4B6SA

Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Mechanistic basis of the inhibition of type II dehydroquinase by (2S)- and (2R)-2-benzyl-3-dehydroquinic acids.
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Lyase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 4b6sA00
4CIWA 1D0IA 5B6PA 4L8LA 4CKWA 4B6PA 4CKYA 2XB9A 4CIXA 1GU1A 2WKSA 2Y76A 3N76A 4CIVA 1GU0A 4RHCA 4B6SA 2DHQA 2Y71A 2C4WA 1H0SA 4KI7A 2C4VA 4V0SA 2C57A 3N8KA 3N87A 3N8NA 3KIPA 4KIJA 2BT4A 2CJFA 3N7AA 4CIYA 4CKXA 4CL0A 4RC9A 2UYGA 2XDAA 4B6RA 4KIWA 4KIUA 3LWZA 4B6OA 1J2YA 1V1JA 4ZC1A 4CKZA 3N59A 4B6QA 2Y77A 1H0RA 5WRFA 4CKWB 2XD9A 3U80A 2XB8A 1UQRA 1H05A 3N86A 1GQOA 1GTZA
chains in the Genus database with same CATH superfamily
4MUGA 2RE8A 2BUBA 2WU4A 5GONA 2SHKA 4PZPA 1IB6A 4WOPA 2N75A 2MU1A 5REQB 5JARA 4RACA 2EP5A 2DOKA 4GMDA 4GWLA 4KUEA 3FETA 4IEIA 4U9UA 2Z09A 4HEHA 4Q05A 5U9CA 1Q57A 2IPOA 3A27A 2G9RA 5IBRA 4BVEA 1RHUA 2ONZA 4QHYA 2VYFA 2PIDA 4XWAA 2WNHA 4IMRA 5TQ0A 4Z4CA 4C5AA 2FW1A 2J3LA 4TKVB 3CO5A 4L75A 3IMKA 3WLIA 2JCVA 1SCNE 4HB0A 1A77A 4GR4A 4HX5A 2QLNA 5BORA 5I45A 4E31A 1DKQA 3ZK8A 3ILXA 4QAQA 5AM0A 1XXHA 1IM8A 3TD9A 3V97A 5G4KB 1QFYA 3HLKA 2B0CA 4IOLA 3C3XA 4G67A 3QU5A 3MWYW 4BFUA 1MJFA 3RC2A 3KAJA 2O7QA 3Q6MA 3N0TA 1HUQA 3RAPR 5CGQB 1GSOA 5FTMA 5BSMA 1PJLA 3NOVA 3QKSB 3WAKA 1EQUA 2GZ1A 1RAFA 2V6BA 2W4IA 4QDKA 2GCGA 3N39C 1USGA 5JVDA 4CG0A 4L50A 4YXFA 1QYDA 2DT8A 1Y6GA 3HR4A 2QLLA 3N0VA 4XWOA 1FS4A 2C1ZA 4R5HA 4NJOA 4QJ3A 5KCZA 1L5ZA 4ACBA 1KYTA 1NLYA 3COYA 3TSCA 4B8YA 3ZQ4A 2YHIA 4H6WA 2VA9A 3T9AA 4JMPA 3W06A 4DLWA 1JKJA 1XB2A 3IMCA 2FSFA 3CNLA 3O8LA 5DXJA 2O3UA 2QX9A 2VHWA 2BD0A 1AGNA 3JQAB 3HXMA 3QYPA 2UYQA 4K0RA 3ZWKA 5K6AC 2ZRBA 4OCZA 3GEEA 1L5HA 5FWAA 1D5CA 4FINA 4BNMA 2IZZA 2QJRA 4UVHA 3PA8A 2UZ0A 3F3YA 2DG2A 2ZBPA 3AO0B 4NESA 3M3HA 4DY4A 4MPPA 3VMFA 1RMYA 3PNMA 4G4SP 3AYXB 3IHTA 4IUYA 3WKCA 3GLGA 4HFNA 3W05A 5KJ1A 4L78A 1O9HA 2P8SA 3DZ8A 2JAHA 4D9HA 2PUEA 1NBMA 4TZTA 2P75A 1SOAA 4BB9A 2G28A 1T43A 1J7JA 1DLJA 1SR8A 2V7QD 3T34A 4GEGA 5AVVA 1NNEA 3D7MA 4CFZA 5AVUA 3U5ZB 4XB1A 2BFOA 1Q1EA 2OY0A 4BB6A 1Z2EA 3C3MA 2VZ8A 4OP2A 5HIMA 3AW9A 1MX5A 3GV0A 4M1QA 1Q1AA 4OL9A 4JJ8A 5HHTA 2PVSA 2I65A 3ROEA 1UT6A 4O4JA 1B15A 5G02A 3C1UA 3EGEA 2P0YA 1NURA 3ONDA 2QKYA 2HI0A 3HZOA 3OE4A 4B17A 3KG2A 3NLLA 3WG9A 4ECEA 1SELA 3DF7A 4IG4A 4P08A 4ZYVA 5CB4B 1T0HB 1VBNA 2W8BA 2BEWA 3G8BA 1C4XA 4LWQA 1P33A 4A5SA 4PYIA 1H8EA 1UKVY 5FBZA 4A6PA 3ZPXA 4JLBA 5ITZB 3A3NA 2ZVDA 3V8QA 1GITA 4J3FA 1DTEA 1YDFA 2QRGA 3B6MA 3PQ4A 2ONYA 4LTNA 4HLUC 2VRNA 3BIOA 5AOVA 1NLMA 5H83A 5J5VA 2IDMA 2CE2X 1T25A 1MAAA 2QSZA 3ABZA 3T7IA 5KJ6A 1FP4B 4KSYA 1NMXA 5DNEA 4B6JA 1U04A 5GM1A 2IEIA 5KQMA 1CUIA 3KQHA 3AFOA 3JPWA 1J2EA 3QTLA 3OLYA 4WFIA 2IHBA 1CZUA 2FFQA 3A4MA 1IU9A 1NDUA 2N1BA 1A7UA 3EDYA 1YQ9A 2H29A 2YHBA 1TYZA 3H2KA 4C7JA 2G0AA 1CUZA 2WAMA 1RCUA 3AUAA 3OTIA 3R7NA 5IMBA 2Q2NA 5HF6A 3LI2A 1ULTA 3E1GA 3O4JA 2OZKA 5CDHA 1G38A 1KMHA 1SC9A 5BMVF 1PCXA 3KZVA 3QBJA 4BXOB 1AK9A 1RS0A 2WUGA 3DXYA 4PS0A 4RZ3A 5EWMA 1A7KA 4MIKA 1WXXA 3VQTA 1K8YB 2ZRAA 2VP0A 3WMXA 1BXRA 4TM8A 4BV3A 2YYAA 2FQXA 1HFKA 2RK3A 2PDAA 2VKTA 4X44A 4A1FA 4Z4GA 5ES4B 5CMLA 1TF7A 5AKIA 3TGPA 4FYXA 5KWEA 2CZQA 2JLQA 4LWOA 1DELA 1QYXA 4LW8A 3U19A 1W7AA 1DQYA 5A0TA 3QLVC 2XDQB 3FNBA 2C5AA 4GDMA 3C6ZA 4NXMB 1C7ZA 2GEKA 4BNLA 3DAPA 2CK3A 3KT0A 3RRJA 4AN4A 3HDQA 4N18A 1EFPB 1Z7GA 5CUQA 4X1YB 3LXRA 3RG2A 2X7HA 1PVDA 1Y8QB 4K1XA 1O1YA 5L3RA 1X9HA 2ACVA 2QRJA 2ZRNA 3FCAA 3ANYB 4GBED 4WY2A 1MDBA 1I1NA 2P1ZA 1KZ9A 3HO8A 1X87A 1H2HA 4O1MA 4MUXA 4Z7JA 4CCWA 1U6KA 4HJRA 3U4CA 2WAOA 3C1TA 1PR0A 4F71A 1ONPA 3UHFA 5EJ4A 4IHKA 2EW8A 4RWZA 4CKCB 2J1LA 2B7CA 2J59A 3A1EA 1KMIY 3CH6A 3DCNA 3RVDA 1RPAA 1B6SA 1R16A 3G1TA 2OD9A 4MPDA 1L5GB 2WYHA 2C59A 1ZRMA 5CDSA 2OR3A 1SUSA 2PZEA 4A4DA 1LPOA 1QZZA 3GP3A 4ZIRA 5CXSA 4Q6WA 4YR7A 3E3AA 3E5HA 3SE0A 1P1CA 4IQ8A 1TW2A 4UXJA 2ID9A 1BCSB 4HH0A 3EVTA 4D5GA 4J2OA 1EFUA 4LDQA 2MJLA 1GTZA 1YB6A 4GX2A 4V24A 5KNBA 1OREA 1GUDA 3WL7A 1FQKA 3NAZA 3D8SA 4EUKA 1LI4A 1E98A 2OG2A 2ZSHA 4Y2GA 4PHCA 1MT0A 1UFOA 2KI5A 5HJ5A 1UJ5A 5E4YA 2NZVG 4FNMA 4YHHB 2PD4A 5BN1A 2ZI6A 3EZGA 4GGPA 4KG7A 3ND7A 4L9AA 3T7CA 5TXGA 2VSNA 4RY0A 5D1NA 4AO7A 2B8WA 3LA8A 2VWHA 1I9CA 4QXPA 3BS4A 3W5IA 1OLSB 2VDJA 3G0CA 5EWJB 4A0FA 5FQNA 5IULC 5K8UA 2CD7A 3H1TA 4XAQA 4CKEB 2J07A 1IEQA 5DW0A 3UW1A 2YKGA 4ZAXA 3URKA 2GZRA 3RLIA 1M6HA 2RGBA 1DIBA 1JXOA 4X90A 4DNPA 4PX9A 3Q8XB 3I05A 1E9AA 1EX9A 4L5IA 5A5VA 3JQQA 1XL0A 2PQ2A 2PRKA 2ZUVA 3OT4A 2A0KA 4N9QA 1DXHA 1Z2AA 2G7ZA 1DXQA 4XVUA 3RBXA 4IRXA 2A86A 3DMGA 1Y4AE 1JR3A 2Y9MB 2TMKA 4G89A 3OOWA 3ADOA 2PFGA 2QTAA 1GQYA 3LC0A 1YRQA 3ENKA 3E3MA 1GZ3A 3FFTA 3OPYI 3PYXA 3NHSA 2OLEA 4V0KA 1PJBA 4ABTA 2Z8YM 1JLSA 2J67A 2ATIA 4KI0A 3T1OA 1K98A 3D4BA 5H8WA 4RDIA 2GMWA 1QK3A 4NOJA 4WLFA 3RVPA 3WLLA 2BFCB 1FYDA 3T9FA 3NT5A 4DCGA 4E33A 4W6QA 5BMVB 5DNVA 3LKBA 5CH3A 5AJVB 3KJIA 3KXDA 4MR9A 4IGIA 4LI3X 4DV3B 4YC7A 3GAFA 1FLVA 2HK6A 2TSYB 4BMYA 2VJMB 3RF7A 1KETA 3RS3A 4MP8A 2LDBA 2O6HA 2IELA 4WCFC 5T3YA 2RAFA 1JRLA 3MT7A 4JX9A 1NN1A 5EMHA 2B5WA 1Z4KA 1RNLA 4MQ6A 2HRQA 5IC6A 5I4CA 1YU9A 2BF4A 1KHHA 1J2UA 1L4GA 3GFGA 3P5SA 1KMMA 3N8KA 3OZRA 5CURA 4CT4B 2YXLA 1ZEJA 3GW8A 5AM3A 3MIZA 1S02A 1IVYA 1OI3A 2IOFA 4IIHA 1IM2A 1KIAA 1S8AA 5DM2A 3RWBA 1DIOB 3UFXB 5EQDA 3W5JA 3H9GA 3R4CA 1D2CA 1ZN8A 4UNPA 3RVKA 4F5EA 4AY6A 1YE3A 3FOCA 4B31A 3B3FA 3LHDA 2IXDA 2K2WA 3RSSA 1A8SA 3KFVA 2CNWA 1T8TA 1WXQA 1Y1PA 4PYRA 3WGQA 4A8JB 1RJ9A 2C8JA 2K5UA 1J4AA 5ALQA 2Q50A 3VR2A 1K1EA 2QYSA 1D3AA 2GYUA 3A11A 4GOKA 1N77A 3MS2A 5HG0A 2I34A 2O0HA 4F6RB 2QM8A 3AEZA 3V7WA 4Y0NA 4CNQA 4B7AA 1Z2DA 4QUGA 2YV1A 2DHCA 2PR2A 1P2DA 2PT7A 3EFEA 4M3NA 3O84A 4MQ5A 3RC3A 3T95A 3IPAA 3LMKA 1JQ3A 4B47A 4TLAA 3JR3A 1UXIA 1XKQA 2Q5OA 3CHYA 3CF2A 1Z5ZA 1XTJA 3GN1A 4FNGA 1IUKA 3LQKA 4DMKA 5JZBA 1EU1A 4UASA 4XWTA 3VNBA 3WP1B 5M2QA 3JASB 1RZVA 1TMYA 2MT9A 3R74A 5EOVA 2ZYHA 3GROA 3JZAA 3LUJA 1PZFA 2VP5A 4ZXPA 5AHXA 2H63A 3ZOKA 2JL1A 4YMWA 2OCAA 3DZDA 4DLLA 2I7DA 4NXNB 2ZSKA 2Q3JA 4JWKA 2C2ZA 1B0AA 2MMCA 1DXYA 2VYVA 4TPKA 2N46A 5ALTA 3QSYA 4ESOA 3WOVA 1V8DA 3BH0A 4OG2A 1YZNA 4U8HA 3F6BX 4QREA 3ORFA 3KJZA 5IZ4A 1OX6A 2NO1A 1P5HA 3H87A 2HRDA 3NHBA 5DNDA 1HKUA 4L4XA 4UZSA 4ZODA 4EYQA 3LY5A 4N82A 5LMUB 1Z45A 2QTNA 1UF9A 4RIHA 5FEMA 5C3MA 3DJYA 3R6WA 3ENNA 4HN4B 4V0QA 1SU6A 1EEXB 1VMKA 1GQ2A 3H0EA 9LDBA 1S2GA 1KI6B 3WIOA 1EYZA 1QONA 4MUIA 1Z88A 2BGUA 4JQSA 1HLPA 2E4AA 4RA6B 1QPBA 5C8YB 3PIIA 5J23A 1KRXA 4TQGA 1U7TA 1W9MA 1FTYA 1JEQB 1U2DA 3TQTA 2A9JA 3I64A 4L2IB 3ELWA 2M1ZA 5ADUS 3COWA 1GZUA 1E1DA 1QOZA 2X22A 4F8EA 4GI3A 4RELA 3OQHA 4LWPA 3RIXA 5L3QB 1UT8A 3KEQA 4FHGA 2JS7A 5EZYF 2GSWA 1R18A 3ILVA 2IHKA 3UC5A 3QWAA 4RMHA 2WM8A 5KOHA 1M34E 3QA3E 2IY9A 4LGVA 4GPTA 2NVWA 1RQ7A 4ZC8A 5GIPE 2QU7A 3QRWA 3DA8A 4OMDA 4RAQA 3S5JA 3ZVNA 1G64A 3MRXA 4S04A 1BYUA 3AF5A 2C4MA 1G3IA 5BW4A 2ZW9A 3IP1A 1KZ4A 1WW3A 4R8RA 5TQ2B 3E27A 1U28A 2J45A 2PXHA 4E14A 3RYIB 4B9EA 1JQDA 3B3JA 5DOVA 1E6LA 1H0KA 3LM8A 2CL6X 4JYBA 1RKVA 4UARA 1NI5A 3EBLA 3VZDA 3B2NA 3WI7A 3OFND 4LY0A 3TI7A 5A3RA 3F90A 5AW1A 1L7AA 1TUIA 1P18A 3DCIA 3L46A 5EKXA 4PLVA 3RTGA 4DCCA 4QSHA 4P3KA 1YB4A 4AJHA 4RABA 5TLSA 3V1LA 1Z35A 3QVWA 1NVVQ 2AQHA 3HR8A 4G4IA 4Y6PA 1DBPA 3W90A 2E1PA 1S4QA 1I3OA 2HCRA 2LKCA 4Z0NA 4LRSB 3VPBA 3ZTTA 3OZVA 1ONSA 4JAVC 4JLOA 1RBZA 2FP4A 4KAFA 2NVOA 3O8QB 4LYYA 1GM5A 4EB8A 4XX0B 1ODFA 2JGAA 4ZANA 4EMSA 2G82A 3GGSA 5A9SB 1R12A 3UKDA 1MU0A 2YOGA 4LVOA 4V0OA 1B0PA 1FFDA 1BYIA 3WNVA 1NVMB 1ZP6A 4ZVNA 2EERA 1N2CE 3AIIA 3PHGA 1GDTA 2R85A 3I92A 2KYRA 2X2PA 3T7RA 2FKNA 3HG7A 5LQNA 4C6TA 3ID6C 5D86A 2DZDA 1EFRD 1GAXA 1EFRA 4Y67A 4IDFA 2NUTA 4EUNA 1E2JA 3GELA 5JZ9A 2FDRA 3L8ZA 3LP8A 3NIWA 4RHUA 5KDLA 4E1BA 3OQIB 3R4VA 2CFCA 3FZNA 1RQGA 4JP1A 1TEHA 1VGQA 4QXMA 2VQDA 4UM7A 3MMXA 2JFNA 4F2GA 1Q22A 3RYHB 1Q1GA 3WLKX 2F1HA 5FOTA 2R8ZA 4ALNA 4XARA 4ENTA 1W4ZA 2R79A 1Z9BA 4E7PA 1MRZA 3A7EA 4INJA 4BRWA 4XSVA 5CA1F 1GSHA 5FI3A 2BMFA 1OWPA 4LA4A 5B3KA 1PJQA 4X6YA 2P9JA 4D99A 3OUTA 3REFA 3WGVA 1ZK3A 3OJCA 4JP8A 2XA9A 5EZSA 1YT5A 2G6BA 1TQ6A 1R7RA 3MGGA 1Z28A 2HU7A 4RLFA 3M49A 1GU1A 1RYYA 4O1HA 3OZFA 3QPBA 4B3BA 2SICE 6NULA 1D6MA 2M2IA 3KDPA 3O1HB 2JIRA 2V1XA 4HL6A 4QOSA 5K9ZA 2Q9UA 2FPXA 5EKUA 5DGCA 4LJ5A 5JZVA 3UGKA 5HTKA 3GJYA 2ZUSA 3LUHA 1IN1A 4M37A 4CR6A 3TXAA 4NU0A 2XNKA 4RF4A 1SC6A 3WE7A 1N5DA 3Q85A 3W5AA 5J4YA 3HWX1 1MH1A 1Z4NA 1FMTA 2OV8A 5COQA 1E2MA 1FUKA 1QC5A 1N1DA 1T4MA 3FUTA 4PHHA 4IFTA 2PH3A 3AETB 1YWGO 1OI7A 2ZAIA 3GLUA 1U8AA 5JAOA 3TR0A 2E7ZA 3F7TA 1SXPA 1O95A 3GUZA 4R8LA 5DNCA 1TTTA 1SULA 4RESA 3VU3A 4L0QA 4Q48A 4C89A 1Y9DA 4XDYA 2PWZA 2XUPA 3ZY4A 5IJZA 3ADKA 3EVAA 1P2FA 5E7IA 1DC5A 4FJ1A 4DY6A 3H05A 2NO5A 2VPZA 4FYKA 5A06A 2UVPA 1XDWA 1TTHA 2MSEB 1N2EA 1EB9A 1IBRA 2VHTA 2WIKA 1DQZA 2YZNA 2VDOB 2Z2ZA 2ZG6A 3FDZB 4GP7A 4TQAA 1YC2A 5D2CA 3BIWA 5T64A 5IMSA 3NORA 3QWIA 2E21A 3OURA 5AI6A 5FUMA 2OFPA 2QE7A 3OP4A 5IM4F 3G02A 2ZI5A 3CX3A 4FILA 4JB0A 4KVAA 1JEYA 2QMZA 3DTNA 5J2UB 3H2JA 5F2EA 3OM1A 2GN6A 4M9CA 3MCZA 1IEXA 4Y2JA 3TRIA 1UC4B 2WTMA 4FU0A 4KZKA 1U0SY 2G25A 2ZB2A 5HILA 4B4DA 4TV9B 1CBUA 1E3SA 1R6XA 1I2MA 2OBNA 3FMFA 3FTNA 3LYAA 1TXGA 3NBAA 3I6ZA 4GAEA 4IO0A 2BSQA 1WSBA 1QYCA 3R20A 3K9LA 3Q41A 4HNVA 2AG6A 2FSGA 1WXHA 1YQWA 1U2PA 4ZAYA 2WPNA 1OFHA 4CKEA 2H4ZA 1KQNA 3ZWMA 3U60B 3BMQA 3CPHA 4I2NA 3KRTA 4I4TB 1NRIA 1NMYA 2NWQA 4JL6A 3A4NA 1VPVA 1X1TA 3QVXA 1YDGA 2ZIZA 5JVDF 1L7VC 4PG5A 1GYQA 1THGA 1GTRA 2WJYA 4YEDA 1V1MB 5DCWA 3K8ZA 5AXDA 2PKEA 3WV5A 4HK4A 4Z4FA 1A8IA 5JPDA 2V6MA 2YWGA 3U9SA 4YFYA 3STTA 2JFWA 1IXZA 1SOUA 4FFLA 4X41A 1RZRD 1MC5A 4KQJA 2XOEA 4TMTA 3SKXA 1T5BA 4EM6A 3DFKA 1UBLS 3AR8A 4ZCIA 1YS6A 1KP2A 5E8JA 4H08A 4K2AA 1KK3A 3TQOA 4LSMA 1QYIA 2MYPA 5DI9A 1TZCA 2VDMB 1QH8B 2Z4SA 4UTXA 1KYQA 4ENWA 3O8DA 2A57A 3D3KA 4J4HA 5G40A 1GUBA 1GCGA 3U31A 2A1UA 3PC8C 5IX8A 3EF1A 1JHQA 3K8OE 2Z58A 1Y1LA 3I2IA 3LOUA 2H85A 1I01A 4OQXA 4IVRA 1PEYA 3R7WB 2YXDA 4MYHA 3L8CA 5FI5A 2D4AA 1E4EA 4PLTA 4U0JA 3N05A 2G9UA 4DARA 1IJFA 2WKPA 2WIJA 3IDAA 5CBPB 1V5FA 2LUOA 2XUZA 4MO2A 1HSOA 4H4CA 5EWLB 2NACA 1S9HA 2X0FA 3GVIA 3KWLA 4IFIA 3LK6A 5I7HA 1QNFA 2XECA 4BE9A 2XXAA 3LNCA 3GUUA 1GU0A 1PKEA 2DUJA 4UMFA 5CX1B 2QROA 2RGDA 1GN9A 2I2XB 3AONB 3FHLA 2VYQA 3GCZA 3IT1A 1R9MA 4RJ2A 4E94A 2PX5A 4HT3B 1JKFA 4G36A 4GU5A 5E6UB 2QWXA 1XEXA 5U4XA 3R8XA 2C82A 3SPXA 3WWDA 3VI4B 1ULHA 2Q4RA 3CH5A 4CMIB 5JR3A 3NHYA 4GMGA 2FUNB 1E4EB 1JDSA 1UH5A 2JEOA 2GN0A 2RIPA 4GKJB 1E0JA 3AERA 2K6GA 5LZ5A 4V3BA 2PSSA 1G8KA 2WFLB 2QRMA 3G85A 4E11A 4CUZA 3H1AA 3UUFA 1BU8A 1N1MA 2JH3A 1D0VA 4HO1X 1Q92A 3BPSA 3A37A 3DKPA 3K7EA 1NDQA 2PX0A 1ITZA 5BQOA 1D4OA 2I4OA 4Y1GA 1B4DA 1GNRA 3JVEA 4Q7JB 3V33A 3U1TA 1R9GA 3GP8A 1NSYA 5C8ZA 2JLRA 4MWEA 4YRTA 2PEZA 3ORYA 2C03A 3KKMA 4LOIA 4WZBB 2DBZA 4N0MA 5EZYB 1DQNA 3UKJA 4XVCA 2O06A 3JD0A 1EEHA 4RS3A 4KK3A 5ARBA 4D9GA 2O8FB 1Z0JA 2EW2A 2WP0A 3W8DA 4LZZA 1E9CA 2FSVC 1LPSA 2C95A 4LHYA 1JR2A 4CETA 4BQFA 2WHXA 1R9JA 3LG2A 3QOYA 4O4IB 1W8IA 3NGMA 3WDKA 1Q1NA 1OTXA 2B7BA 4W99A 4DFDA 2ZITA 2ZJ4A 2JK0A 3UG6A 1HKHA 1CP2A 3H5NA 1N0VC 3ICQB 2XMBA 2E0IA 1PV1A 1K66A 2KB0A 1PFWA 2R6DA 2FW8A 2WOOA 3GNSA 1DIRA 4L0MA 1NY6A 2V7TA 2BE9A 4BHTA 4RLSA 4JV5B 4EFNA 1UWCA 4FDLA 1MH9A 2O6LA 1V2GA 2H0QA 5IW8A 4K6CA 4GSLA 3GIWA 3ER8A 1WCV1 2IW1A 1E92A 1XAGA 3Q7PA 4PFSA 4QOHA 5IXSA 2XVXA 1R0LA 1E94E 5HCIA 3RU7A 3S6JA 2IRWA 2ZXFA 4H27A 2V97A 3OLZA 2AOVA 2KLBA 1XTVA 2OK8A 4KX5A 2IL1A 4YJ2F 4LFAB 2JAUA 3PSHA 4KBYA 2ZTSA 1QIEA 4ENPA 1DCKA 2WV9A 3G5TA 1DQSA 3ZK7A 4BN4A 5IDQA 2CSUA 1BMQA 4WGGA 5DSTA 4RM2A 2PKQO 4DM7A 4FEGA 3M4XA 3WK9A 4KV7A 1KZ7B 3S28A 1QTRA 1XROA 4RXTA 3JV7A 1Y4ZA 4HSEA 3TW8B 3E48A 2XDQA 4N5MA 2O7VA 2COUA 2ZRJA 4KO4S 3MFYA 1LS6A 3EXEB 3KB1A 2BR4A 8OHMA 1T2UA 3ZCRA 3PC8A 1FP2A 4IS3A 4P4NA 1G4UR 4F97A 3U1VA 2R8EA 4MX8A 1W88A 2QMOA 2VLIA 3WNDA 3EGVA 2B36A 1D4ZA 5H9WA 4BTEA 3VUEA 3LGXA 1Z0SA 2JKVA 2X42A 2Y0PA 5DU2A 4BX9A 3GRPA 2BM8A 4Q66C 3UYLA 2WQ6A 3O8CA 3OICA 3B1FA 2AFHB 5EMKA 3KUXA 5CB6A 3CUTA 5HQ3A 4UDOA 1KFKB 3SI7A 4YQYA 4OPMA 3MJTA 3NNSA 5JO0A 2ADOA 4B4VA 1M7GA 4K9KA 2HV8A 2JLXA 4AB1A 3C39A 4BJ3A 4D6XA 4O2AA 2BKAA 5FHQA 4R1LA 1G5FA 5DULA 4PLCA 4S1NA 2F8MA 1XEWX 4XCXA 2GK4A 3IR7A 2G0NA 3THOA 3ZWXA 1OQAA 1VFNA 1R6DA 3KB2A 3ME5A 4YUAA 1ZCFA 2R7KA 1C0LA 4HMOA 1IDN1 4GXNA 4P82A 2IV3A 1YS7A 4FSHA 5K4AA 3SY8A 1WZ2A 1MABB 4UM8B 3FVWA 5J1TB 2G9ZA 4AQDA 5HE8A 1I7PA 3RBVA 4EG4A 3IL2A 3OETA 3AUJB 2XBMA 1Y3BE 3JYNA 2YV4A 1PR4A 1USUA 1L5RA 1N8NA 3SP1A 3IIJA 4P7JA 4EPTA 4DUGD 3NH9A 1M7HA 2A33A 2ZSIA 5E2IA 1LVHA 3SXPA 5HFAA 1AB5A 2A9FA 4I3FA 3O8BA 1OJLA 2NTEA 3GT3A 1DEKA 4TLLB 2IYNA 1KPHA 3HB1A 4I5IA 1K8ZB 4GMKA 4M21A 4BAGA 3A10A 1CV2A 1R0RE 3DKKA 3HCPA 1ZH0A 4YT8A 3SLRA 5CLJA 3KJXA 4M1EA 2AC2A 3WGUA 3D43A 4TRRA 4Q12A 6GPBA 4OQEA 2ZQYA 3KR0A 4WKBA 3T5BA 2DUWA 3Q1KA 3R9XB 1ZK1A 4N6NA 4CKZA 2B3DA 1ADJA 2FLKA 2ZJ6A 4RTLA 3BB1A 4C4YA 3WHPA 5EUQB 4LMRA 4FCVA 3W5BA 1FVFA 3MF4A 1CNMA 4O4LB 2V7XA 3DW3X 5JSHA 5CGZA 3I6QA 5BR7A 3P2EA 3GLFE 2NOAA 2EV9A 3CKMA 3MMZA 2A1UB 1F0YA 2O2GA 4UQLA 3TNLA 4D97A 5JUWA 2WUDA 4CEIB 2QA5A 3S27A 4KIFA 2EOAA 4BWVA 5BV1A 1L5NA 5EJ6A 3BT7A 4B85A 4TKUB 2R6GA 4DM4A 1NVAA 1OBHA 3RAEC 1EBBA 1U8UA 2W93A 2GZMA 3LW8A 3NWPA 4L9SA 4N3NA 1NSFA 3V55A 1C0KA 2GRUA 2IGTA 1OSNA 3PFKA 3T52A 4QEKA 2FPUA 1G8AA 3PLNA 3L8DA 1FMLA 1PD0A 1M6NA 3CPJB 1WOYA 1YC5A 4FWIB 4PLFA 5EVCA 2IV7A 2UYCA 1ONBA 4JFAA 3I2YX 4LBYA 1ZVJA 5AUPB 4G8JA 2BI4A 1YHZA 3FGPA 3WGKA 1T8YA 3WLEA 3GFBA 4IHJF 5FT9A 3HSKA 1ZU4A 1PGJA 4IJVA 2XNCA 2BKLA 3FVTA 621PA 2FVXA 4KTVE 3KUUA 1TECE 1RAGA 3MAAC 4MYDA 3WFIA 1L3IA 3C97A 1COZA 1PK9A 1WXGA 3EUWA 4Q9IA 2NUAB 5LKRA 1QRSA 4RTQA 1FFXB 1XHLA 4W9NC 3IYLW 1G8FA 2PXXA 3OZBA 5LBTA 4DT1B 1UK9A 4BGDA 4D9MA 1G1MA 4LJRA 4HNAA 2YS6A 2B99A 1FFHA 3C48A 1I80A 1A0OA 1NHWA 4AJIA 4PZ0A 5IARA 3DBLB 1MIHA 2GQ0A 2KWIA 3FI9A 4EIWA 3JALB 2XQKA 3RE1A 4BNNA 1ZXBA 2QN9A 3DR3A 2JI8A 2IIBA 3WB9A 2XDAA 1U6JA 1KY2A 3OMWA 5GVSA 1EQ2A 2NU7B 4L15A 3GJ4A 1N5IA 3V3KA 2P62A 4NYIQ 3TECE 1QPZA 3GCXA 4QU5A 4Z99A 3ZU6A 4X66B 1ICIA 2FX2A 1GT91 2UV8A 1E3EA 4RFSB 3WYEA 4N47A 3T1YB 1UPBA 2FXIA 2XJ4A 4MQEB 3UJ7A 5EE1A 1QUFA 1P7ZA 4JZYA 4QYTA 3T7KA 2WJ3A 2JJYA 3IMFA 4C3ZA 2OQIA 2NTVA 4L4RA 1G4HA 3MRSA 4IKEA 4NULA 3ZLVA 3C15C 2DYKA 3R7DA 3FOZA 5BVGB 2YQ5A 1Y5IA 4KQKA 2NU8B 1JLRA 1BQ4A 4U0KA 3DEIA 4EBBA 1MQ8B 5H7XA 3ZJUA 3A2LA 1GNPA 4B3FX 1D1SA 1GQQA 2NZWA 3N74A 3NALA 4MVYA 4BIIA 3K5HA 2EZTA 3LW7A 3TTYA 5BQPA 2FXVA 2C31A 2GBLA 3EW7A 4HUQA 4G2NA 1MEEA 3F5SA 2XCTB 3IAS1 3HBMA 2O8EB 1BXGA 2Q6VA 4ACAA 2O2SA 2NUBA 4M0KA 3N53A 4AS2A 3L7DA 2C7GA 1QIJA 1XRSB 1JVNA 4R1UA 4F3NA 1A2QA 2M32A 1PYOA 5C80A 2X8JB 5BO5A 1M2VB 4HQ0A 5EXPA 5I4KA 1CQZA 4RULA 3SC6A 1N36B 2J5XA 1RYZA 3KVRA 5ERYA 5EXDA 4UBMA 4ZOQI 5KQPA 1SA0B 1L7DA 4HEJA 1CLUA 3G0BA 3UJHA 1UQUA 4AQYB 4G01B 3TBKA 3B85A 3HGMA 3HNRA 1QIGA 7ABPA 1ZAKA 2GRAA 3RUAA 1NYRA 1XJ5A 3FSJX 2F8LA 3O92A 3O82A 4MWOA 3ZE9A 3DBOB 5FF9A 3EXG2 1ODTC 2HT6A 3L6DA 4KSBA 1RAEA 1ZD5A 2G4CA 2VK1A 1X9GA 4KOAA 2BZ0A 3HBAA 1DAPA 2IYUA 3QNMA 4IXMA 4Q3KA 4NPCA 5DZSA 3W3ZB 3U7HB 2Y1EA 1JFTA 4TYYA 2XCOA 1VECA 3CZ5A 2MSNA 4WT7A 2CYBA 1X7GA 3MCVA 1RLUA 4GGOA 4IOMA 4XLLA 3C5WP 2VHVA 3TRDA 1BO6A 5B55A 1GUAA 3T0FA 2FSVA 3DKRA 3VM6A 3ZXYA 4CUKA 4AZ3B 1KMHB 3VPXA 1EWKA 4BQQA 3KELA 1JPVA 3H83A 1DKLA 4RV4A 1CLEA 3S1AA 4UFPA 2N3ZA 5J4HA 3W5DA 4BVAA 5LQUA 5KYXB 5H70A 2JRCA 3KTAB 2FG5A 2W5UA 4EHFA 4C88A 4WK2B 3ZI7A 4ZK6A 1AKMA 1SK9A 2R8BA 4KQ1A 3HCFA 1VL0A 1MKYA 1VXOA 3LIIA 3LUPA 1DT5A 1XELA 1GFSA 4EB3A 2CJPA 4X93A 4AJ1A 3FAZA 4OHPA 1B00A 2ABWA 1RJWA 1MAUA 3FY4A 3S5UA 2GBPA 4F72A 2CMFA 2RH9B 2GEUA 5T4EA 1PJAA 3P20A 2WM2A 1NM5A 2IV2X 2G72A 4DYHA 3HXOA 2WHRA 3FWNA 4ZQHA 4JHXA 2F2TA 1X77A 4F7DA 2JANA 4ZYXA 3C14C 3KPYA 1AUPA 1KYXA 1RWQA 1LXCA 6AT1A 3AG6A 1OROA 4OYYA 5GAJA 5B53A 4WL0A 3LU1A 4TRMA 1TO2E 1IZ7A 2Y1XA 5AHKA 2CHFA 3JCZA 4WOCA 1UJ4A 4QWWA 2APJA 4RC9A 2UYYA 4HYQA 5C0OE 2O0LA 4JD5A 5TQ2A 4YUZA 2WHEA 1SKUA 3MT0A 4ZVMA 1QG6A 4F2DA 3JS5A 3BGDA 2CW5A 4NMXB 2PYDA 3W34A 1TEVA 1T4DA 2OMKA 4F9GA 2Q1WA 2QOEA 2R8XA 3O91A 5KTTA 4YAOA 4RTKA 2FR1A 4A03A 2ZGVA 5CRIA 1FMFA 5TR9A 4HH3C 3GJ3A 1VGVA 4PZYA 3IKMB 2R1TA 4OI1A 5JTUA 1YRAA 3IEIA 4BEWA 2HHLA 3JVUA 4FB5A 5KS2A 1XMOB 1GPAA 3NTRA 3F2VA 1ECBA 1M2GA 1O3YA 1NWCA 2XRYA 3INYA 3NVKI 3DAOA 3WLAA 4K0KB 5LYJA 4QGFA 3MCTA 5AK0A 5LKAA 1SBNE 2WG0A 4CU2A 5C8XA 3H9JA 1FJXA 2H1FA 4K6FA 3TDNA 1JHDA 1IG0A 5FL7D 4Y6SA 2A35A 5B4UA 3PG5A 3PUVA 4Y7DA 3H2IA 3OIVA 3AQ4A 1Z4JA 4F9FA 1SXJA 5CR9A 2B37A 2A58A 2EKPA 3TNYA 3LQFA 5BVHA 1EFDN 3DQPA 3ORRA 1NJ2A 4LVCA 4D9FA 2ZS9A 2HA2A 1E79A 2ILVA 3THRA 1HFJA 1XGKA 3W9UA 4BKRA 3MERA 3EAGA 5D3ZA 3SNHA 2OYCA 5DW3A 4FR2A 1AT1A 2YMMA 1H4VB 1Y4SA 2CHQA 1VLQA 4I1IA 5IYZA 1I6LA 1JXAA 3GJSA 3N0XA 4EEXA 3B3QA 2J9GA 3QKWA 1JFSA 4C0QC 1ZH4A 1T2FA 1DKUA 2V55B 3K6KA 2JD2A 3A9VA 4XYMA 4W5HA 5FNVA 3AVWA 4EUEA 2AN5A 1KI4A 1XZDA 3HB0A 2Y1FA 3NP9A 3I6IA 3KJQA 3WRYA 4EHJA 1VJRA 5BUCA 3CVUA 3HXPA 4MWTA 2BBWA 2RSLA 4F8YA 1EGMB 1EFPA 4ID9A 2ZSFA 2IYEA 4PPYA 2JLCA 1AO3A 1CRQA 3HLYA 2FRVA 3AF1A 4IO1A 4MS4B 4U9IS 4X45A 3TKAA 3ZWPA 2X58A 1KPIA 2O8VA 4OIMA 4URWR 4F5WA 1DIHA 5JH7B 1N2IA 5C3UA 4J4TA 2DSTA 4YJ3B 1ID8A 3PS9A 1T9GR 3DO8A 4IV0A 3UK7A 3T1TA 4D6YA 1QB8A 2FEKA 4DF3A 4IGEA 4DZRA 4KNYA 2ZTLA 3RHFA 2VNHA 1HY3A 4LSWA 1HEIA 1XOIA 2BZGA 1L9XA 1JZTA 4QFDA 1UOPA 5JE8A 4PWYA 3EZYA 1G66A 5C31A 1PLJA 5IABA 1FYWA 3JQAA 2Y0EA 1EK5A 3GCDA 5DHAA 1KRHA 4U7HA 1DJMA 2V9ZA 5AKGA 1CEEA 1JR6A 3DL2A 5FWXA 1T24A 1A8HA 4Q1BA 3IFSA 4HCJA 2GA9A 1DRVA 4QU0A 2NW6A 1T9GS 5KNBH 1TI7A 3KE8A 3VU8A 4JGBA 3GGJA 2B5VA 3IVCA 4LHSA 2BBTA 3V8EA 2PFKA 3FHOA 5EJ5A 3ETCA 2OO5C 2WQZA 3DZBA 3ITKA 5AQEA 3QKSA 2AFIA 3M5PA 4JQZA 5FPHA 1GNLA 3IBSA 3BD7A 3NC1C 3DFFA 5EJAA 3ND9A 1X1RA 1SUDA 4YIKA 4C14A 2KJQA 2P3QA 1VM6A 4G9GA 1HZJA 1LBIA 3QLJA 2HA0A 2P9ZA 3BMOB 4KIWA 3KBOA 5A5DA 4Z4HA 1QDUA 3UAGA 1FS5A 3GDGA 1QAMA 4US1R 5FL7A 1IN4A 4E0BA 2FG7C 3M6XA 4UJ3A 5U1PA 5JQGF 1CNFA 2DQSA 1PT6A 5F9HA 2Z2XA 3EXG1 5CNIA 4TLEA 2ZT8A 1F8XA 4KXWA 3B1WA 4HXYA 4QDOA 1V6AA 4MCJA 4R3NA 2OG1A 2ODPA 3W2FA 4DRYA 3I8SA 4D0NA 4CM6A 4MUKA 5ALUA 1EVKA 4J3NA 3AG5A 3F9RA 3K16A 4PVDA 4S0ZA 2I1VB 3R40A 1NXSA 3HL0A 3FTQA 2O8NA 2QNIA 4PHGA 2FE4A 5KHAA 1JL3A 1OKKD 3VHXA 3RAFC 4HWOA 2UUAB 3KP1A 4LZOA 4JUAA 5I7WA 2VKQA 4IIJA 3PI6A 1CQIA 4MMXB 3R8FA 1Z13A 2FPIB 3CNQS 4JIMA 4XQCA 1BX3A 2REOA 4ER7A 1AKVA 1QSGA 2IX3A 2P9EA 3DB2A 4US2R 3R3HA 1HPLA 4WN9A 4BQEA 1ISRA 1RW4A 4NCAA 1KQOA 1JA0A 1JR3E 1WB6A 4WCFB 4XPIA 3PXUA 2OWEA 5I5GA 4BO6A 1O94A 5ALDA 1N6OA 4RVNA 3H65A 5B37A 1QF7A 1UODA 2NVUA 1JECA 5BXQC 5DHSA 2VT7A 1FDUA 1MJGM 5JSQA 4KACA 4CWAA 3J7AC 2NP7A 1HTTA 3QY9A 4ZGGA 1K7XB 4FHDA 1EVIA 1YASA 1LQUA 3CC8A 4D4HA 2HJ9A 1TE2A 1UANA 4HQRA 3ZHSA 4BNWA 4D4KA 1G5QA 1P1IA 1MO4A 2QV7A 3L0SA 4NEHB 2M6KA 4BLRA 4P38A 4YX9A 2XADA 4MV5A 3HBLA 1SVLA 4X85A 3CWQA 5KU7A 1RC8A 2IYTA 4ISBA 4MGEA 5G0VA 3UHOA 3OZEA 1XPJA 1BW9A 1ECJA 5EP1A 4ZAVA 1W4RA 4G1CA 3CXRA 4S24A 4ZOLA 2GPBA 4FKZA 1GAWA 1H9BA 1NXQA 3GGDA 2PS0A 2Q07A 2GEDA 2IA5A 2FKAA 3RADC 2HYDA 1C3EA 3GWZA 3K4PA 3VPFA 4YO8A 4FMDB 5ILGA 3ZV7A 1BVYF 1WMDA 2ZPAA 4POOA 3X1JA 2BMVA 2WKRA 2WC1A 3TJRA 3LHFA 1WRBA 4GI2A 5JYBA 5LP6B 4K9RA 4YXWD 4W5OA 3OUUA 1ZLXA 1WUYA 2IPLA 4N7JA 4M1WA 4R8VA 4TS4A 3PNYA 2R97A 1J2TA 3SJAA 4A5OA 2M6RA 3QTBA 1F4VA 1XCJA 4H1TA 4PPFA 4CQJA 5BRJA 5ICSA 2EFHB 1IH8A 3PHHA 3GJ8A 4WSOA 1C8BA 3QBEA 1QGOA 1IWPB 4V1CA 5BV2P 4P4SB 3EB9A 2UVDA 3HUDA 4V0LA 1KS9A 4UUAA 2FYTA 4LUCA 2QTZA 1EFLA 5JFTA 4IF6A 1XZCA 2WTNA 5A4DA 1STOA 3U2QA 1P45A 3CZMA 3LVFO 3P5BA 2Z3WA 3P9SA 3TO5A 1TLTA 1Z8NA 2G8NA 3PJGA 1MC4A 1J8FA 1VIMA 3VR0A 4BRUA 4D42A 3P4XA 2J3EA 1H8HA 1NVFA 4G85A 4MB2A 2WKQA 4FN5A 4EA8A 1M66A 4MI3A 4HGZA 3KPUA 2RHTA 2E6UX 3QE4A 4TTSA 1NP6A 2GTPA 4QPCA 1THZA 5ILOA 1NW6A 1IRXA 5FYDA 4BDSA 3OD5A 3USZA 5IDWA 4MQMA 4CN8A 2G4LA 3L5OA 5AJWA 5EFZA 5A62A 4BRZA 4QYWA 5CB4A 4MA4A 1DIAA 1DOZA 1PWHA 2D1FA 4F60A 4BP1A 2AMVA 3KQLA 2F3UA 2V7GA 4BRSA 4KX3A 2JKYA 5FDFA 1NG1A 1N0UA 4B3CA 1SCDA 4HRYA 2HGZA 1HQCA 3PXBA 4D8TA 3NWBA 2YRFA 2QL9A 4HDSB 1LW7A 4WJZA 4QXRA 5L3ZA 5KTPA 2R5WA 3D6NB 4TTAA 3ASYA 1UEXC 1DFIA 5FIUA 5GV8A 2RH5A 1KY3A 4K87A 1G6KA 4Z4EA 4X62B 1OH5A 4GP9A 1A5SB 1HYQA 3IULA 2Y1LA 4TUYA 3WKEA 1NI3A 3VV3A 3DYVA 2OB1A 4ENVA 3LCMA 4Z9BA 1KZ1A 2DUNA 2IITA 2E6KA 3B5JA 3BHNA 4GYJA 3V00A 4TKLA 4MI9A 8AT1A 2W8BB 2FEOA 1AKUA 3PJDA 4DYDA 3TVTA 1GRQA 1YFKA 3GUVA 4QBHA 3EZ6A 1C1DB 4XGQA 4ZI2A 3KQTA 4S1WA 4KKXB 1G8PA 2DBQA 1YA8A 1TKRA 1GQFA 2V7UA 3R5SA 3RREA 1J8VA 4YRGA 2GXAA 5D51S 1FRQA 9ATCA 3PEUA 3GLKA 1Y9AA 5JAHA 1C3LA 3GL9A 1CERA 1H0RA 5G0TA 2J4DA 4CM8A 2IY7A 1XZEA 2EBWA 3BWCA 5TV2A 3UY4A 2IYYA 1RXCA 5LOVB 4N1AA 4PNHA 5IXJA 3FLEA 3CLVA 4AICA 3ZV5A 4Q24A 4KR2A 1YIAA 4H3SA 1S4MA 4H3KB 3IAXA 5IJ0B 1OIWA 2OP1A 2HBQA 1YZKA 3UT5A 4EG0A 3OZCA 1E63A 4OQQA 1F2TB 3LK7A 3WMRA 3KLNA 1LI5A 3VOSA 3GLGE 4OHZA 4W1PA 4KQFA 3OOJA 5CVVA 3UA3A 4JLPA 5EHNA 3U4IA 2YOFA 3UCFA 4DA9A 5JZMA 2H7YA 1M8KA 4ZA2A 2H5LA 1Z74A 1X9IA 1Z16A 4B4OA 1N2CB 2R6R1 1VRCA 1E2PA 2X6TA 1FE8A 1OIVA 2CXNA 4ZJZA 1X0VA 1Q95A 4JEIA 1F3LA 1QGAA 1D2MA 4JGIA 1X94A 4RK6A 3ZKWA 2BBSA 4H31A 1T8PA 3VPGA 3KM0A 4B6GA 4C7VA 1YJ8A 1P7PA 3U3MA 3Q12A 4GBGA 4OMUA 1Q21A 1AXRA 1YZUA 2CVPA 3WB0A 4EHNA 3FLAA 1MVOA 2BT4A 3O2NA 5K2OA 1TEXA 1O94D 2FZKA 2A0FA 5JS2A 5DHRA 3THXB 2NYRA 1BCRA 3C1AA 3T3GA 1PWEA 2KE5A 1A9XB 2W2TA 1QHGA 2DM6A 5L4LA 4V3CA 2YY5A 3BJIC 1CIJA 1NPDA 2ZBFA 3IB3A 1G2QA 2O14A 2QUHA 2FW0A 1R50A 1GN8A 1UXKA 1D5WA 1Z5NA 2XUQA 3INTA 4WOKA 1WLYA 1I4EB 1W46A 1GFZA 3R6TA 3JR7A 1SG6A 3OIUA 4R16A 4BNFA 4FHCA 4J0KA 4FEYA 4XIGS 1J6UA 4LQCA 4KR6A 3MOGA 5EVJA 4JUIA 4MEAA 1QJ4A 1MPTA 3OMLA 1SBTA 4I9FA 3PQ6A 2AN9A 2VTDA 2X7XA 1YQTA 3Q10A 4JVOA 1ZQ1A 4GZMA 3UXEA 1GZ5A 1XDZA 3TD2A 3B6EA 3EUFA 4NYIR 3QEBZ 2C5GA 4IXNA 3RHTA 2HDHA 3I52A 1RZRA 4FFRA 4YJFA 4R2HA 2X0DA 3A6LA 4NWIA 4ARBA 2J09A 3G5AA 1QC5B 2B2XA 1I6KA 2C8VA 4YY3B 2XE8A 1NVEA 3OX4A 3AH8A 1CUGA 3QFFA 4YRFA 4DADA 2ZRQA 4DIFA 3FWYA 4FXOA 2FMKA 5AIBA 4LMAA 2J7PD 4JVSB 3OU2A 4YJHA 3EPJA 1RWBA 2WMYA 3TCNA 4QQ8A 3ZCUA 3PR1A 4K9LA 4BKUA 4C78A 5HKAA 3ML1A 4H4DA 4MVJP 1QGDA 3L9WA 2X9VA 4Y2QA 2BJHA 2JFZA 3ZJYA 1F2UA 3K1AB 3W5UA 1KKLA 4QKQA 4IM7A 4CJXA 2QRNA 4ZV4A 4RFLA 3EPHA 2WZDA 3D6TB 1MJGA 1JEYB 1G20A 4JI4B 1ELOA 3B9QA 1Y1QA 1FS6A 2DERA 1KI3A 3GXOA 1M10A 5DCLA 3RTAA 3WGIA 2O3QA 4XIYA 3EC1A 4RCVA 3RS2A 3GEHA 3MAJA 1YB1A 2ORWA 3BMOA 4QOGA 1PJ4A 1Z0KA 4REMA 4PZDA 2BHNA 4BNVA 2BEUA 1M5UA 3BILA 4IZIA 4DILA 2YWCA 1NP3A 2OHXA 2EYUA 3VAZA 5HVNA 1XPUA 1UPUA 4DHWA 4AZ3A 4UPVA 2ZYGA 3HWWA 2QTWB 1CY1A 4M76B 4L6CA 3FPGA 2X0JA 3H42B 1R0WA 2VTVA 2D1RA 4WNIA 4TMVA 4EJSC 2IYXA 1R2QA 1P2SA 1PS0A 3G9ZA 1O58A 3ISTA 1E5XA 3RO7A 4X65B 2BP7A 5JS8A 4W9NA 4J7XA 5LQJA 1KORA 2ETXA 3I2HA 1VCOA 4N8EA 3T1HB 1MZPA 1W48A 4CG3A 2P5TB 3A14A 4WCDA 4B74A 2AXEA 3AM4A 5C37A 3ACBA 4PBTA 3PQ8A 1VPTA 1DGQA 4QT4A 2ONCA 2PR7A 4B87A 1YHNA 1Z4LA 2CHEA 1NNLA 4EZEA 4RIGA 3N7AA 1ODKA 3R0JA 4PINA 1ANKA 2IGBA 1A5TA 3QVGB 4LDZA 4M38A 1XEFA 1C3OA 3EASA 3PQ7A 3ESRA 3V1MA 5F77A 1EUZA 1FPQA 4MV6A 3RRFA 2P6UA 4LV5B 1NN5A 1OXBB 2ZTMA 3HUEA 3O75A 3DPSA 1P61B 1XCOA 2WMOB 1J2YA 4IXDA 5A7GA 1KL7A 2G4VA 4W9RA 1XLVA 3T3PB 2EIXA 4UVIA 4MB0A 2OQ2A 3H8WA 1WD5A 2FN8A 3UATA 1YONA 2OCIA 5J3JA 4J90A 1L4HA 2G1JA 1KYWA 3F73A 4JROA 5EMLA 4UTNA 1ZZEA 4E21A 2F55A 4X8MA 5CT4A 1OI2A 2P67A 5AM4A 1PX2A 1SJ9A 1GKIA 3O0TA 2ST1A 4WXRA 2XMCA 5DGTA 2PSHA 3DBIA 3QK7A 3HY4A 3CFYA 4M9RA 5AOCA 3R7SA 1BW9B 4N5DA 4A8HA 4M89A 1QVVA 2JBWA 4N7BA 5D87A 3A0UA 3FRHA 3LLVA 1M2HA 3GEMA 2WFZA 3GLTA 1GJRA 1NHGA 1N6IA 3Q8WA 1CDZA 2PGIA 4NZ9A 3QW4B 4UEQA 3ZDFA 4D4IA 4EKEA 3C8ZA 1XTUA 4U9HS 3LFTA 1JNYA 2JJ1A 4LPSA 1TCCA 3E3OA 3D3EA 2YWBA 5JI2E 1YDMA 3ZDBA 1TB4A 3DOJA 1DQRA 1M2WA 1O77A 4UHJA 3U17A 1IFXA 4N0EA 1G5IA 1YZGA 5THQA 2IE0A 4JYAB 1A1VA 2PN1A 3H11A 1F06A 1ZWLA 1E61A 5JADA 5KINB 5TQJA 1ZGZA 1EP2B 3VC2A 2IP2A 2R6AA 4OAQA 1C9YA 3KU1A 4FDAA 4D98A 5IXYA 2FPOA 4GLJA 4R7ZA 2VEOA 3BZWA 1AO0A 2A0UA 4NF2A 4NBTA 1N7JA 1QIKA 1IULA 1XA0A 2CHVA 2WFAA 5T5QA 1ZMXA 2J3DA 4DDKA 2QLFA 2PKCA 3KHUA 4B3MB 1Z4OA 1GR1A 2H6EA 2WT9A 3DMFA 4R4JA 4DCJA 1U63A 1W85B 1FC0A 1OA0A 5BXYA 1QZUA 4RVDA 4C20A 5HCNA 4QJ5A 1XX6A 3A06A 4Z3OA 2ZSDA 5FTWA 3JRXA 2KM1A 3RSOA 3EF3A 4WESB 1H93A 3FVVA 1FRZA 3Q0TA 2H8GA 5KOIA 1A7JA 2F1IA 1H8ED 1SXJB 3HWSA 1NXWA 1M34A 3O74A 2AD1A 4KLRA 4RL4A 3ADDA 2AG5A 3CUSA 2VYCA 1PNTA 4GOLD 1GYPA 1T8SA 2AUMA 3ORHA 1T0UA 4TYMA 4D02A 1XEWY 2I4TA 1C0EA 4DQ0A 3U80A 3IQHX 1YBVA 1LBQA 3O4RA 1LLDA 3OBIA 4MUJA 1XEAA 1SOMA 4C0AC 3UMVA 5DK6A 3VVMA 2B1IA 1KJZA 4FX2A 1Z3CA 3D2CA 3U49A 4AZVA 1UWLA 3WL3A 1SZPA 3L2OB 3D1LA 4OXNA 3FD8A 1P5RA 5TPWA 4ETNA 3JAKA 3WDSA 2ONJA 1E6KA 3I5AA 3GRRA 4V39A 1UAAA 2CYCA 1JJ7A 1GKLA 2RONA 1KJJA 3SLGA 4BZPA 4YRKA 2L2QA 3SDSA 1L5FA 3DEKA 2D7DA 2G40A 1HRDA 4KPYA 5DLEA 3EC7A 4DQDA 3JTMA 2QVGA 1SGWA 2I2WA 2YHAA 3KLOA 5SZHB 2Q4DA 2FMUA 1LPNA 1IY1A 5FUBA 5CFZA 3PDIB 5ICCA 2FSHA 5KDOA 3GGOA 3FB4A 1O9GA 1YL7A 3D81A 3ZXUB 1Z83A 1MQAA 3WRVA 4JUFA 4MW7A 1A71A 2GD1O 2UZ1B 3KZNA 3ND8A 3SAJA 4IQGA 1VKRA 3ZXIA 3EXHA 2B98A 1RQPA 4QYMA 2DUUA 4CVNA 2NXNA 3UA4A 4WDRA 2XKBA 2VK2A 1KU0A 1E9RA 5EIHA 1Z4MA 3BMQB 1Z5OA 1Z6TA 2TS1A 4N39A 2OBLA 2WW8A 3QU7A 3NONA 5BP7A 3HDHA 1JMVA 1ZEMA 1P0MA 3T9DA 4M8KA 3LQQA 2IK8A 5EZQA 2EWMA 4MLDA 2QGFA 3AUUA 4L02A 4LKRA 1J0CA 1LKZA 3HCWA 4M1KA 4BZZA 1S1MA 2E4YA 1NP7A 3K5WA 4LYDA 1G2IA 1N8TA 4RKEA 1P3JA 2PBLA 4UNIA 3I9V1 4D8XA 2ETVA 3GJ6A 4ER0A 3W78A 4HDOB 5CBPA 3P2MA 5I48A 2B30A 4BP3A 1RVDA 3DM5A 1O94C 1YR9A 4W4TA 2DQYA 3H3FA 4OKNA 2CE7A 5A4FS 1NJ1A 3OA0A 2K7ZA 4G0YA 4M9UA 1MTZA 3H9QA 2XF8A 5IFKA 2XQFA 1IHOA 2Z9BA 3DMTC 1MDFA 1JG4A 5A71A 3WBFA 2P5YA 3I9V6 1U2QA 1WOMA 2UUBB 3MTIA 4UU1A 2R1VB 2VHZA 4J1TA 1IBLB 1I36A 4N5NA 2XEXA 1RJ9B 1SQSA 2IVFA 2FUEA 2GARA 3E9YA 3P9ZA 5JD4A 3A6PC 1PDVA 5U4QA 2HU2A 2NLOA 1BC5A 1L6RA 1Z75A 2GAJA 3QA9A 4ZVRA 4MCIA 3I4FA 1L4NA 1JIVA 2HMAA 2XLCA 3HP4A 4QBFA 1WCYA 4Z0PA 4L4ZA 4YJ3F 5IANA 2X4IA 2IE8A 4RPCA 3I28A 3JQDA 2WYVA 4G4JA 4CMJA 4BC1A 1B42A 1GZ4A 4HAWA 4CMCA 3RS7A 2UYOA 3J80A 4ZYUA 3L02A 4IIYA 3F5QA 3ONEA 3DZIA 1I7NA 3RD5A 1XF9A 4MRMA 3UXHA 1T1GA 2JW5A 4BZXA 1JLLB 1FQOA 5AXCA 1Z6GA 4TTQA 1NMEA 1JDJA 4RZQA 5IP5A 1GP2A 4KLAA 2ZBGA 4A2QA 1N4DA 3JQ7B 5BT9A 2Y77A 2A2ZA 2L69A 2C3MA 4QIHA 4DQXA 5CG1A 4I14A 1BTOA 2LNDA 3TZ6A 5LMZA 4A26A 3K31A 4LG1A 5AK6A 4HQNA 2MWMA 2BUCA 4Q9HA 3RJTA 3LT5A 1LQ2A 3U3XA 3EY9A 1BHJA 1EAMA 2F43B 1I24A 4TTIA 4JUDX 5AKEA 4AJ2A 4OXIA 3GK3A 4XM1A 2LRHA 2QSJA 3NXSA 4AULA 4KWHA 2NQ2C 3NHFA 2EX1A 4YT5A 4YMVA 4OMCA 3DUFA 4YP9A 3L1IA 1FSPA 1Z25A 2HY7A 3PNLA 4EG6A 4AJNA 1CG6A 2PT5A 3P4YA 1BXZA 4UHDA 5F2OA 2B9EA 1JDBC 4G09A 4Y1RA 3I5YA 3PDWA 2IEBA 5I9SA 1VE3A 4LJ7A 5E3IA 4IGKA 5BWMA 1G8JA 4CMEC 4O63O 2VR1A 2IOQA 3IVGA 4O4HA 4XXHA 1FPMA 3FPHA 4TQ9A 1V95A 4Y98A 5D7BA 5FYQA 1CF2O 4WLEA 1F2UB 2DTEA 3WLFA 2QL6A 3FCYA 3AX6A 3JD3A 1AN9A 3K3PA 3K5IA 4KN8A 5BUZA 3IAS6 3O9ZA 5IDYA 3O3MB 1AKRA 1OLXB 4BU1A 4C5BA 1HZZA 3U3RA 4OLBA 3KTDA 3S2FA 3F74A 3GEPA 1LSSA 3TVYA 5JZOA 2H7CA 3U4QA 1TUBA 3QXJA 5ALSA 4X95A 3LWZA 4CDNA 1G7CA 2I8LA 3WGJA 3HP1A 1KERA 3I23A 4R5MA 5D3MA 3WQQA 3MELA 1A5ZA 5CP8A 4FEAA 4KDRA 2RH4A 2XNJA 1S6YA 1OWLA 1JKJB 4YREA 1CVIA 1P1HA 1XIVA 3K32A 1G16A 3P2IA 3QVJA 4RMIA 5K2MA 2CL7X 3EYAA 3TWOA 4I4IA 4M0EA 1J0EA 3UEOA 1CY0A 2JHFA 3SN6A 5A0VA 2C83A 2Y1CA 3ZD9A 1G5TA 3G2HA 1EFTA 3LUGA 1TCVA 4ADSG 4DCMA 1EGHA 3ZCTA 3T5PA 2WG2A 3MD0A 4GRDA 2OO5A 2DULA 3H99A 3DJFA 3I6MA 2P0EA 4U2GA 4XYGA 2AG8A 2HA5A 2PSFA 3MGCA 1OE0A 4MQUA 4LYJA 1OWMA 4Z6KA 3SJBA 3P97A 3TSYA 2QQGA 2QZSA 2PUJA 5DDIP 4AD8A 2IYAA 2VJAA 4JWTA 3CN9A 1KWKA 3VO1A 1X8LA 5AH0A 4YUVA 2M1XA 2REQA 3LX4A 1A9TA 3QKUA 5KQGA 1VLVA 4EW2A 1ORVA 4KFUA 3RU2A 1XD2A 4Q47A 4WH0A 2R2AA 4BFVA 1J8MF 1IONA 2WV7A 1WHSB 1CR1A 2AH5A 5BWBA 3FKSD 3GA7A 3AHCA 3K70C 1ZMRA 5KVQA 1RACA 2FJ0A 1YBMA 3QFTA 3ND5A 1RXSA 4JP2A 4BQOA 3OWOA 1U2RA 3P2JA 3HE3A 4MHTA 1XR3A 4DDUA 4MPJA 5D3KA 5M29A 1FNDA 3V4FA 3VOAA 1EK0A 1DFGA 4FP9A 2X14A 1R37A 2L42A 2A9KA 4JJGA 2BFAA 3T7JA 1ZJ4A 3FSEA 1EDEA 3EHEA 3CUKA 4B0PA 5CVDA 2WHQA 2OGWA 3DW1X 2RARA 4WVFA 3TIIA 1FMCA 2CLHB 5LWQA 1I33A 1L5QA 2NSJA 2OKGA 1NC1A 4P4UA 3WK8A 1Q15A 2ZUFA 1M2OB 3OF5A 4U7FA 2J5KA 5KO2A 3QJ5A 2HJGA 2HYIC 1YZYA 4C6SA 4NG4A 4DBLC 2EG9A 5DWVA 5HSGA 1MUUA 4DQVA 1ZGHA 8ATCA 2ZRHA 1ZUNA 2O2XA 4EZBA 1OBFO 3OIGA 3EGCA 5FBVB 3KK0A 3P0HA 4YACA 3C7KA 4FDTA 4PLWA 1AMUA 1L5YA 4LDPA 1TMKA 3RG8A 1RLJA 3DTTA 5MGNA 2Z2IA 4ZDWA 5BNWA 2MHCA 4D4GA 1VI5A 1EPUA 3PFCA 3G1WA 1G6Q1 2QE6A 4GECA 4I9NA 1BCRB 4IYJA 4II7A 4R1OA 7ADHA 4GOXA 2X0KA 4EO9A 2WZCA 2B1RA 2V0NA 4M7OA 3ERCA 4EGSA 1NJ5A 5A5FA 5BR8B 3QKRB 1HZZC 3BXEA 4BWGA 2AQIA 3L6EA 2K4MA 4DA8A 3N75A 3ZGNA 1PP4A 1R27A 3W9BA 4B48A 3HYRA 5AKHA 1UM9B 1CEXA 4GWGA 1TM7E 5FBRB 2ZYWX 2GO1A 1T9AA 5IC4A 4UM9B 2P8JA 4DEXA 1V1JA 4OHXA 4XDGA 1O08A 1VLHA 3CUEF 3IQIX 5DMHA 5LIPA 3CX4A 4OXKA 1CK4A 3OZDA 3ABIA 4ITVA 2W2NA 3ONFA 3QPUA 2QZJA 2V58A 3KLPX 4L57A 5UKDA 1L5VA 1RHQA 3MTEA 2EKLA 1UK7A 2GR9A 1TT5A 3K1JA 4IR7A 2Z2YA 3TIVA 3D6VA 1I2CA 3PQFA 4K03A 1T2EA 3B82A 3TX6A 1IL0A 4D4LA 2LKDA 1SH7A 5ALPA 1RHMA 2WIFA 3RIGA 3UW3A 4AO8A 2IWHA 3IE1A 1O0BA 3CVXA 4L51A 3WR5A 3LFHA 4FFOA 4HLNA 1V6CA 1KMNA 2N42A 3E1SA 3OKCA 4HVTA 4KUGA 2JHGA 3RVLA 3ZV3A 2AUTA 2J30A 4OB7A 1DSSG 3UGQA 3DLTA 5CTAA 1TZMA 4A8JC 3O7MA 3MHPA 4HYYA 3L1HA 4DXDA 1TPZA 2XTMA 4W5TA 1BCSA 4RH1A 1KOLA 1RQRA 3RYHA 1HT3A 3WOHA 1LJUA 3ZHRA 3OT1A 4DWJA 2DXIA 2HUNA 4OB6A 3B78A 3HGTA 4P9NA 3HBJA 3PTLA 3X1YA 3AYZB 2RAPA 1P7CA 1NT2A 1P4RA 1PJZA 3IOBA 3H8SA 4LXYA 1Y63A 4UATA 1X7DA 2V3WA 5DRTA 3SJZA 3W9SA 4AZ0A 2JGKA 4EK9A 2PD6A 2I29A 3W2TA 5BN4A 1FFGA 4L07A 1AVTA 5CD9A 4PYLA 4R8MA 1VLJA 4BMCA 2XKJE 4OMFG 2FPPA 3X1KA 2AL7A 2AX4A 3NIBA 4RFSA 1P9WA 3K1TA 3HUUA 4W8HA 4WV3A 3PRJA 3O2JA 3B53X 3A4TA 4F04A 2GCEA 2I9KA 1X14A 2VJPA 1RTTA 1ZFNA 1EHIA 1M8FA 4LOJA 3U6BA 4E1AA 4ODIA 4DA0A 1NQWA 1VG1A 2B20A 1XZBA 2FE1A 3ISVA 3K6RA 3PYLA 4HGYA 4GOJA 2XDYA 2GVDC 4RNDB 1NOIA 4AJOA 4UUMA 4TTTS 2X9LA 4RYLA 1YCGA 3MBIA 4BX3A 2Q5JA 2AJ8A 2X6QA 2CXUA 2V54A 3VH4A 3U7EB 3KAQA 3H9EO 3JQGA 4XFKA 5KJEA 4ZVUA 4HS4A 1SVKA 1RVV1 1KDVA 2JZOA 3H8JA 3F47A 4K9MA 3QLUC 4YP6A 1CTQA 4P0PB 4QDTA 2WTEA 2VNSA 1C50A 3UWDA 5ECWA 2VCHA 4P34A 2FP3A 1RHKA 2I1WA 2XQVA 4QOJA 3TZQA 4LV6A 2G70A 3GHHA 1FYXA 2PBFA 2W2KB 2VUIB 4RORA 3F6YA 4TL6A 4PEVA 1FY2A 1NM5C 1XJ0A 3D6FA 3EQ2A 1P4AA 2V5AA 2L19A 4XCQA 2R47A 4FYYA 1PQPA 1XKLA 1DO8A 2P6OA 1IZYA 1BFDA 2R751 3MJEA 3REQA 2O1EA 3E23A 3RDPA 3SR3A 3VVCA 5A2GA 4COKA 3VDNB 3L7MA 2J9RA 3SX2A 1ZN9A 4YAJA 3RVNA 4W7HA 4JX8A 1BNCA 1EG7A 4RMNA 2QK4A 4I4TF 1RXWA 1N75A 2P90A 4EZIA 1VMEA 4JQCA 4EJSB 1SZCA 5E1BA 3RU3A 2REQB 1PHPA 3N6RA 2EQ5A 5G4KA 2NMVA 1WG8A 3C45A 4H0NA 4DLVA 3KQUA 1W5AA 3EZ9A 3KXIA 4FDUA 4LRYA 2G04A 1LDNA 1AM4D 3DFIA 3OE7D 3Q2IA 3SS8A 5K01A 2FCAA 4ZOCA 5AMXA 3WNZA 4E5KA 4RD0A 1QH1B 1P4GA 5B1DA 1U1FA 1M0WA 4S1OA 4WI1A 4LC0A 5KX5B 4V0MA 1Q5PA 4IQ4A 3FDXA 4Y2SA 3ZW7A 3CH7A 5F1YA 3U26A 3IAAA 4BUJA 5IHPA 3PXCX 2B25A 6YASA 1EWTA 1P19A 4G23A 2J3MA 1L8XA 2OLKA 2BRUC 1TMGE 4YBZA 4M4SA 4O4JF 3SU8A 2WU0A 2H2IA 1JFFB 1YJAA 2WD9A 3BQMB 5BN5A 2JFGA 2GO7A 4AN0A 4ZK2A 4DRXB 1UBCA 3KUCA 5D5HA 2BFFA 1D1PA 5HBGA 4B4WA 1D07A 1UDCA 3WYDA 3DH0A 3CISA 4N3CA 3C8MA 4YP5A 5CEFA 4C6HA 2PWYA 4MJ7A 2XVZA 7GPBA 4F4CA 1KDYA 5I7OA 4EEKA 1JIUA 4QM7A 1TF2A 3DDHA 1ORTA 2NTNA 4KE8A 2ON6A 1KZHA 5ECYA 4BFZA 1RFGE 1IHPA 2W2PA 3DAGA 4DKJA 3VPDA 4BLWA 3A9SA 4EAQA 1WMBA 1FSGA 3M6WA 3OM9A 4J4BA 2GFHA 4L9WA 4MKFA 3S7ZA 2WUEA 4NICA 3G1UA 3N2GA 3AM5A 1UMKA 1GGVA 1W34A 2AS0A 1Z8DA 4R8KA 4OXYA 1BX0A 5FKJA 2Y68A 1FDWA 1CE8A 5EHZA 5MGBA 3J81A 2G1AA 3QUQA 3UO8B 1H69A 4FLMA 1MRSA 2DFDA 3PDIA 4E08A 1R9NA 5TJHA 2PO5A 2C20A 3IR5A 4ZT7A 3BB4A 1EZ4A 5J5CA 1RE1A 3NHWA 3TTWA 1ZUWA 4CR8A 2J85A 3ITNA 1S3FA 3V4OA 4V0SA 4ETMA 1PT8A 3K20A 2EKDA 2UXBB 1DOAA 3MWFA 4GKKB 3MCAA 1A7AA 5LM3A 2O0KA 4C1NA 1Z29A 3H1PA 4Q4JB 2CVOA 3BL6A 2MCFA 3TCKA 4CE6A 5TJ9A 4BBZA 3EDCA 3WA7A 2CMKA 3EC2A 2IZ5A 1RYFA 3RTDA 1DC6A 2AK2A 2Q1YA 4YVFA 1SKYE 2R8OA 3D64A 4JEUA 4RAOA 2DSNA 3BRWA 4NDZA 3BD6A 3S8MA 1RABA 2B4KA 3GLIB 1Y1SA 4KMOA 2O5CA 1UBUS 3ZW8A 1DO0A 1NOKA 2J3KA 3GH1A 3JARA 4G0NA 1XT6A 3WMEA 2ZR0A 1C9DB 4XIJA 4EHKA 1CFJA 1CF4A 1HE2A 2Z4RA 3AZPA 3C5EA 2GRJA 2IHTA 2X23A 1NNUA 1TM4E 2P27A 3V34A 4KEAA 4B34A 1G8YA 1KK1A 2WHYA 2A4MA 2YQZA 4UDNA 4PGGA 5AM5A 1V9LA 2PYZA 2VT6A 1CCWA 4I1YA 4LE2A 3AEUA 4RS4A 5FA5A 2D74A 1CIPA 3GDWA 4KGVA 3GFQA 4A23A 5GZ3A 1PWZA 3BTSA 1SHTX 3SMVA 1HDXA 4ZI7A 2MINB 4JXJA 4LTDA 3IP7A 3HKCB 1CW2B 1ZY2A 3NKVA 3I30X 1R0CA 5T4FA 3WP0A 5JW6A 2FLWA 1AZSC 1JH8A 1G5RA 2CBZA 2WYUA 3IALA 5K8TA 5LDDC 4ZEWA 4D9JA 7MHTA 1RPTA 1XO1A 4E1VA 4RMGA 4DCPA 3E6AA 3DTYA 1U8FO 1LSJA 2ODTX 1UDRA 3FOEC 4U63A 2I78A 2GHTA 1NF9A 2A5FA 3M81A 1TRHA 3F78A 3NTQA 4H15A 1FNMA 3RV3A 2WTXA 3W77A 3RYFA 1XMIA 1WHTB 1SG0A 1DHTA 2XGMA 4K1LA 4Q01A 5C1IA 3S40A 1DCTA 3LX5A 1IQUA 4BCCA 5DYGA 5GIOE 4I2VA 5CLGA 4ZGBA 1AQYA 1OGJA 1R8QA 1NXPA 1WA5A 3AUXA 3G0HA 2L18A 2GXSA 2DX7A 3K2EA 4KPUB 1KBOA 2DJIA 4FEEA 3TB4A 4DB4A 3DVAA 3MTJA 1Q7EA 2Q2OA 4Q03A 1JLMA 1N5OX 1FRFS 1TUEA 3SSOA 3NPMA 4EPYA 1PEKE 1ZD9A 3OFNA 4RHXA 4AY3A 1NA5A 2G5TA 3CTPA 4IUDS 4ROTA 5CLHA 3D6HA 4PZEA 2BN4A 3CU5A 3EGXB 5TQ0B 2J87A 3ENZA 3ZV6A 3GDFA 1ZUNB 3I45A 3NGLA 4BYGA 4D46A 1NBIA 1P62B 2D3WA 5C46F 1XQYA 1NJSA 4HDNB 1SCKA 2VUTA 4U8GA 3DWIA 3OU7A 3AB7A 1TO6A 5IKOA 1KR2A 3OQIA 1EUQA 2JI6A 2F43A 2O07A 4P33A 3DM9B 4LPKA 3TX2A 2BCEA 2W2KA 1Y8RA 1N25A 1PR2A 4FR0A 5JAPA 4DMCA 3HDTA 4CMEA 2C3OA 2V74B 1KNXA 5HIKA 1L0BA 1DJQA 3SHVA 2ZE5A 4MYCA 3NTLA 1P1BA 3AR3A 4P83A 2I7TA 4HB4A 5LUBA 3G68A 1ODIA 1RP7A 2WKWA 3MINA 3WS7A 1VCNA 1O97C 1N5LA 1CJTC 4NAVA 3E9ZA 3PJFA 2OPHA 2HU8A 1CRWG 4DVGA 4EJ0A 3MPUA 1A50B 4IIUA 4O4HF 4BB0A 4OQLA 3MWKA 4UHEA 3S55A 1M8PA 2BGWA 4GYKA 1X7XB 5CDTA 2JAXA 2XXAB 1HDRA 1OI4A 1DAIA 2IXBA 4O4HB 4WKNA 3RGGA 4BCBA 4M7RA 4QUJA 4J1NA 5CU7A 1H2XA 4MV7A 1VHQA 2FTKE 3NIFB 3W0LB 1FVHA 3BERA 1L3BA 1LK0A 5LR6A 3I2JA 4NNOA 4RSRA 4BKMA 3ZY3A 5F51A 2BTQB 4N0QA 3TEJA 3NUGA 1J9GA 1REQB 2PWAA 1QE3A 1QHEA 2F3TA 2XTJA 3DOIA 4JGGA 1GPH1 1I3CA 1T36B 1L5SA 3DZCA 5EYPB 5KC8A 3V6LA 2XBLA 2Q6LA 1V0JA 4U6SA 3UWSA 4BNJA 4F84A 1DIGA 4LJ8A 3GWGA 2GPWA 3O38A 1JDVA 1HT2E 4PZCA 2RHDA 4QXAA 2FQWA 1ZM4A 2XTAA 4I08A 4C6RA 3C6MA 4CKCA 5AHWA 2IBTA 4KO3S 3A2MA 2QRLA 4CQNA 4CLDA 2YY6A 1ZPDA 2C29D 2PX8A 4NV3A 3ZE7A 4FE7A 2XJ9A 1SU4A 4FUQA 4MMYB 2OCYC 3SQNA 5K0SA 3SZGA 4OJQA 2PZKA 1M1UA 4RKQA 4BMSA 4OHMA 4MJ3A 1QHHA 1HEYA 1NW7A 3DAYA 5HGJA 4QICA 2X4LA 3DVAB 4UTZA 1GTJ1 1CJUC 1EMDA 1U0EA 3OCJA 4OBWA 4EW6A 4MS3A 1XA4A 2I6UA 4IWYA 5I7EA 4UXIA 1HYBA 4NBSA 1TUBB 2WSSD 3DNFA 2VDLB 2ZRFA 4K2HA 1ZJJA 1T4CB 1MP0A 1EBFA 3V2GA 3ZQKA 4EY4A 4GNRA 4LC9A 4YP7A 1HTBA 3U9TA 3C3AA 3PICA 2AOUB 3FLMA 4PAWA 3OZSA 2WM9B 4KNVA 1PBNA 2FFBA 4GE3A 3O9VA 4N3GA 2QLBA 4O25A 3STUA 1KYVA 4CQLA 2B69A 3A04A 1Q77A 4OSEA 1BFKA 4GOMD 1Q19A 5AICA 1KI8A 1ZO8A 4K9QA 5CHEA 2IP1A 1LEHA 1P3Y1 3D1VA 3Q7SA 1PSZA 3KPWA 4Y2HA 4QBTA 3R9IA 3RUEA 2VJMA 3OM8A 3DBRA 4TTJA 3KQVA 2VK4A 2WJ4A 2ES4A 1K3UB 4LXGA 1B6GA 3ER6A 1Z6ZA 1XMSA 1Y5MA 2XNDA 1TAHA 1VB3A 1YZFA 3H5WA 3JQGB 1F4PA 3Q0EA 4LV8B 2NXJA 1QBGA 3ETEA 3PR2B 3TTXA 1TF5A 3VHXB 5B4VA 4AP6A 4KBFA 4TL9A 3C6XA 3IXLA 2YV5A 1O6ZA 4JXKA 5C51B 2Y4OA 4IH1A 4D43A 3SS7X 2QP9X 2AYYA 3V8NA 5ALMA 1CUEA 1U1GA 2OUIA 2Q4OA 1X86B 3TLCA 4XGKA 4LZWA 1EBUA 3R6GA 2B1QA 4HNAB 3WGZA 1A4RA 4C0BA 1E0SA 3B48A 4YRLA 1I30A 2IUEA 1UL1X 3OP1A 1OU4A 2F3PA 3P9CA 4Q6BA 2OE2A 4R6WA 1Q7RA 2HIGA 2PH5A 3ANTA 1NNI1 4M8NE 2JHCA 4PC7A 4QAJA 4AX8A 3ULKA 4UUOA 2ATCA 3V9PA 3FTCA 1KJWA 3BWXA 1SOVA 4RA9A 4YJGA 3WSWA 2C88A 5FPPA 5JI3E 3FDIA 4RFVA 3ANSA 2XD4A 3TLGA 5GOTA 2P7HA 4TSKA 4NQZA 5D01A 2ZWOA 3HV2A 2G07A 4F85A 1Q44A 1JILA 2HRCA 3IQFA 1BWQA 1E7SA 3M6LA 3W8EA 4ETWA 1R00A 1QWSA 3H7IA 4PYNA 3W5SA 5EJGA 2GB4A 1JAYA 1DUSA 1MX9A 2YW9A 4ML3A 1ZINA 1ATZA 5LLSA 2Z6AA 3DHVA 3KSUA 2MDTA 3SIXA 3T4PA 1RTKA 3KQYA 3R7BA 1POXA 3UHPA 3I5MA 5FXMA 3MJRA 3WFJA 4BAUA 5JJ5A 1S7CA 2BP7B 3IELA 4ZQGA 1VL5A 1EVQA 2WWVD 3U7QA 3UT0A 3ZHVA 3KXPA 1BA2A 3ANLA 5D3MB 2GA8A 4KE9A 1MQ9A 2QVYX 4XE5A 1E2FA 3P0EA 2I4NA 4MGYR 1TYAE 3BG5A 2H1LA 2B4QA 4L6IA 1XQ1A 5BSFA 2XGJA 3NT2A 1W52X 2DHEA 3I1FA 3DV0B 3QP9A 4GL4A 2A3RA 2FETA 4QO7A 4RHEA 4V38A 4WKOA 4ZVKA 3TZEA 6ABPA 1NYQA 3N1UA 4KAXA 4WZAE 5DTMA 1XNRB 3FNGA 5K0EA 4IRUB 1UXOA 2ZWIA 5EMMA 5BYBA 4WUTA 3M6AA 4ZEXA 5JT1A 4L1KA 4XASA 2IWRA 3SEFA 1ST2A 4DIBA 2CXRA 3H6KA 2AT1A 5KI6A 4J0EA 1LJLA 2DY0A 5JRJA 1XZFA 2QD3A 1DG9A 2LW7A 3QZUA 1PT9A 1M34B 2IF0A 1Q0HA 2JD1A 3D3WA 4MV3A 1SWVA 1SQFA 2O2EA 3K8YA 3JVDA 3Q98A 3QXSA 2DFKB 4QPDA 3ESXA 2PUCA 2JATA 3TZLA 2NO9A 3C5HA 3VR4A 4MDEA 1TRKA 2EWWA 5E6SA 4BZQA 3TFQA 1BXGB 1XTIA 2D1SA 2WDPA 2PNJA 1E9FA 4F8JA 4Z7OB 3E05A 2JH8A 4K6MA 1J5EB 2I6TA 3EIEA 4MULA 5I8PA 3E2IA 5KX5F 3R0ZA 2QPTA 2FWMX 4KIGA 4YBRA 1J2JA 1FTNA 1RI2A 4XLZA 4F3RA 5I3ZA 2YOHA 1G42A 3RSHA 3M9WA 4MVJI 3CLTD 1VP9A 3SIPA 1GDDA 3L6OO 3T12A 4XWYA 3KQSA 2BH2A 1NQTA 3OOEA 1N2CA 2QL5A 4IMJB 5AKKA 5HCUA 3VFDA 3BJEA 5BYKA 1UP4A 2BGLA 4UE6A 4JI7B 1XMVA 1ZJ5A 1R6BX 2G8LA 3B8EA 5EHGA 4M6WB 1XWFA 2X2EA 1QTIA 3E4CA 1TKBA 3M83A 3FPJA 4I4CA 2XVAA 3WKBA 4D9NA 5C1DA 1PX0A 1TM5E 4LECA 3AV0B 3G23A 2R00C 3EVZA 4ZJPA 1KKUA 4G5XA 2HO4A 4C0LA 3DV9A 1TYBE 4GI5A 4NDAA 2H1OA 1MHPA 3OKAA 3EEOA 3EBOA 2X4GA 3TW8A 1VYHA 1YZQA 3HJTA 1OCEA 1GVNB 4C5CA 3QUBA 3BUSA 4WKGA 1DS6A 4N5LA 1CXZA 1OA1A 3I53A 4TUYF 4UW9A 2B94A 3IXQA 1I0IA 1M73E 1P91A 2VQ3A 3PPVA 4DJAA 3KOMA 4BFCA 3L6UA 2FFJA 4IVQA 4L95C 4QSMA 5KVAA 2G1PA 2JI4A 2WJWA 4RHTA 1PT7A 1U4SA 4FB4A 2Z5GA 4N48A 2W70A 4L4UA 1DWOA 1WF6A 1O97D 4BN0A 3EZNA 3L0BA 2O8CA 4LF5B 1XNGA 1G55A 2IIVA 3HJRA 4OKIA 3L1VA 5DTIA 1E2BA 1K88A 2HFKA 2LDXA 2W2LD 4JI0B 1DJLA 2P9GA 1DJPA 3ZH2A 4CM7A 1ZGJA 1IOWA 4HY3A 2NVBA 3G0IA 1MC8A 1NW8A 1XLUA 2H4FA 5BNIA 1WMEA 5K0ZA 2VRBA 3BWEA 3QKRA 1IWBB 3OD1A 3QV1A 2CCGA 4ARAA 4EY6A 1S9DA 3MIIA 4CBVA 3FROA 3GMIA 1DC4A 2VP6A 1LV7A 1NVVR 2QTMA 3NOOA 1JHPA 3UT6A 1LSUA 4XSGA 2FFAA 2QAGA 2RGGA 3JQPA 4ONEA 4QDJA 1FFEA 3UH0A 3ZBTA 3EWIA 2EJWA 2GXQA 4ZO7A 4EPVA 5IBCA 3PU6A 4NPAA 2I4LA 3GJ5A 3H17A 2EAUA 2VTBB 4PG7A 2O4UX 3L79A 4QTXA 3C8DA 1X0XA 2Z9DA 2BHRA 4FZJA 1ZM7A 4WCVA 3X1DA 4YQEA 2Q5FA 4FQ7A 5DFAA 3E8SA 3VTFA 1QXSA 5BSKA 4NU6A 3WMGA 1QLWA 1H94A 3MQ4A 2Q41A 1EA5A 1R4NB 1OPXA 2O50A 4I5FA 4JELA 4PQRA 3LHKA 1NAIA 4X3CA 1J90A 3IP3A 1VL8A 3TI9A 2O5EA 1Z4QA 1K4MA 4G0MA 4C4TA 1XD9A 2ONKA 5CFLA 1EXMA 2I2FA 4JJAA 1IXSB 1VPWA 1LQTA 2X5NA 4W9MC 2EF0A 2PKYX 4LNUA 3N2YA 1ZW6A 1ZCJA 3SVZA 2IS6A 3NFYA 1UM9A 3LPCA 1QRDA 1K6EA 2ZE7A 5AIAA 3EFOA 3D59A 2C2OA 2VO1A 3N2KB 2W6NA 2J6BA 2DFLA 3JD2A 4OV6B 4MIOA 2AJDA 2JJQA 1CUWA 4ND5A 1L4EA 3OWHA 4LF7B 3JD1A 1OFIA 5DH9A 2QR2A 1A97A 2ORYA 1OH6A 1BSVA 2O9JA 1X7HA 4WBNA 3IODA 1IUOA 3QWBA 3P94A 3C5VA 3H16A 3LV8A 4PC2A 1L4UA 1LK5A 3CLRD 4PLYA 4IV5A 3CWCA 4HAVA 4V0ME 4CL2A 2K2QB 4M0FA 2XIQA 1KAMA 3FSGA 3MQFA 4ND3A 5K3AA 3HDJA 2LTAA 4R1MA 2C54A 1TW3A 3WYBA 1U99A 4FC7A 3ZE6A 1SKAA 2ZJOA 5H68A 2W37A 2C7PA 2JB9A 4UHBA 1XMJA 2OENG 3IUNA 4ZD6A 3UAOA 1UCFA 2P4UA 3IEKA 3VHQA 1M54A 1WUIS 1WXIA 3FDFA 3AHGA 4TRNA 1L1FA 4TT3A 3CS3A 4F96A 3WBJA 4XDHA 5DM60 1EUYA 1UPTA 1SZJG 3Q7QA 2R66A 4AIRA 4WACA 2HA3A 1G18A 3KS9A 3VX4A 2VTKA 4AG3A 1GRVA 3QVGA 4NCNA 2I91A 3E82A 2FN9A 5HDBB 3R3YA 2QL7A 2W83A 3TRHA 4DV1B 3AVOA 2I22A 2CLCX 3NNDA 3NVAA 2D0IA 2ERYA 4RPIA 3PEVA 1AOXA 2ZQ5A 3IDFA 3OECA 3TLKA 2WA2A 2I80A 4H9GA 1KK0A 2P5UA 5K6AA 2AYZA 1E1CB 1NQXA 3GFPA 5B58T 3LT0A 4QYIB 4YN3A 1FXWF 4D4MA 1XQVA 4MKXA 1PKXA 3WGOA 2GPYA 3B38A 2QR3A 3UK1A 2H7XA 4CIXA 1IAVA 2HR1A 2CV2A 3OBBA 1XU9A 2IPXA 3AOEC 4MINA 2PUFA 1MAWA 1WXDA 2QDXA 1PG5A 1RP1A 3H11B 3KYDA 2FLVA 3LHSA 3PXXA 5BV8A 3W3AH 4LOKA 1FXWA 5EIBD 4MUEA 3IEMA 1DADA 3CNEA 1LBHA 3ENQA 4KH0A 5KWIA 4IXWA 2WPDD 5GY7A 3A6ZA 1UMCB 3GT4A 4UCFA 3QPCA 1CJVC 1TYCA 2IX9A 1PR1A 2JRLA 2VTEA 4M83A 4RK7A 1E1QD 5HE9A 3ET4A 1PZEA 3HI4A 3EGWA 3LX8A 3A6GA 3TW6A 4JASB 3ZE2B 1NUSA 3F9CA 2NO0A 1W5EA 1EB8A 4EJFA 3DFZA 4CEHB 3VGPA 4WK0B 1E5VA 3UMBA 1IOLA 1QHIA 1RU3A 1LK7A 3F49S 4TKVA 5DIZA 3AM1A 4MVJG 1T26A 3ESZA 2ZRIA 4YQZA 5IFLA 4ZEOA 1W93A 1OVGA 2H1CA 2E2WA 3M4ZA 2C9OA 4KLNA 3HKBB 4M1SA 1UBEA 1NYTA 3G6KA 1ZBQA 3V3TA 3HI6A 4H6PA 4P3PA 1MA3A 4CIAA 5I4IA 1D09A 5BRNA 4YV7A 3Q8MA 5DX8A 2NO6A 1CZHA 2H57A 4L08A 2JBAB 3F7OA 3FSRA 3LBNA 5KTNA 1NUUA 1K3TA 1QH0A 1J8QA