD 2H5EA 4JLPA 1I7PA 1DOAA 2HEIA 4LHXA 1QRAA 3AP1A 4LOAA 3TJZA 3KQHA 2GEUA 1SVIA 4OI2A 3TSOA 3GPLA 2O8CA 1KZGB 2PCLA 3G6EB 5KPDA 2F9MA 4GOJA 1F2TB 1RYHA 2QQ0A 1GRNA 2GF0A 3ADKA 3T1QA 1P2TA 5H5JA 2ZUBA 3X1XA 2JLYA 1GKYA 4WIAA 5L3RA 2O8EB 2QMEA 4Z51A 1WXQA 3IHWA 3K0CC 3ADDA 3T1OA 3LVQE 3CO5A 4NONA 3QOFA 721PA 1OFTA 5GVSA 3PJRA 5C4GB 1RYFA 3E1SA 5TR9A 3CCVB 4ZDKA 2IYVA 2GQFA 4TYYA 4D0GA 1JQLB 1K5GA 1KK2A 4W9MC 3AVUA 4PQYA 3CONA 3GJ6A 1OXTA 1KY2A 1VQ6B 3BFVA 2CLSA 1X1RA 3ES9A 3QXHA 3THWB 2PEZA 2ZE7A 5DN6A 4NU0A 4AIIA 1ZNYA 2NO7A 1AKYA 4IDOA 2XTZA 5IHPA 2O8FA 1PLKA 3MUFA 1XXHB 2IK8A 3VQTA 1QDEA 3HU2A 4G5SA 5JCPA 3RANA 2AFHE 2PEYA 2QUZA 2H57A 5JZVA 1SQ5A 2PLFA 4BFUA 1FDRA 3PFIA 3ADBA 1D2MA 1US8B 2BGJA 1Z0FA 2IYQA 2YINC 3VR2A 3THXA 2ZRCA 2I3BA 2WWGA 4HDCA 1FRNA 2OCYC 3BE4A 3W6NA 4LHZA 4RCYA 1LW7A 4EAQA 2I1VB 5HCNA 5A5GA 1PV4A 1JPJA 1U0HC 3O8RA 5D3QA 5SZKB 1N6RA 4Q7LA 4M9SA 1K9MD 3AP2A 3B6EA 2X2EA 3IHLA 3KTAB 5L3QB 3QKSA 1HEIA 4QHSA 2OT3B 3HU1A 2V4ZA 4YAUA 3U3OA 1A5TA 3IO5A 1JECA 2F1JA 4L5BA 4CT4B 2QMHA 3LFUA 5CITA 1N8RD 2VYQA 3CC7B 2C98A 4HLUA 4QBHA 1G3MA 4Y0AA 5AK0A 2ATXA 4DT1A 3V4RA 2J59A 4BFTA 2IYSA 2XOKD 4EFMA 3RDPA 1RVDA 3VHXA 3ZYCA 1KO5A 5LPNA 5CJPA 3MG9A 3KB1A 1WBBA 3VKHA 3K09A 2NZJA 4JJKA 1Z6TA 1ESMA 1KI6A 2P67A 3PENA 1G19A 1TU4A 1NVWQ 2ZVPX 4LPKA 1XTRA 5J4VA 3VU9A 4YC7A 1GO2A 1Z5ZA 2X2FA 1M90D 2ZIAA 1EK0A 1MO6A 1Q1QA 4MRSA 2RHDA 4IOJA 4MGZR 3B78A 3BFKA 4B43A 3I3SR 3C5CA 4EKDA 2EYQA 2R44A 4LJAA 2ZR9A 1RJ9A 1HY3A 2QQEA 3AGQA 3JQPA 1VQ7B 1OXXK 4TQUS 1GRQA 1R0ZA 5B57C 1KI4A 3CCLB 1S72B 2WV9A 3A4NA 4HDOB 4NYMQ 2BOVA 2BEKA 3RAPR 3SR0A 3BS4A 1XD9A 5CM8B 4FMCF 3OHMA 3CC2B 3ASYA 2V7QA 2IS6A 2ERXA 3EW9A 4Q01A 4OK3A 1KTVA 4OI0A 4F38A 1F2UA 3GLGE 4IEIA 5B2ZA 4ZDJA 5EP2A 5DN6D 1Z63A 5GV7A 4NYJR 1CF4A 1XBTA 3LBIA 1OE0A 4TL9A 3ZZ0A 2OXRA 2QTHA 3IEUA 1T4GA 1W4CA 2P6UA 3BRWD 3LH5A 4GBMA 2QBYB 5KYKA 1F2UB 3NHAA 4O0MA 1BO6A 1JI0A 4XVQA 1Q7YD 2OILA 1N5KA 2CL7X 2MSEB 1XPUA 1AM4D 1QG2A 1JA1A 2D7DA 3VHLB 4PC3A 1R7RA 2C8VA 1GZSA 3TUZC 1ZUIA 4QBFA 2Z43A 1KSHA 1DAGA 3X1WA 3T06B 4OYHA 1VDZA 1VMAA 2AWNA 2HCJB 2AK2A 3EG5A 3QNUA 3L0IB 4C0BA 2IS4A 3KKNA 2ZANA 5DGXA 3K0FA 3TQFA 4LPSA 2NO9A 2O8DB 4YXWA 4NKRA 1YVDA 3CWQA 1XE1A 1ZCBA 4FXPA
chains in the Genus database with same CATH superfamily
1UBMS 3MSCA 1V1RA 1C81A 1XLUA 3TIXB 1AB9C 3AZOA 4X64B 1QYVA 4RNDB 3N8IA 2GFQA 4UMEA 4HG6A 4WLNA 3F3KA 2E2WA 1FJSA 3BJRA 1FA9A 3SJCA 5DHRA 5K4GA 4IH9A 3GG2A 3LNCA 4TLLB 4B80A 3OG9A 3HABA 3L41A 1E79D 3ED5A 3L6PA 1GPJA 3HA2A 4OKNA 3QQPA 2HTEA 3S27A 2C3UA 4C9BA 2ZI9A 2CVPA 2VH1A 3FZYA 1G3EA 2LBPA 1EFRA 3QTOH 1YZNA 5E6SA 3UCFA 2ROQA 1J06A 1WM1A 3RFVA 3B1JA 4QA9A 3NX4A 5D6NA 2I4TA 1OROA 5TV2A 3I9LA 3CZAA 4MDEA 3RYCA 3MMNA 3KETA 1TJ5A 2Y6TA 4OHMA 1M2HA 2PX5A 4OS2A 2ALPA 3MT9A 1KPIA 1PU2A 3BQMB 4F2WA 4N0QA 8MHTA 1HYEA 1QC5A 3AEUA 5IJWA 5BNIA 2B9VA 2Z56A 4YEJA 2MSWA 1GI3A 3JV7A 1GL3A 1FFHA 2ZBDA 1TK2A 4JSRA 5AKZA 4TMZA 4WJZA 4KRFA 1ZVKA 4RKQA 1VHDA 4D46A 1Z4JA 1O54A 4KJZA 4QVKA 4ZO7A 3CXUA 1MN6A 4KTCA 1JX6A 4F4UA 1DFHA 5AW6A 5EJZA 4HEHA 1E9CA 4NG5A 3A4MA 4EA8A 1ZGHA 1BAPA 2AEFA 3ILYA 3OQHA 1BD3A 2XT9A 4BNDB 3MUOA 4UOQA 1SA0A 4DIUA 1HE5A 4R3NA 5ADHA 3PXXA 4I1OA 4OO3A 1LS1A 1ZMTA 4TRMA 5GZ6A 4UBKA 4C1NA 2JH9A 2HUPA 3KJIA 5JSUA 4RPIA 4B4UA 3T5TA 4F9GA 2HNTC 1UC9A 1TGTA 4TLAA 1YTUA 1EK6A 1UH5A 1QR6A 1X94A 4AULA 2FTMA 2E7ZA 3WLRA 5ALVA 2H1SA 2YZNA 2IEYA 3LQ1A 5KTYA 5AW1A 4BKOA 4G4IA 2Q1XA 3NWBA 3GCTG 5JD4A 3ZV3A 3JYLA 4AGJA 2QSYA 5FOSA 3V00A 3UMRA 1QIXB 2BKAA 2HHAA 1HIAB 5LYYA 2G7ZA 5EZQA 2WY2D 4OAOA 5D00A 2VZEA 1UPCA 1YYY1 5HCIA 2A5KA 2BPOA 4LSMA 3M6IA 4FBGA 2B9LA 5KVVA 3ENZA 3MHPA 1HYQA 3MJRA 3UIRA 2QRPA 2WJGA 1DEHA 3IT2A 2JI4A 5EE1A 4YJ3B 4CKCA 2B30A 3BWMA 4EHJA 1FK8A 5L40A 3KE9A 4CHTA 2D5BA 1E58A 1E7QA 1KWKA 2BFWA 5AJTA 2OBNA 2GDEH 1ZR0A 3AG5A 2ODTX 1Z0IA 5EHGA 1FMFA 1WORA 5HKKA 2CFOA 2UYOA 3MOIA 4B7ZA 3AHEA 1HM5A 4EMSA 3OM0A 1Y81A 4LOLA 4C04A 1VL8A 8GPBA 1YVUA 3ZDQA 3AY3A 4LCBA 4AD8A 2ZRHA 3SWWA 4QGGA 4IJ6A 1XKQA 3QKUA 5BWMA 4R7TA 1BTXA 3KUKA 1YR7A 5EIBD 4YJ2F 2BFCB 2QGGA 2G1PA 2GCOA 1T3ZA 2Q3JA 3FP6E 3M3VA 3IPYA 1Z4LA 4AP6A 1ODIA 1TZCA 5FBRB 2K0QA 3G9QA 3FZGA 5DHSA 1N2GA 1NJ8A 1HTTA 3RC4A 1SK9A 3K5IA 3W5DA 1D7OA 3L82B 1NZFA 5FR2A 2WUBA 4BATA 4M8NE 4ZOBA 3H0EA 3Q10A 1JIKA 2QRMA 4NFEA 4PAMA 2IYXA 1C3OA 1ZK2A 4CLEA 5JNUA 1W9MA 2GKOA 2PH3A 4LXHA 4CWAA 3T7DA 2GT7A 3WB1A 4KN6A 1GD1O 3NG1A 5LPFA 4IDQA 4XLEA 1SA0B 5CHEA 1J09A 1U2GC 2CLMB 2WG0A 1YXMA 1HZZC 3PNQA 3JAKB 3LT0A 4V02A 5TDHA 2BYTA 3RXHA 4DBLE 4U7WA 2CLFB 4MWCA 1AZLA 2IFTA 1KI2A 3KCQA 3GFPA 3KQOA 3H9QA 4EEZA 3PO1B 2F9OA 2I9KA 4RTJA 3LAWA 4L6CA 1UCYE 4UD6A 5DTRA 4KDRA 1E98A 1V6CA 1YHZA 2O05A 1T29A 4EY8A 4DXDA 3A7DA 3I32A 3DC7A 5KSYA 3K1JA 4IDEA 1RIWC 2OFFA 1HAVB 4WZ6A 2AJLI 8GCHG 3IR7A 4XVRA 3K71B 3GYMA 1G8YA 4O4LA 1F9EA 1IWBB 3TX6A 5H70A 3N74A 5FUVA 5MFZA 4LE1A 3LY7A 1NOIA 3NCLA 5J4HA 1H05A 1O6FA 2A1UA 2L0XA 1TOAA 1P5FA 4J94A 1WDTA 2VYVD 2GZRA 2H1IA 2FQWA 4WNAA 3M7TA 2GZ7A 2FP3A 2QGNA 5DVZA 3O2SB 3ZWYA 3R0FA 2O2EA 5IM4F 3QX7A 1FY3A 2XWBI 4IDDA 4WXYB 4R2WA 4CG3A 2FF5A 4P3PA 1NQ5A 2D0DA 3TG2A 5B1HA 4ALJA 3EEBA 2I8CA 5IT5A 4UVGA 4BCDA 1RM4A 4HQ0A 4FZRA 1J9GA 3B7PA 5IBQA 1X8JA 2WYUA 2I71A 5B1IA 1QH9A 3UOWA 4DY7B 3K73O 4BB0A 4CW7A 1JIIA 1ZJ5A 2VDRB 4XEHA 3JZIA 1QYIA 3UJ6A 2WIKA 3G8YA 1KVSA 4EB0A 1A2KC 4KV9A 3DT8A 1CYDA 1L8AA 2B2CA 2ZF0H 3TTUA 4H6WA 2DUCA 4EW3A 3DH0A 4TXNA 4L07A 5BV8A 2X86A 5HMAA 1PQPA 3BIOA 4Z4GA 2B4TO 2XUIA 4BX8A 3I01M 2I87A 1RRFA 2NU9B 2HSDA 2K2WA 1KXBA 5FPKA 4MPXA 1IHXA 1ZSLA 1J70A 5EWJA 1Q1ZA 2IODA 4MRRA 3JWEA 4F1KA 2PANA 3L5OA 1LF5A 3P52A 1ZLYA 1XYVA 3L43A 5BSGA 4RTMA 5HIYA 4GZ6A 4MITA 5LLTA 1RM3A 4RL4A 1U1DA 1I5EA 4FDUA 1BKYA 3BMQB 1JQDA 4BFSA 3EE0B 1Y8RB 5EJ4A 3Q7SA 1KMMA 2RCYA 1VJDA 3F78A 3IP3A 1JXOA 1U04A 1BVYF 3A6JA 4FMDB 3ZK7A 4TUYF 1GHTA 3QY0A 5HJ5A 4PLPA 3C0KA 4DWWA 2I2WA 2FR1A 4ZQHA 4HPWA 1L4KA 4Z4UA 4P9SA 4AB9A 2H8GA 1YQGA 1E4YA 2PGIA 5FDFA 3ZY4A 4QUDA 1EGAA 5JAIA 1BXRB 4ABTA 1E1LA 2QT0A 2VBCA 1ZUNB 2XYQA 5CB4A 5DBIA 3WLMA 1C1PA 2PH1A 3OOCA 2E55A 1U0BB 2BGNA 4TPIZ 3ASQA 3H5RA 4W5WA 4RKYA 4YO8A 3GX1A 1PBTA 1KBOA 1QRWA 4MDHA 3HLTA 3FGPA 3W5BA 4FJ0A 5K8JB 4UE3S 3H0CA 4Z9AA 2F55A 1PNQA 1OWLA 1LVYA 1RLIA 2FFRA 4D3SA 3Q6QA 3PEYA 1MJFA 4ACAA 2O7QA 3KQSA 3SAJA 5AM4A 4XOJA 1Y3WA 3A1EA 3WL4A 5F78A 2JIPA 1XF1A 4QECA 3S2FA 2VNJA 2FPUA 3WZMA 5IF9A 2IUEA 2YASA 2FX3A 2ZBVA 2W4QA 1VHWA 5KYTA 4JLNA 4MB2A 2FIRH 4F9TA 3BZWA 1GPKA 4FCTA 2ZRNA 3UHPA 2GNPA 4LJ5A 3NNDA 1G36A 3RMNH 5TVKA 4CKEB 1B1CA 3VU8A 1NW5A 5JJCA 5THXA 2PGNA 2P8JA 1OFIA 5HFJA 4G24A 1I51A 4MYUA 2ANYA 2H1WA 1UHBB 5A3QA 3F71A 3U4QA 3DSPA 5B3JA 1K6EA 2IUFA 1XTZA 1SR8A 3P4XA 4UBIA 2BOHB 3NATA 1WZIA 4GQBA 2ZR8A 3PIIA 3ON5A 2CXPA 4YJDA 3WY9A 2M6LA 2WPLS 4DWOA 2H29A 5A4FS 4LY6A 2XBYA 1DZ3A 3LPAA 2X0JA 4Y2SA 1G60A 4JL6A 4MO2A 5FWYA 3GEGA 3CLVA 2OYSA 2QD2A 2LTAA 1ECBA 4WK2B 1U2GA 2Q5JA 2JGKA 4WLUA 1K8QA 4M6WB 2HLDA 2WTUA 2QX8A 1RYZA 2GESA 3ZXXA 2BUBA 3HY4A 2CFRA 1LZLA 2LP4Y 4QUAA 2ET6A 3RT7A 2LDXA 5ITSA 2C2GA 3D2AA 5AKKA 4RVGA 2FI3E 1TUIA 4KK3A 1L1FA 3R20A 4RPDA 4HLNA 3G0IA 1U81A 4BVEA 3E9ZA 4XLZA 1FQ3A 3EA0A 1P7VA 4GUAA 4CEJA 1KORA 2M9MA 1I24A 1EOJA 2BFFB 4ZI7F 2FXVA 4L73A 3AEYA 1ODJA 4YDSA 1HNWB 2QR3A 1XTJA 5THQA 3UHJA 3TDNA 1A5HA 1RZVA 5JWHA 4Q63A 2PRZA 3KHTA 4EY7A 1AVTA 3IX7A 4OMDA 3C5WP 3EVAA 1F92A 3PGXA 4I14A 1XUIA 1EQUA 4LI0A 4G5XA 3DM9B 4JR2A 4AWAA 4X54A 3S6JA 4L4SA 3SD7A 1Y3IA 3RSGA 3QVXA 1W35A 3W1EA 4Y0ZE 3I5XA 2GZAA 4G5YA 4NL4H 5AVXA 3P9NA 1GPUA 3SJZA 2K5UA 5KTNA 2ZHDA 4CM1A 4BEVA 5CDFE 4EKEA 3AW8A 3DV0A 4FN5A 2P9HA 3KUXA 1XNRB 2WLSA 2BGTA 5K0JA 1BTZA 4K9MA 3DEYX 3HJGA 1BQYA 5E2OA 4LECA 3ESBA 1FPHH 2C4HA 4NYIR 1CUYA 1T8RA 2QRGA 4AW9A 1CUIA 1T25A 2Q28A 3N0RA 1FDIA 5ALQA 5GOTA 4EY4A 3FTPA 4UUMA 5FCDA 5FBZA 4B4OA 4EHNA 1T0HB 4UUOA 4PO9A 3FFAA 1OXBB 5CG2A 2EKPA 5A8ZA 4FOOA 5KJCA 2Z9DA 1HBJA 3QPWA 3I77A 4B76A 1SUBA 3ET4A 4FLEA 1DO0A 4KX3A 4BU1A 1OXKB 5HZHA 2ES4A 2HOBA 5FBLB 2VIIA 1OLSB 3RJZA 4RQUA 3ZDFA 3DBRA 1IY8A 4D74A 4RORA 4KRGA 1T10A 2Q62A 5C1YA 2PM8A 5E3HA 3RC3A 5AOVA 1BEUB 4IINA 3NRJA 4YP7A 2SNWA 2FSPA 3VB3A 3NM6B 3ETEA 3L8HA 1BA8B 1DADA 3TNDA 2J4IA 3IITA 3MBOA 4TQ9A 2EVWX 1QYXA 5JCOC 1CY8A 5DM1A 4BGEA 4PGFA 3INGA 4I5GA 4Q1BA 1JA9A 4XOUA 3C8UA 1W5BA 3RYCB 2OR3A 3E7XA 2GJSA 3EPKA 2I78A 2XYPA 4LRWA 2SGAA 2GJRA 3PPVA 5F1PA 1CEXA 2QA5A 1Q17A 3EVCA 4ZKRU 4M8IA 2QLMA 3PQ7A 1NNLA 5F8TA 1T2DA 4LGVA 4CHAB 1XTKA 2C8LA 1JDNA 4XVUA 2DUJA 2YOHA 1ILEA 3ZU6A 4AU1A 2CLCX 3DCYA 4JOCA 2PZMA 3SXJA 3W79A 1XUHA 4UNNA 4BJHB 1W4AA 2Q2VA 3KYGA 1FFCA 4B7UA 4HDMA 3FTFA 1N8OC 5KNLA 4Z9BA 1GI5A 2H2DA 2XITA 4P31A 1UDXA 2XTNA 4AB8A 1YBMA 1VBMA 4N7JA 2P3MA 2O2JA 3QVLA 3FZQA 1JIMA 2GAOA 4KKDA 5LQMA 1GA6A 1LVMA 2W2LA 3LLUA 2E49A 1SVUA 4R1MA 4AZTA 3G71B 4UHBA 2PBFA 2HALA 5FCRA 3CUTA 1NPTO 3QG1A 4OBXA 4RVCA 2TMGA 5E3JA 1WBJB 1HNXB 2Q21A 4DQKA 1WPXA 3OEHA 4AKGA 3F5DA 1U7TA 4IIGA 1PP4A 3DSRA 1TGNA 2GT8A 3W04A 5ALZA 2PUDA 5LQNA 3SFTA 3EZ7A 1H4TA 1ZPDA 2JVIA 3ROGA 2VIQA 1ZZEA 2ZZFA 1AQYA 2WRZA 1N6LA 1M1YE 1WUYA 2ZSKA 2LPMA 4E0FA 4D1YA 2ZRGA 5F4MA 3U3KA 4N47A 4MVJG 3IILA 3WYEA 4JR0A 4IV0A 2VPWA 4JB8A 4EKNB 1WUJS 3PA2A 5CDSA 1C4V2 3SQMA 2WPDD 3VU9B 2Q3FA 3VKUA 2ST1A 4FEAA 1N8TA 2WMYA 3ZY5A 1Y5AT 3UWJH 2H18A 3HDTA 1BUIA 2AZ4A 4UMVA 3BWDD 4KR7A 2OGZA 4D6XA 2CFTA 2FOHA 2BX3A 1AY0A 4UU8A 1IDN1 3W7AA 4GG1A 4N5HX 3U8TH 4GMFA 4LRXA 3RRBA 2V7BA 3EBPA 1YB1A 4OYLA 1WCXA 1BRTA 1L5YA 1XRSB 2CNDA 4GH5A 4NSNA 2VWGA 1I01A 5LBTA 4H3KB 1ZGVA 4FGWA 2CUTA 1PWEA 3GDOA 3S29A 4PZYA 1PFXC 1TLTA 1HURA 3F4KA 3BD7A 1TAWA 4LVUA 3KSZO 4JI8B 1JSXA 3P27A 3T29A 3OX7U 2R4QA 4MDYA 3SYJA 1TRMA 1M7GA 2OD3B 3M1LA 1MVOA 1KEPA 1JEYA 4XBBA 1XZCA 3M5WA 1KAGA 2OPHA 1XVUA 1V47A 5ALJA 4M7WA 3P9IA 4GQIA 2ZITA 4PS1A 1O2DA 5JDCA 5EFZA 4J0EA 5AKJA 3RXTA 3STUA 4D6PA 2XKAA 3GDUA 3U4GA 2OL4A 5JS6A 5EWLB 4DWJA 5IDKA 2WM9B 1GBMA 1UJ6A 2ZJ3A 5KSZA 3QEKA 1X9IA 2XQKA 3N8DA 1E99A 3VVMA 3ICVA 4LKRA 3ZJTA 4B87A 3LVFO 4KQ9A 2C00A 4RK0A 3FFTA 4Q7MB 5A5VA 2HX1A 2ENUA 1FLAA 2J0QA 4EUFA 2CV0A 3VSCA 4C0LA 4PVCA 4FINA 1SQOA 5BUQA 3RV3A 1U8XX 1INCA 1MHTA 3IDFA 5CDTA 1RYHA 1M73E 1GRNA 4TX1A 5FPQA 4M7OA 1I6LA 1NSYA 4R8VA 5IBCA 1HJ9A 3AVUA 4MO9A 1RBQA 1Z7BA 2Y2UA 3T3NA 1QDEA 1YF3A 4N5IX 3RANA 1B43A 4G09A 4LQLA 2I54A 1P1IA 4X8VH 1K7XB 4YCAA 3W6NA 4LHZA 4RCYA 1JKJB 4DAEA 3ROXA 4DMFA 2W6PA 4JAVC 3M5PA 4EMUA 2FUEA 2F1JA 2IPLA 5I7EA 1CA8B 3GFFA 3LFUA 5DXAA 2C98A 1A8QA 3ODFA 4XQEA 1FYFA 1DSSG 3RDPA 1TKCA 1CUDA 4YQYA 1WBBA 2ESTE 2FPPB 4WXEA 3TNYA 3A04A 4K2AA 4K8BA 1JEOA 1F0KA 1H22A 3C3XA 2RHDA 3DOJA 4RIIA 3SMVA 2C93B 2CGAA 4WK6A 4QPDA 5I7WA 3D2LA 3NLLA 3JD2A 2HTFA 1SURA 4AOQA 2RJOA 4OK3A 5J2TF 1KTVA 1F2UA 1A88A 5HKAA 5EP2A 4N8EA 4RSRA 1NLUA 1W4CA 3I1IA 2QBYB 4H27A 1O94C 2H5JA 4EMBA 1Q7YD 1Z56C 3JYQA 3FDFA 4Q16A 5FUMA 3D4PA 1YMUA 1UMAH 4G1FA 4N01A 2LELA 1NI4B 2INGX 2WQ6A 1FLEE 4MI6A 3WMEA 2XCLA 3BXGA 1BTHH 1M1ZA 3FYDA 3D6NB 2IY8A 4FFDA 2X8JB 3R5SA 5DTMA 4Z3DA 2NQ8A 2P27A 3UAGA 1D6RA 3DOIA 2XUKA 3HM2A 3FFWA 3GCXA 2HDWA 4JCOA 1YU6A 5K8IA 3BMCB 2Q0SA 3ZZ3A 2VP2A 2PWYA 4CRDA 4QU0A 1R0YA 4DC9A 1FPQA 4WXRA 3RRZA 4R1NA 4BTEA 3AI1A 1BIOA 1MD9A 1E60A 1W85A 3X43A 1FUKA 1M7HA 5I7RA 1EGHA 1GCGA 1A46H 2BBTA 4OL9A 4PZUA 5JCXA 1QQ7A 4O2BF 1BHO1 2VTBA 1OFHA 4MNYA 5DYTA 4AFNA 2QF7A 4FT2A 3LHKA 2EQAA 2Q5FA 2R8ZA 3SQDA 3CNNA 4LKOA 2BGRA 3H5IA 3G2OA 1ODLA 2NU3E 1EK2A 4JQCA 5EXTA 1RRMA 2CB0A 1QFKH 2C2HA 3MPOA 1DSTA 1YPMH 4JR1A 1T15A 1NXTA 3UWPA 3TB4A 1MU6B 2HI0A 1PT8A 4UFEH 1ESCA 4K9PA 3UH1A 1RFNA 1HUQA 4N40A 4GICA 1Y9JA 3BCFA 4TTJA 3TQSA 4RKOB 3L6DA 3L9WA 1NUAA 2O5RA 5C81A 3F6YA 1RM5A 1LJ8A 2MOKA 4ER5A 4AZ3A 2OCBA 1ZWLA 4HB4A 5EHQA 1Z5WA 4FKZA 2C5HA 1DWEH 3QPCA 3LY9A 4GE0A 1HOTA 2OCXA 2OK5A 1B73A 2GN4A 5AKEA 1CT2E 3WDSA 4WV3A 4PC6A 3FOEC 1XA3A 2HIMA 1J2UA 3TSCA 1DAMA 1VDMA 3KHVA 1C9EA 1XU7A 5BN3B 1BHXB 4BZZA 4MZDA 5JAZA 2GM3A 2XAAA 2XXAB 2X7JA 4DLXA 3R1IA 2PX0A 2NM0A 3EHEA 3EUWA 2VWPA 4E5PA 1WSAA 4F6CA 1V16A 2IEDA 3GA7A 5UKDA 1WB6A 3DEKA 1ABBA 4HC4A 2QZZA 3ISJA 3STYA 2GEDA 4RPBA 2YXDA 1MB9A 3C45A 1ONPA 4MRVA 2UYQA 4J4HA 4XE4A 4BBAA 1MO3A 2HWWA 1GHWH 4QGSA 2KFWA 4PZPA 1TKBA 3UY4A 1NAHA 2A45B 5FI3A 4QDTA 1Z2DA 1C2YA 2W6JD 1YA8A 4WXVA 1A7KA 1BMFD 2YWGA 1YAJA 1WYKA 2ZVJA 4P36A 1OWKA 4Y6QA 5DASA 2XAUA 2UXCB 3KR0A 4F1JA 1K2I1 5FA5A 2B3TA 2NUPA 1MTNB 5JS7A 3BFPA 1EVZA 5FEUA 2Z4TA 4JI6B 3L1UA 2QX7A 3H1GA 4NZMA 1N5OX 5BSMA 5C8DA 3RXKA 3A1FA 4XWKA 1IL0A 1ETRH 4UPDA 4ZGNB 3C97A 2ZR7A 4NBRA 1P4MA 4M9QA 4MP6A 2JGJA 2B0FA 3JQ8B 1FDWA 1EIWA 1OLXA 2FZ5A 1IH8A 4EPYA 3QFSA 1RLUA 5EKXA 2G9QA 3TCXB 5JI3E 2JHAA 3W9UA 4U7JA 1X8LA 4NZOA 2XWAA 3SJ8A 4DL9A 3U60B 3GEHA 1SXIA 2KW5A 1ORRA 1DBIA 2XTAA 1VL0A 2C2KA 4Q15A 1PEAA 3IURA 4OP3A 5JYBA 4W63A 1MCTA 3WWBA 1PFWA 2MMCA 3GJ8A 5I7SA 4X1SU 3AR4A 1S83A 2PUWA 2YHBA 4BBJA 3MXOA 4I19A 2R48A 4B84A 2W83A 2QQ5A 3E0NB 5EQJB 3TNJA 2BY4A 3VB7A 2HCFA 3TJUA 2H1UA 2ZSJA 1SCQA 2OCPA 4FGLA 4RGVA 2WJWA 1RI4A 1UTNA 1O3AA 1EXVA 1P6UA 2EFDB 1BRCE 4NX2A 2BEJA 2GRJA 2ZB7A 5HBRA 1X14A 4JMYA 4P34A 5G0WA 3AF5A 5FUXA 2GRAA 2FNAA 1MRSA 2QX6A 3MYYA 5LU9A 1V3TA 1WW8A 3UMYA 1YPKH 4RZIA 5HIIA 4EELA 3UPUA 3T8YA 4E11A 4OM9A 2C9CA 2X8AA 5K8VA 2HC9A 3BFXA 2CVFA 4JLKA 1UBLS 1KBZA 1U7PA 3Q3VA 4QGBA 3I2GA 1DEKA 3RF7A 3LDHA 3QYJA 1NUHA 2IPXA 2WU0A 1Z36A 1GGNA 4CQMA 3LD9A 2ABWA 1GLNA 4JGIA 1RU3A 1RMQA 1YIOA 1AN9A 3U37A 1IK6A 4GWKA 1TXGA 3SNCA 1P1FA 4UREA 4NDAA 5CCEA 2V9CA 3TW0A 5DBHX 5IASA 1P81A 3QLVC 2FP7B 2ID8A 1XWIA 3RHSA 1JEEA 2XCNA 2R6ZA 3QFTA 2FUCA 4HB0A 4BFLA 3F9RA 3H6GA 2RSLA 4ZZ1A 1YRLA 3ZHZA 2BDHA 1WV7H 1NB0A 3ZV9A 3U8OH 1G20E 1BTUA 1S3IA 4YJGB 4NFSA 1SEPA 1N78A 1GVHA 2IELA 2FE1A 3ZHUA 1RADA 2Z8XA 1XCLA 4KQXA 2IRWA 1RLMA 4LZ1H 5I5EA 3WGGA 4KAJA 2HNKA 3OIWA 2L42A 3IEPA 3OFSA 4LJSA 4B81A 2VXBA 1HX7A 3KLMX 1AA6A 7MHTA 1S2DA 3HK2A 2XRCA 3LXXA 1N7IA 1TX4B 5T67A 1QLWA 4QFCA 4QULA 4EYOA 2GH1A 2Q6OA 1I7SB 1OVGA 3JQGB 2Z2KA 5D5PA 2N75A 2ZSAA 3G0CA 3MB5A 1O08A 121PA 3NJRA 4MGYR 4M37A 4PSUA 4I55F 5D2CA 5E6UA 1ZGAA 1SBHA 3RGWS 4F4IA 6CHAC 2QTWB 5JZOA 4U9UA 3HEMA 1EB8A 2EGUA 4IJ5A 2QVYX 4QRDA 1NFUA 2ZJ7A 3W3AA 4W7SA 3GUHA 3ETJA 3TM4A 2Q4EA 4I8DA 3H3XA 4NENB 4BVHA 1DZIA 1G8HA 1X80B 1P29A 4IMJB 2B9EA 4V0NA 4QUJA 3PUYA 3DSOA 3IBSA 1PN3A 4LJ4A 1CZOA 3N07A 2IXBA 2KS6A 3EAGA 4HAZA 5IK2A 3LDUA 2I6QA 1A5ZA 3MWGA 4CGYA 3HACA 4ZQEA 4KI0A 5FEMA 5C1BA 2RH9B 3SU1A 1JL3A 4IMZA 2H5IA 1FYVA 3C27B 1YLCA 4D4IA 2P91A 3PMBB 1S3SA 1YONA 3LGSA 4RSMA 2ODNA 2RHOA 3M4XA 4FNOA 3V4OA 4ALMA 1NG9A 4KO8A 5ILGA 3NANA 3B3QA 3LTNC 3CIOA 4AP9A 4ZOCA 4YT7H 4LJ8A 1MKXH 5G41A 4JI2B 4YDHB 1BT7A 5A3VA 1FFBA 3GY7A 5IULC 4W1RA 1K9SA 3HBJA 1SD2A 1VJ5A 2IYZA 4ESOA 2CL5A 5JEEA 4TVKA 1WMBA 3E1XB 1M54A 3VFEA 1MQ9A 3EGDB 3HBLA 3A6PC 4OHPA 3O2NA 1THZA 2M2AA 2ZFSA 2ZA5A 4TWRA 2P40A 1GA4A 4LZ4B 2VNTA 3DE4X 1DUSA 4JODA 4DIFA 1H8HD 3RWBA 1A9OA 4CM3A 1SHTX 5E4JA 1XIVA 3TLBA 4A6LA 1RWXA 4FUTA 4R31A 4QYMA 2HJGA 5LL6P 1TO6A 1AC5A 5MGBA 4EPXA 1C80A 1DCKA 2PGAA 3CMEB 3K7EA 3E7PA 4DABA 1TL7C 1DUEA 1Z7KA 2BE7A 2WUVA 1NJ2A 3KTFA 4NE7A 5K5EA 1QVRA 5DEOA 5C67A 4GC9A 5DBOA 3D4NA 4H35A 4HUTA 1SIUA 1SUIA 3LPDA 2GX4A 3KDSE 4UEJA 4ZA2A 4YRDA 1V2QT 4TVSA 3C87A 3H1BA 3PMHB 3QHQA 4WERA 3ER6A 4WBNA 3C3WA 3H1PA 4MA0A 3CM0A 4L5YA 1WOOA 1N8SA 3SV9A 1T24A 5AP9A 1FFYA 1SXJE 2FXIA 2BFDB 1T4UH 5EMKA 5ESBA 4GR5A 4ID3A 2BZ1A 4CMEC 2HHHB 3SDBA 1O95A 3PDCA 3R7AA 3TAXA 2BTQA 1ZJZA 3LCJA 4WZTA 1Y6ZA 1D0SA 4AS2A 1OAKA 2NZUG 5EVCA 1MV5A 1WXHA 1L4LA 3N9IA 4MP3A 1O9GA 4XW2A 2YWXA 1FFXA 4OQQA 5C51B 3UHFA 1T36A 3Q9NA 2CMFA 4U7PB 3IMFA 1JQJC 5FPPA 3C7KA 3IPRA 3U9TA 1J7KA 3GT3A 3UC5A 4LGMA 4HIZA 2J94A 1XMQB 3OZWA 2WKQA 4WY2A 4JP1A 1G98A 3GVLA 5EPUA 1YZGA 4MUGA 1CIVA 3TLAA 3CT4A 1JU9A 3ETGA 4MHSA 4RE5A 4U2BA 1E8MA 4HFPB 1C9MA 2CHQA 1M8PA 2FOLA 2FX4A 2VJJA 3MJHA 2LW7A 4M22A 1SNYA 2OHHA 3F9HA 2XMQA 2CY0A 2UXBB 5C2ZA 3KPYA 3SQWA 2CC2A 3IBYA 1KSGA 3QELA 3I4CA 1SG6A 2JFPA 1CIJA 3ZW7A 2NXWA 3HNOA 4NCKA 1YVRA 2NZWA 4Q3KA 1RC1A 3MCUA 4J7AA 1F0NA 2EP8A 5EIEA 4EA6A 4KH1A 3H42B 1BVUA 3EIFA 4PLGA 1O58A 5IYWA 3TD6A 1AS3A 4GPGA 3FMPB 4NWLA 2R7NA 2ZTVA 2FLVA 5HZMA 2UZ1B 5ARBA 5AXDA 3KQPA 4NH0A 1E94E 4RV9A 1EEXB 4RN6A 3SO3A 4TOIA 2UDPA 2HQSA 3AERA 3VO1A 3ZJUA 1Q1EA 2P3UB 4R84A 3G13A 3ITDA 3DKIA 4RKWA 1KC8D 4BASA 4BQFA 4YV1A 1NUUA 1MEOA 5T6FA 4TWJA 3OJWA 4DUGA 3CP2A 4PC2A 1SKAA 1KKMA 2H1VA 4Q7EA 3UYKA 2Q4TA 3HJNA 4MZXA 4OD0A 3GPIA 5JLAA 2DLCX 2JGDB 1QHYA 4F7WA 2Z3DA 1NI3A 1E3IA 1HF3A 4PSDA 3SNEA 1EZZA 3I30X 5DCLA 4Q6WA 3PC8C 1HL3A 1IY2A 4WNAB 3S68A 1BGWA 1PI3A 2NV4A 4IJMA 4G1BA 3D2BA 3KDAA 3OLVA 3OQNA 2H9EH 3L3BA 5B12A 1KS9A 2A1UB 2C3OA 4KR3A 1GJ8B 1X42A 4OXKA 4RENA 1Z0KA 4CEHA 3V8EA 2K1QA 2XNCA 3QTVH 2Q2WA 1WO8A 4D4LA 2RKOA 5FD8A 1RTTA 1N1EA 1T9GR 5IWAB 2G28A 1USKA 2HN9A 1NVKA 3UFXA 4IXWA 2BDCA 2ZFTA 2SBTA 2H6MA 3Q9LA 3E7WA 4YESB 3O8OB 4NSYA 5HA5A 2AN5A 3EZFA 1APBA 3DL0A 4MUAA 3AW0A 1XOIA 1HCGA 2JFWA 3O3CA 5ESDA 3LX5A 1Z5GA 2O06A 4KQIA 1QBGA 2D06A 1PTJC 5E6RB 1O5OA 4GMKA 2N46A 2QN3A 3A1UA 3PHHA 1E4EB 5L3SA 1JIXA 1O5AB 1SEVA 3HJCA 4EUHA 3C6XA 4FQ8A 3DDCA 2B8WA 4P0TA 2QV7A 1NVFA 2OAEA 4LF9B 4LZPA 3SS8A 1N0VC 3JTMA 2NLOA 3HYNA 1G8PA 2Z9CA 4YLQH 4KDEA 2Q4DA 3K0HA 2P69A 4BVAA 5EXNA 1JJBA 3EPPA 3PXBA 1VQPB 2GYUA 3R40A 1NN3A 1MW8X 3LDGA 5JANA 1Y98A 5FBKA 4IXTA 5E4YA 1Q0TA 2R8YA 3ADPA 2RDLA 3PXGA 2OE2A 4MI1A 1FXSA 3FTQA 4C7BA 4QGAA 4BAKB 5EAIA 3IIEA 3PWBA 2P68A 5EUQB 3N7OA 1A0HB 1DFGA 4O2AB 4TUYB 4UAGA 2MSDB 4CKEA 5LD2C 3QW4B 3W90A 2FZGA 1BBRE 1ZHOA 4BGVA 1OILA 2H85A 4EJSB 2W2KB 1ATIA 2DJ5A 4LV6A 1FTWA 1X1TA 5DMHA 4NZLA 3VNQA 1NRWA 1DM4B 5KEIA 4OQEA 4ZMBA 4GT1A 4QPJC 4CHGA 2QM0A 3C2QA 3EXIB 1VMIA 4I4TF 3IVGA 2RGRA 2XW6A 4N65A 5EVJA 2IHUA 3O4FA 2C7GA 3BGWA 1NKVA 2GCIA 2DWUA 1IN7A 1RWOA 2F1MA 5KQGA 3RYHB 1KI8A 3U1JB 1QIHA 3BTGE 3RO7A 3L93A 2NTVA 4IYJA 1GVKB 1KDQA 5LZ5A 3ZY3A 2JIMA 1A7AA 3VYRB 4IDHA 2ZWMA 4ARSA 4U9IS 4YTAA 1KDVA 4Q34A 1E0AA 1ZINA 3CLRD 3EBOA 4MR8A 5G53C 3EXIA 4ZVOA 5BRAA 3WAJA 2C95A 4WH8A 1ADGA 3USCS 2DFDA 1OVMA 1CE8B 1W2BB 1FVOA 3TIGA 5FI0B 4CEIB 2E3JA 3PRYA 1ZCFA 5L3VA 3OCUA 5T4FA 3R0JA 3GD7A 4PAWA 3UHAA 3P94A 4EJSA 1KE2A 3EDXB 2X3UA 3CRRA 4O4LF 4ZYWA 1Y3XA 3O1HB 3DT0H 2HRBA 4TLMB 4DOMA 4POOA 1X9GA 5DP6A 1Y80A 3D4OA 4DLAA 2O8EA 4OU4A 2FLRH 3DHWC 1VR1H 5DN9A 5DNDA 2JFOA 2R00A 1IQRA 3DOUA 4GP6A 4H9GA 2I2CA 5C34B 3BULA 1Z8RA 1U8YA 5G4LA 1COZA 2A5YB 4DREA 2BXUH 3FM9A 4UEHH 1TD9A 3L8FA 2I8AA 1QTQA 4KVZA 3SQNA 2ORED 2JH5D 2A4OA