4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
2GCNA 1BBRE 1THSH 5DKMA 4UQOA 1P10A 5E95A 4OHZA 2J34A 2A31A 4I8GA 3AVOA 2FF7A 5F03A 1O2UA 5FBQB 3OY6U 4B35A 2XJ9A 4EDHA 1ANKA 1TGTA 2F4LA 1GMCF 4NYIR 3DPUA 1DLEA 4JLPA 2WIAA 5JHGB 2QF0A 4KSBA 4QBFA 3SNAA 3LLUA 4M9XA 5T3HA 3I1FA 1C4Y2 1S84A 3H7TA 2GCHF 4EPVA 3W5JA 4CR5A 2F43B 3VKGA 3MJRA 1HDTH 3DKVA 5G3YA 8KME2 4G5SA 4C3ZA 3BFVA 3RNLA 4DWJA 3M0EA 1LVGA 1ELVA 1G2MA 3H2YA 2ODNA 3BG4C 3EDXB 1VITG 2K1QA 3KQBA 4G0NA 1OE0A 3C4JA 4M53A 1KGDA 3TK1A 1DANH 2Q9AA 2Q1JA 4JLJA 3ZVBA 4QNMA 4URZR 4ZIRA 4HAVA 4DSOA 3A7ZA 2VL7A 3SNBA 1SGPE 1P62B 1C1MA 2X19A 3OE7D 3PCRB 2Z94A 1N6YA 3IPXA 2FWRA 1KSFX 3QKRB 1PQ5A 1T8NA 2O0JA 1NESE 5C4MA 4NSVA 1O34A 2OUKA 2R2MB 4FMBB 3PUVA 2OCBA 1O35A 1LS6A 1YKTA 2I6QA 3RABA 2EA3A 2B21A 4OHYA 3VXEH 2C96A 3MG9A 3X1XA 1II8A 1CGHA 2QNRA 2OEPA 1N6KA 3ZZ0A 3K65B 2X2FA 2ZJZA 5DHAA 1QY6A 2YOHA 1P2JA 1TMBH 1W2HA 3CP7A 4ZXXH 1JRSA 3E16B 2IS6A 3N7OA 5EE1A 1FZQA 4EPXA 2FESH 2HLCA 3PV5A 5HGGA 1M34E 3KQLA 4ITRC 4LV8B 5AUQA 3STIA 1N25A 2GZHA 4TMWA 1OFIA 2IWHA 1EZQA 2FO9A 1UK4A 1UTNA 3O8RA 2GK6A 4FW9A 3LGWA 1DWBH 1VG1A 2Q9BA 4ZKEA 1T32A 1A5TA 1XNJA 4NIXA 1XMNB 2CCKA 3SQWA 4LJYA 5FTMA 3IG6B 1G7TA 3VMFA 4JSYA 4P4SB 1ZW6A 3CRW1 2VVVA 3GD7A 3J81k 3WMEA 1P9WA 1EB2A 4K81B 4LWZA 3FANA 4EKDA 1GFIA 1C1WH 3SUEA 3EPKA 4LHWA 2ZU0C 1M9UA 2XC0A 2FPMA 2V54A 2BVXH 1NG1A 2D2EA 3NK8A 2RG3A 2SGDE 4YM9A 5F9HA 3GP8A 3LIWA 4EFNA 2QPAA 1HV8A 2KWIA 2BVSH 2OXRA 1TB6H 3PENA 7ESTE 4WMDA 5JI3E 3UR6A 1PJRA 3T5DA 4LJ5A 1U98A 3QDZB 1VJ9U 3QKRA 1OWHA 2FSIA 1EAUA 3QWCH 1ZIPA 2VIQA 3TVJB 2CXVA 5E7IA 4C0HA 4CYMA 1GHBG 4ON9A 2MMGA 4AD8A 2BCGY 3AW0A 1TNKA 3CKLA 5GJWC 1THPB 4G5OA 2OBOA 4B6EA 3NBZC 1NBME 2ZRJA 3OAAA 4YOGA 2NU3E 4GPTA 1CR0A 1B0UA 4HLQB 4B74A 3BTWE 4MRRA 5FOXA 1K1MA 1C1RA 2IEYA 1IQPA 5LPRA 2EYQA 3QK1A 4LI0A 1QB6A 3ELAH 1NIJA 1KY2A 4GZMA 3CR8A 1O2QA 1FMJA 1HAHH 1U0HC 5H1YA 1E4VA 1QHYA 2YC2C 1EASA 3GJ3A 1JALA 4QL3A 3DMDA 4GSYA 4M22A 2UZIR 4QJ5A 2VRWA 3REGA 1ZYOA 3Q76A 3PMAB 2IC5A 4LJ7A 1EQ9A 1WDTA 1W0ZU 4OS5A 4R2HA 2IYSA 5DG6A 4CT4B 3RSLA 1Y8TA 5F8XA 4M1YA 3IGFA 4AYTA 1JBKA 2GEUA 1O2LA 4OHVA 4DKXA 5C2JB 1CBUA 2BMGB 1NVXQ 4R8TB 1QHHB 4MGIR 2P67A 5IDVA 2OC1A 1NBMA 3GCNA 1J90A 2QF3A 1XMSA 1ABIH 2VIVA 3AUYA 2AGIX 1KAOA 2QXGA 3DZ8A 4JBYA 1MT0A 3QXXA 2QV1A 2ZJAA 2AIPA 2C77A 3ATMA 1Q3XA 2ZFRH 3SZEA 2XBXA 5BYKA 3VHXA 2ZI2H 1E79D 3CRVA 1V2RT 1T3LA 2ZRAA 2O8UA 1IQKA 2VHJA 1QQ4A 1HT2E 4WZAE 4ACAA 4RD6A 4D9RA 5EPYA 1QF9A 1J16A 3AP1A 1V2KT 3E70C 1AZSC 1E9CA 2BVRH 2VP6A 3ATLA 4E06H 1C5QA 2A1DB 3C8UA 4WMFA 3RC4A 1IN6A 2Y5FA 3MH6A 3VB3A 2G1JA 1FY5A 1XP8A 1AKSA 3AGQA 4YLUA 1A7SA 4H6SB 1JPJA 2BJVA 2ZPRA 2GKVE 3I61A 5EU8A 5JHHB 1C5YB 4EIWA 4B3CA 3BORA 1KXBA 1DS6A 4KJZA 1O0DH 1DVAH 3A86A 5CLLA 4MGYR 4BAQB 4ZV4A 4NPHA 1GHVH 4WH8A 4V03A 1K21H 4HAXA 1XUJA 1Q44A 2CK3A 3ZVCA 4U32A 1TQ0B 3QXSA 2GV6A 1TEXA 5BYJA 1QZXA 1DWEH 2X8AA 4JZFH 1NFXA 2PLFA 3CH4B 1T4UH 4J2YB 1GHZA 3TGPA 4MDSA 2DY1A 3T1OA 2O8DB 1G5RA 3M5LA 1QTFA 3A8CA 5FUXA 3EASA 4US1R 2JDID 1LS1A 3JZMA 1G19A 2BDCA 4JK5A 1HT1E 1TU4A 3D3QA 1Z2CA 1EAIA 4I33A 1RZ3A 1HXEH 2XB4A 3BTEE 2XBVA 1XF9A 3R7WB 1CLUA 3LJOA 1AGPA 2P2LA 1U90A 4Q80A 1LVYA 1RGQA 1QBNA 3U3KA 4KFRA 1AS2A 5I46H 3MI4A 3D6TB 1O2IA 4B71A 1M7HA 3QBVA 2WJGA 5FR2A 4OYHA 3BD9A 4H9GA 5KPDA 3MO9A 1G41A 5CYOA 3E5HA 4LHXA 1OXTA 3ZZ5A 3RS2A 1A7JA 1S0UA 3R9WA 3GJ5A 3P8NA 3KJEA 4HZUA 4B32A 2ZAOA 3TVDA 1HQYE 1IQLA 2RGGA 3NIBA 7LPRA 1F2UB 4JSTA 1W48A 2WPIS 3UWJH 1X1SA 2A2XH 4WJG2 3BXZA 1K1OA 5L8VA 2GRJA 4BLQA 2OBLA 4AURA 2FOHA 2GXAA 4AX9H 5G53C 4UDWH 4OI2A 1QJ7B 3D8BA 4YLQH 1PLJA 4M0LA 1UKEA 4D81A 1SGDE 1E9DA 3CZQA 2QP9X 4XTRA 4A0RA 2ZQ2A 1KZ7B 2C5LA 4GL2A 1YU9A 2FGKA 4E03A 4YMTA 4C7OB 4BTUB 1OHHA 1AQYA 3AKDA 2J87A 2FE4A 1RJXB 2ODPA 1O3EA 3RDZA 4AOQA 2GVDC 1GJAB 2YWEA 3K70D 2GP9B 4NA8A 4AC9A 2BY9X 2GMTC 1CULC 1MD8A 1IN4A 1P5ZB 2WWHA 4LK2A 5TCCA 4YZUA 3EAQA 4WAUA 1UHBB 3QVVA 5JPMH 1ZM2A 4EJSB 1FNMA 1ZRHA 3K0CC 5E4FA 2WINI 4TPIZ 4M4SA 1DBSA 3UIRA 4D4MA 3GJ7A 2NOAA 5FBRB 1YR9A 1BYIA 6CHAB 4A0HA 1GDQA 2QAJA 2OFOA 1N8OB 2FU5C 3SGQE 2H16A 1NU7B 3MWIU 4MDFA 1EX3A 3ZD7A 3MFYA 2VIPA 1GRNA 3EA0A 2ECKA 4D25A 3EQ0H 3QUMP 3MSXA 2YNAA 1IAQA 1UVPA 1ETUA 3BIUH 3P1JA 4DJZB 1SZPA 2Q6GA 3A8DA 4C9BA 1AD8H 4DDUA 1ZUHA 3Q7PA 1DAMA 3ZYCA 2BHGA 4QOSA 4P33A 3GICB 4L9WA 4X6MA 1OB5A 4JYCA 2YVUA 5J47A 4NTZA 3WYGA 1AKEA 4BASA 4HDOB 1P7CA 4LZ1H 1EP6A 5EE5B 1D3PB 2QSYA 2RGDA 1XCPA 3T15A 1IHUA 1XKBC 1KJYA 4TTPA 4N0DA 1MAYA 2NPIA 1EAWA 2CF9H 2VH0A 4DG4A 1JPNA 2BD5A 4ARZB 2WPKS 5EQTA 3ZQJA 1UTKA 4IW3B 1TUIA 5BN5A 1GKIA 2SGPE 4L5BA 5EXXA 3KQHA 1NN6A 3DMNA 4LXBH 1PQAA 3SU5A 3CS0A 4D8NA 1UKYA 4OS6A 4H1UA 4K5ZA 1C2DA 1LHDH 1SQOA 1Z0KA 2QSZA 2PGQB 1GI8B 2IXEA 5FHTA 3QF4B 1E6CA 4LOAA 1KXEA 1DE0A 4O03A 1F5LA 1RRKA 2PMDA 2PJRA 1SLVB 2AL7A 2Y81A 1WRBA 4M8NE 3AVTA 1LY1A 2GCHG 1E1QA 2YOLA 3CZPA 3I92A 4WBSA 1C5RA 1P12E 1DS2E 2R62A 3RUOA 5EXMA 3PMBB 4PAOA 5AUNB 2EFGA 4L9SA 1KSJA 4O3MA 2OESA 3PEWA 5TCAA 5FBEA 5FTKA 2BZAA 4POAA 3MNXA 2ZPSA 2ZROA 3P4XA 4AZ2B 4JZDH 5ANRB 2G0TA 4DIEA 5C1YA 1MZDA 2HGTH 3FKSD 3ATKA 3SJKA 3SW2B 4DOQA 5ABWA 3FYHA 1F0RA 3U69H 2VEDA 1T8OA 5DI3A 4B2CA 2F9VA 2AD1A 1GJ8B 5JZVA 1QHGA 3U7GA 1EZUC 3LDXH 3BK7A 4TLEA 4DUGD 3TIFA 1E37B 1R7RA 4ASHA 1KLIH 1DO2A 1NO9H 4R71A 1Y3YA 4FCVA 1NRPH 2Z6VA 3LV8A 1U9IA 5IRCD 2QBYA 4HZUB 3VFEA 4UXHA 4C7OA 3QJYA 1FAKH 2AD5A 4CEHB 2OP9A 1P6XA 2C9CA 3OEED 4LY6A 4IHQA 1IQFA 1TL7C 3MJHA 1NY22 2VWLA 5DI3B 3F9GA 1VTKA 1KK0A 1YZUA 1I2MA 6CHAC 2YYZA 1HQCA 2H5EA 2OM2A 4BFZA 3S1AA 1ODFA 3KCGH 1XCMA 2ZU1A 2YC4C 3TGIE 2J0VA 1PPGE 1NRNH 5F8TA 2AXNA 1S1CA 1BOFA 2PW8H 1U6QA 4PFSA 1TMKA 3BFXA 4IS5A 2C8VA 1DG1G 3VX3A 5EXLA 2GCTB 4KLZA 5C1XA 1V2MT 3Q7QA 2ZJ8A 1G3CA 1VJAU 2YNBA 3N5CA 1U8YA 2STBE 2OC7A 3MHWU 4B6FA 3LC5A 2FX4A 1U8AA 3BERA 4CEHA 3KX2A 3PM3A 1G8HA 3O8DA 4FUHA 3PEYA 1ZC3A 1GHXH 3WHKA 4OS4A 1N5IA 3HATH 3LW7A 3LC3A 1K2I1 1NG9A 1DSTA 2G81E 3RANA 2ZG0H 4UFGH 4JBXA 4WXIA 5G41A 4KYUA 3NCLA 3VKWA 5EXPA 3A7YA 4Q7YA 4X8LA 1Q57A 1C2MA 2LNCA 2JLYA 1HLTH 1E9SA 1R8SA 2IS4A 4RD2A 1W12U 3VB7A 1HPGA 2XOKA 4RZUA 2FA9A 4C4PA 2OC8A 2DHRA 1MH1A 3AVQA 2DE8A 2CLSA 1W4BA 1W0JD 5EP3A 4B2AA 2IPHA 3U6BA 3RXSA 3GY2A 3GY4A 2ZYTX 4Q03A 3DZDA 1OS8A 4U01A 2BOHB 3X1DA 1IY2A 2ALPA 3A1TA 1GILA 1C2IA 5HM9A 2Q3MA 1R6BX 1Q3TA 2WUCA 2XC5A 2J2UA 1WAYB 2ATXA 2GEVA 2K5UA 1GPZA 2O0HA 3UMSA 4ISHH 2SGAA 4XWAA 2PLRA 2ZPTX 5KSZA 2KAIB 1E2NA 4U00A 2ZI6A 1AFQC 2I1VB 1CEEA 4DBLC 3SJ9A 1VITH 1S85A 4NZLA 2AMDA 1U0LA 2ZU4A 3AF3A 4GLYA 4E22A 2Y7ZA 1EGAA 3SYNA 3LWNA 3A1VA 5AJYA 1P2OA 1IAUA 4HUQA 4FXGH 1E2PA 4V0OA 3EWSA 1P9NA 4B3FX 4GOJA 1MTWA 1W5SA 1OP0A 2R6DA 4NU0A 2FGJA 2H6MA 1AQUA 4ZDIA 3M5NA 4ESHA 5A8ZA 1IQMA 1Q20A 1EOJA 1P2UA 2ZS8A 1E9FA 1PYTC 4WXPA 4XFQA 2ZRGA 4M1WA 3B60A 5JJLA 4NCKA 4RVCA 4JT4A 5KPJA 4ACBA 1E2JA 2YV5A 1S1MA 3GLGB 1QHHA 1E9RA 2AN9A 1O2WA 5EW2H 1OV4A 4K8BA 5LD2B 1WA5A 3SI4H 1UTQA 1TONA 1E0FD 5G40A 3QG5A 4TSFD 1SSXA 2IF2A 5E7JA 3S7HB 3TRFA 1IQNA 2RGXA 4GRAA 2CK3D 2O52A 5JBCS 1XEWY 2BQ6B 1DX5M 2XZLA 3LGVA 1LNZA 3EPJA 4TTQA 4BAOB 1SGEE 3NHAA 5GJ4B 5ESTE 3SQXA 2WPDD 1BRCE 1SI5H 1KAGA 4HGCA 1RRFA 5DGXA 1OIXA 5J4HA 2BM2A 1ESTA 2F9LA 4D82A 3GFTA 4X8UH 1G20E 4NCIA 2BZ6H 1H9LB 2ZUBA 5SZIA 3GLIA 3AV0B 3QTVH 3OIVA 4ABBA 1NMXA 2C3SA 4U02A 5JS8A 1CS4C 5ELXA 1YZTA 1AQ7A 5AK0A 4TYDA 1JJ7A 2AS9A 1V2JT 1GJ4H 3GYLB 1YPEH 2ZRKA 4X8VH 5FXLA 3RM2H 2ZYVX 1XUIA 1JNYA 1TLDA 1GMCG 2P3SA 3TNTA 1KMQA 2HNTE 3A1UA 2G88A 3T28A 3C1KA 2H18A 2D1JA 3SC3A 4NYMR 1TPSA 4X2WA 4JLKA 1MCTA 2ZJ2A 1QBVH 3IWMA 3OEEA 4FU9A 4YC7A 3MNSA 1QL8A 3M3SA 1RIFA 2QPOA 3KB2A 4AIIA 3REFA 4Q4JB 2ORVA 2CVFA 1S8FA 4FUFA 1OYTH 1RE0A 4Q1EA 2J45A 5EQRA 2ORIA 1EPTB 3LLMA 1T0HB 1CHOG 4QBGB 1OFUX 1GDDA 4D0GA 1CA0C 3T62A 1U8ZA 3CBQA 4V0ME 2SGFE 4II7A 2VIDA 3LGUA 1GG6B 4US2R 4EFMA 4EQ6B 3B9PA 2WKRA 1XTRA 1R10A 2VHUA 4US0R 2HWLB 2TBSA 2Z9KA 3I72A 4MUAA 3ETLA 2ZRMA 1T5LA 5DO9A 3GLHA 1XZPA 4AG6A 1E98A 3GYMA 2ZYUX 2FPLA 2BY7X 2XXLA 5F6MA 4WVPE 3P8GA 4MPVA 2AEIH 4Q18A 2CBZA 2QRZA 1MKWK 1E79A 1C5WB 2RKOA 4UFDH 4TYPA 3D7MA 1BRBE 1O33A 4GHTA 3TPIZ 2HJGA 2G8TA 5CJ2A 3D62A 2W7SA 4B2BA 2O8WA 1YPKH 1O2VA 2QUZA 1CT0E 1IXSB 3TSZA 3SU3A 3ZZAA 4GDFA 4MVNA 5TXGA 3B82A 2OLJA 4Q66C 4BTIB 2ANKH 2PMKA 4MKHA 5JLJA 3ZVLA 2BBSA 4RD1A 1ZMLA 1WMSA 2G5NA 2EYUA 2PT5A 4XD7A 4RSPA 4PQYA 3Q00A 1G7CA 1US8B 3LOXA 3AUXA 2ZU5A 4QRHA 1KO1A 2O5VA 3A58B 4LGMA 4GCHG 1UTLM 1FIZA 2GDEH 1G3RA 3UKDA 2ODWA 5HCIA 1GBHA 1YP9A 3RDPA 5LGOA 3GPLA 3GDVA 3QGJA 1AB9B 1RS0A 1IN8A 3KKOA 3WRYC 1C9TA 3A7WA 3SZRA 2IHYA 4PZYA 2FMJA 3UNQA 3GY8A 2G5VA 4XSGA 2ZE8A 1C2LA 1OW3B 4XH9B 5DK1A 2A32A 2R2WU 5SZJA 1E69A 1AZTA 2WWXA 2W0MA 5KSPA 2J7PA 3X1ZA 5DP4A 3I5YA 1QB1A 1F2TB 1Q22A 2O8TA 1GI7B 3U8RH 5GVRA 5C67A 3DL0A 3KGPA 4BFXA 1YRAA 3U7FB 3WHLA 1SHKA 4FCTA 1NLYA 5I25A 2SGQE 3QX5H 1NU9A 1O3YA 4CHAB 2BVNA 4GOXA 1H4WA 1E2DA 2G1KA 2X2EA 1Z63A 4TLBA 4PAMA 1S6HA 3M3VA 4MDEA 4ZXYH 1XU4A 2IYQA 4K60A 5DNYB 3FHTA 3AQ4A 3ZZ8A 3N2EA 3P20A 4DHEA 3IILA 4AYYB 3GLGE 5FX6A 2OFXA 2O8MA 2XNIA 3A84A 3UK6A 2VWNA 2RGBA 1WQ1R 2X77A 1AN0A 4MNYA 5DI9A 4AG2A 4HB2A 2IA5A 2ZU6A 3QXCA 2ZKSA 2BLOA 1DSUA 3RRYA 1X3SA 3TGKE 3QF4A 2WYJA 1OHHD 1W46A 1N3BA 1IY0A 2P6UA 4TZ0A 2PZFA 1S9DA 2BD8A 2HPQH 1N2CE 3GQBA 3I3SR 1XCGB 1GG6C 1Z6TA 1PV4A 4UD9H 3R9XA 1P9RA 3T12A 1ZCBA 1O2ZA 2QAGB 2O8BB 4BZPA 1T8LA 2XC4A 1TGNA 5FX5A 1E2EA 4HAUA 2QAGC 5DHFA 2A5YB 3H5CB 2ONKA 4RKOB 1PPZA 4I32A 1WCV1 1BIOA 4UNQA 2XXAB 2GWHA 4QFMA 5JRZA 1AVWA 5J5CA 2ANMH 1SFQB 3ATIA 2YWGA 3SFVA 1F0UA 2FSHA 1GBCA 1EPTA 4ABIA 2BX3A 1KDQA 1G8GA 1UVOA 1O2XA 2ULLA 4A1XA 2W6IA 1HFDA 1Z6JH 2G83A 4D7GA 8LPRA 3DFLA 1SGWA 4NYMQ 3VTKA 4H4FA 4CDGA 4LSGA 4DDVA 1ZSJA 1LW7A 4NCJA 2CMYA 2Z9IA 6ESTA 4A2QA 4EFLA 3LFUA 1PPFE 1LF0A 3MYWA 1SOZA 1D6RA 4X2YA 4QG7A 4TWYA 5CK5A 2NGRA 3TQCA 1BIFA 1ELFA 3W3AA 3ZZ3A 1MABB 2VSFA 4JCNA 3BRWD 3AVYA 3UREA 3B8JA 1OH5A 2PKAA 2V8OA 1Y3VA 1FQKA 3A81A 5DIFA 3QXJA 2HPPH 1FY4A 1IY1A 2DFTA 1HYLA 2VHCA 2CHAB 2SFAA 1ELOA 1CBWB 1GHBF 3OTJE 4BFTA 2QI9C 5D3MB 2C8ZB 2ZJ5A 1TIOA 4DIHH 3IQXA 3S9BA 3S9CA 3AASA 4NFFA 5SGAE 3SNCA 1GI6A 4DZZA 1GBEA 2JKHA 2F9UA 3NBYC 2XTTB 521PA 1ZCAA 5FUVA 1ZIOA 4ZDJA 4DLVA 1SGFA 1DTSA 2CLCX 4ABGA 1P73A 3LH5A 3DDCA 3BH6A 2J92A 4Q5IA 2WPMS 3BAFA 1Q1BA 3SV2H 5DYGA 4BLSA 2ZIQH 1AFEH 2EI6A 4UNPA 5A09A 5FCKA 4M1OA 1TPPA 1HXFH 3SQHE 4ZKRU 3OAAD 4DEXA 3EA5A 1SHYA 3U3MA 1M74A 4Y0VA 1TX4B 2R9PA 3KIDU 5TV2A 1E35B 5FOSA 4O0MA 3Q5EA 1CU1A 3DOEA 4MKIA 1BMFA 4XSHA 1P06A 2PWXA 2ZO3H 1T8UA 1K22H 4I8HA 1WQVH 3TE6A 1KI6B 4TYQA 4Y6DA 3M36A 2ZR0A 2ZWLH 5B6OA 2OSBA 1G18A 1YRBA 1DUAA 1W7AA 4AKIA 3RC5A 1N6NA 4WW0A 1Z83A 1YJ5A 4INLA 1O32A 2AK2A 3KJIA 4PC2A 4L15A 1WBGB 1NY5A 4ISIH 2FI3E 4MG3A 1KOFA 1XVMA 2FSGA 3AP3A 2GCPA 5A0AE 4B34A 4HZHA 3UIEA 3PO1B 1FMLA 5K7RA 4P4UA 1RRPA 1XPOA 5T6DA 2QYIA 1P2VA 4B48A 3AF4A 3V00A 2BXUH 2XNSA 4Y71A 4FI3C 2KI5A 4DLTA 1QHNA 4OHXA 1JB1A 2FIRH 2P6RA 2OXCA 3ZV8A 1SULA 4PROA 1P3EA 1H8IH 2P65A 2FOGA 1JEDA 1LVMA 3SGAE 2ZQ5A 1XD8A 1R0WA 2UVQA 5AUPB 2O8FB 1NVVQ 5FOWA 4EPRA 4V0MA 1TGSZ 3RWMB 3AF2A 3EXAA 5EXTA 3R0FA 2DFNA 5CB6A 2QGRA 4HB3A 1ZUNB 3NVAA 4G5QA 4YT6H 3IUYA 3GY3A 1RRGA 8GCHF 2P16A 1T0JB 1OXGA 1OP8A 2GF9A 4JZKA 3BOSA 2I1QA 1FX0B 1LVOA 2ZDVH 1Y5UT 1QJ1B 2CL0X 4XJXA 1NLZA 2ZFPH 5JSZA 4M9ZA 4BUJA 2C03A 4CBOA 2CCJA 5DH9A 2WJJA 2ALVA 3EAJA 1S82A 1F48A 3A8AA 5H4IB 1E0JA 4HZIA 4A6XA 1B23P 2V4ZA 5C2ZA 1HV7A 4PC1A 3TNSA 2IWRA 2STAE 5JJKA 5DISB 4BFVA 2G77B 1YZGA 2F7SA 3BJIC 2BYAX 3SFZA 1BCUH 2VA8A 1KY3A 4WZBE 4NG9H 5AJVB 3QENA 3T5GA 4DSNA 3GLFB 1JQLB 1DM4B 1OWEA 3R8CA 4PPQA 1GUAA 1ZAKA 2QGNA 1HAVB 4KBFA 2RDLA 1XD2B 4LPKA 4A4DA 1L1GA 1T31A 2GBLC 3PUXA 1HE8B 2GMTB 1ETSH 1BTXA 2MSCB 3A80A 3H1TA 5GPIB 3L33A 3PVSA 2A7CA 3UWKA 1C1VH 2VP4A 3W94A 3TW8B 1V2PT 1AWHB 5L6NH 1PLLA 1IXRC 2ZEBA 1FN6A 2F91A 4KO8A 4URWR 2BOKA 4DCUA 3G0HA 4IEIA 3P17H 2GJAA 2Z4RA 3OF5A 3M35A 5TB5A 4JL8A 4BWYA 4KVGA 2WV9A 4VGCB 2LKDA 2AXPA 2YNMA 3NEJA 1Y59T 1MCVA 1ZSKA 1L7VC 3THXB 2FV8A 1UCYH 4Q4AB 1X1RA 1KSGA 2GHIA 2ZGJA 2C04A 1HAVA 2XZPA 1O3JA 4ABDA 5CM8B 4DJTA 1C1PA 1CR2A 1JXPA 5FTLA 1LB1B 4BGDA 1JIMA 3EZ9A 2JETC 4Q9HA 1ACBE 2J38A 2Y6TA 1VYTA 4A1TA 1AZZA 5EQQA 5GCHG 2RGNC 1FY8E 3OIWA 3S69A 3OEHD 1KI4A 3MWYW 1ABJH 2WICA 2PKSC 1Z0FA 4C0LA 1OFHA 1THRH 5DSZA 1NSFA 4QC2A 3QIAA 2BD2A 3VR5A 1MQ6A 4VGCC 4QM6A 1G7RA 2WWFA 2J4IA 4TMKA 2QGZA 1QBOA 3VEQB 1IQHA 1ZM4A 4AI6A 3Q72A 2ZUCA 1ELAA 1BZXE 3FDIA 3QOFA 1T3HA 1MRSA 2QA5A 5JWOA 2ILNA 1G291 1E4YA 1QRAA 2O8EA 3PEUA 1JWTA 3SEAA 1XJ0A 4XWKA 3AF0A 4CIDA 4KELA 5FBWB 4ISOA 4HUQB 4Y0YE 3U2QA 2BLQA 2ODEA 3PB1E 2ORWA 1L2TA 3AKCA 3NZIA 3GY7A 1FOEB 3LH1A 1AO5A 4PC3A 2R6GA 1LKAA 3HK6B 1N6RA 2A0QB 5HR5A 3OTPA 3CONA 5GVSA 3A6PC 1XM1A 3NKVA 5JJIA 4BZXA 2G00A 221PA 3GJ4A 1WSSH 4B33A 1P75A 3M61U 1Z8GA 3DFJA 2VYFA 5DN6D 1TQ2A 4MRVA 5DN6A 2A5JA 2XNDA 3NTUA 1KKMA 1NLFA 2CE2X 1E2FA 5B30A 4L4UA 1P0SH 3B6EA 3UG6A 1MU6B 2VF7A 2EFHB 3DHWC 3K70B 3BTKE 2Z0MA 4TL8A 1TQDA 3W3ZB 1EXMA 3GDSA 3FMIA 3ONWA 3F0TA 1QG4A 2A7QA 3SJAA 4I81A 1BO6A 1RIWC 4G5RA 3LXRA 1EXFA 1PYTD 1W0YH 3TK6A 1TF2A 3FMPB 4MA4A 1C4U2 1CSOE 2ERYA 3F1SB 1LTQA 1ELBA 3GLIB 1BMLA 3SO3A 5L2YH 2A5KA 2BWJA 4IJMA 1KYIA 1RVDA 3T61A 4ZHAA 3VXFH 2ZF0H 1J9CH 3FWYA 2PFEA 4DDWA 1RKBA 4ABFA 3UQVA 2CCGA 2ZRLA 1YCPH 2OCAA 4DUGA 3RXRA 1NZQH 1NT1A 1Q1EA 3ICQB 5A4JA 2GILA 1HAYB 1W2KH 2F3RA 1GL6A 2A5AA 4RZ3A 3B1ZA 3A1WA 1XUKA 3CO5A 4TMTA 1NFUA 2ZAMA 4MGZR 1TTTA 3FKSA 1DOAA 2N1BA 4MYHA 2WBLC 1OPHB 3VU9A 1TBQH 3RS7A 1SR5C 3BGWA 5E0HA 3T27A 4IDHA 2BDYA 3FVFB 1KDQB 3BIVH 4CRAA 1RD3B 1OB2A 1FTSA 3RMLH 1O5AB 3HKIB 5F3WB 2HVXA 3B8HA 1E1QD 4UFFH 1O5GH 1EB1H 5A8YA 4I4LA 4IOKA 3EA7A 1GI9B 2FTLE 2AMQA 5LH8A 3TSWA 1T7CA 3MH7A 1FPCH 4BNRA 5K8UA 5UKDA 3TLXA 2Z5FA 4NA9H 1KI1A 1ESAA 4WF8A 3WP0A 3T34A 3KB1A 5FOVA 1EX6A 4X6PA 4ZROA 1NL3A 4Q4HB 2VTKA 1V43A 3KL4A 1GL0E 4ABJA 3FTQA 1CJUC 2V6IA 3OU0A 2QN6A 5LB2A 5C4GB 1UKZA 5JBBS 4GP7A 5L3QB 2BKEA 3R3GB 1C1UH 5EP1A 4BLPA 1W10U 4FMCB 4C2UA 3UPEA 4JLOA 2EQBA 1SGRE 3E0NB 4I1UA 4CZ2A 2ZFFH 2O0KA 4Q7MB 3ZZ6A 2HRVA 4GP6A 4ZKNU 3FMOB 3ZVFA 1ETTH 1P60A 4AB9A 2CE7A 3I62A 2B0FA 2IYUA 3GDUA 4S35A 5J4LA 1D9IA 4PO8A 3MCAA 2P8OB 1J17T 4OJKA 4OGYA 2GESA 1N0UA 3R20A 2BEKA 2DFLA 3LPRA 5BPEA 2WWWA 1TOCB 3K2UA 2QRNA 3KQDA 1W7GH 3TIUA 3CPEA 1OX1A 2UWOA 1DO0A 3LD9A 1ZHRA 5T6GA 2BBWA 2BDIA 2QORA 2D3WA 4RSGA 3KQEA 2PBRA 3D49H 3I5XA 3QPUA 1FXYA 4JZEH 1O3AA 4BAKB 3RHFA 3SN8A 3L0SA 3ZLJA 4IOMA 4KI0A 1KNXA 3IHLA 4UJ3A 2VO1A 3FZZA 4B75A 2OD3B 2E87A 1F7ZA 4F4IA 3GOVB 4O2LA 1HGTH 1R5NA 2CGAA 1KI7A 1OYWA 5DP9A 1HUTH 3MAAC 1AHTH 5E7MA 1P2IA 4OBEA 3TK5A 1HY3A 4P3YA 2DR3A 4DLSA 1SXJA 3UNSA 1UK3A 2OT3B 5AF9H 3MO6A 1GMHG 2WZQA 1QRZA 1Z08A 2JJ8A 3SJZA 3QF7A 1GVZA 2F9MA 5IF9A 4Q7XA 1FAXA 821PA 2NG1A 1LPKB 1C5PA 2FYQA 1S83A 1C5OH 1C5SA 3ZJYA 1A1VA 3V3MA 1ZOMA 4JJKA 4GZLA 3QPWA 4U7DA 1WXRA 2ZE6A 3SU0A 3ZZ9A 1VIYA 4INHA 3HP1A 2WYGA 2EEKA 2ZDMA 5K8IA 3DT0H 4NE2A 3CPHA 3K0CA 1XTJA 5M04A 2ZI4A 2Q9CA 4UNRA 1S3GA 2CN0H 2Z9LA 4ZDWA 5A0FA 3CWZA 3E1SA 1GMDG 1MKWH 1UVTH 1N0WA 4DXAA 2J0UB 3PXGA 1C1OA 4X1NU 3QNUA 3TKLA 2QMOA 4MKGA 1F0SA 3TNFA 1A5GH 2F9PA 4M1SA 1ELDE 3U98H 5KNBA 1Q2WA 4NIVA 4Q7ZA 3EW9A 5GJVC 1X6VA 4CW7A 2AKYA 1SXJE 1EFTA 4AORA 1Z3IX 3LGYA 3FHCB 1A61H 2FPZA 1J8AA 3Q77A 4WWYA 2ANBA 3RU4D 2PT7A 1UVUH 4XOIA 1L0ZA 2JA1A 1HYQA 4FUIA 5LB4A 2Z4SA 1O5BB 1GBBA 4TPYA 1GL1A 1E0SA 1O3LA 3EC2A 621PA 5SZHB 4W7SA 2ZQ1A 1O3OA 3M3TA 3SV8A 2AIQA 2WOOA 4GVUA 1LHGH 1DY8A 3AB3A 4PHHA 2Q0HA 3LX5A 2OLKA 4Q1BA 3B23B 3RS5A 3ZZBA 1HJ8A 3NXPA 1C1YA 4NH0A 3D23A 1X86B 2ZE7A 4EJSA 3H84A 5JBTA 2FNAA 4JKYA 1K8RA 4O3TA 1NSTA 3L8YA 1FX0A 3TW4A 4NONA 2BY6X 5FOUA 2FI5E 2DYKA 5JI2E 2RA0A 5A0BA 2ZRNA 4ZCLA 4HTCH 1AKYA 1G4AE 1Q31A 3HGNA 2WSSA 2BD9A 3KFXA 1KNQA 1Z47A 3IEUA 3QZRA 2W6JD 3A7VA 1ZVQA 4OHWA 1F60A 1F0TA 1GSIA 1UDXA 1DVRA 4Q7KA 2PV9B 2Z6BD 3WMGA 1S81A 1G4UR 5LPFA 1C5VA 4FMDB 2KB0A 2UUYA 4NCYA 3PYHA 1QL7A 4D76A 2A7HA 3EYDA 1NRSH 2TGTA 3KKQA 2R6AA 2R3YA 1UPTA 3BEIB 1CT2E 4RFSA 3UOPA 1YKSA 4HATA 3FB4A 3CNLA 2JJ1A 3UATA 1UO6A 2RGAA 1ZZZA 3MD0A 4AKGA 4X1QU 2ZJBA 4DT7B 3KUCA 2FS9A 4LBYA 3CNNA 3ITIA 2ZGCA 2ODQA 1OH8A 1YYY1 1G5PA 1QIXB 2F9OA 3U4QB 4Q1AA 1AE5A 2XWBI 3MGCA 4Q00A 2NU1E 3BF6H 4YESB 1UBCA 5FPHA 1LO6A 3MUFA 3L0IB 3PQCA 5CIQA 1XXHB 4DCNA 4EPWA 3VPKA 2CXXA 4IC6A 1P2NA 3SE0A 4K46A 3CF2A 2WSSD 1U9IC 2NIPA 4TQ9A 3K9LA 2GZ7A 2GNOA 1BUIA 5JS7A 4BANB 4NFEA 3KZ1E 4YOJA 4X1RU 1D4PB 4LYFA 1N0VC 1EG7A 3H7OA 4NWLA 5A2MH 1PJPA 1J70A 1E2IA 1V2QT 5KOYA 1FFHA 1CJKC 3SZNA 1MO4A 5FUWA 4AKHA 2JASA 4ZHLU 1OXXK 3QKSB 4HB4A 4A82A 1HNEE 1WBDA 1QRWA 1S6FA 2AYWA 1S2MA 4CBNA 2PCJA 3T26A 1UJ2A 4G5GA 3PR1A 2BX4A 1TNIA 2BMEA 3NBFA 5EG4A 4Q7JB 3ZS8A 2EVWX 3K9GA 4G01B 1R4AA 2Z83A 3V0XA 1M7BA 1H8EA 4RCYA 2AFQB 5K8TA 4XBBA 1YPHE 5B58C 4HEJA 4RI0A 3A88A 1UBFA 1MTUA 3S0NA 4B43A 1ESNA 3SU6A 3NHBA 3RXIA 4FUDA 1TA2A 2XOKD 1T8MA 3PUWA 5IHPA 1FJSA 1ZD9A 1E9EA 1MTVA 3A37A 4NMMA 1DG3A 3BEFB 2H92A 1GHYH 4OS1A 1GHWH 4I8JA 3M1IA 3ZZ7A 5DPAA 5H68A 1UCYE 2G9NA 1Y3AA 1XJCA 1N8OC 1P05A 2IN2A 3B7GA 2C9YA 4IEEA 4YXWD 1C9PA 1RJ9B 2GAAA 2Z9GA 2VHQA 3WY9A 2Z3CA 1IJEA 2VP2A 1BKDR 1TA6A 5JDUB 1O5DH 2V7QA 3RXMA 5C18A 2D62A 1E9BA 2GXQA 3P92A 3U60B 1GVNB 2ZITA 1D2MA 3MMPA 1YR8A 2HV8A 1OOKB 4DCDA 3I77A 4HI0E 1SVOA 1YPJH 4THNH 1HJ9A 1LQEA 1A82A 2IEZA 1ZR0A 1ZTKA 1KI2A 4XTCS 3F8TA 3LQQA 3SORA 5IT5A 2J94A 1G1MA 3L82B 4V0NA 5ETXA 2D7DA 2OCPA 2B9LA 5FBLB 2ZVQX 1QA0A 2W3IA 2ZR7A 3VGCC 1LFDB 2RHMA 4GOKA 1R0YA 4F91B 1E2QA 3RLFA 2ZA5A 2O8LA 1AVGH 3ZS9A 1INCA 4JYVH 1EZSC 3LJJA 2WPLS 2V1XA 1L2EA 1C9KA 2NZ8A 4FMCF 2Z3DA 3BFKA 1JQJC 1GWNA 2BD3A 1W49A 3LVRE 1E94E 1Z7KA 1GJCB 1ZSLA 1HURA 1LTOA 3PV2A 3SNDA 4KP0A 4P0TA 1Y3XA 4F49A 4CRFA 4LYHA 1COWD 5HMAA 4Z1MA 1NN0A 5LD2C 4NIWA 4DCSA 2IYZA 3S7KB 3RXEA 1NVWQ 4ZKOU 2YKGA 3K0SA 3LDAA 3QKUA 5J40A 4TZ6A 1GKYA 5EOKA 3P26A 3I32A 4TQAA 3M6AA 4CH2B 1G64A 3U4QA 1N1LA 1DAIA 1BJVA 3SUGA 2BDBA 3NDPA 3W5IA 2BD4A 2F3CE 2ZGHA 2D74A 2QTVB 4KCGA 2RGNA 4LHZA 3VKHA 1IN5A 1O5EH 4PXAA 2BY5X 1H1BA 2PTNA 1BTUA 4M7GA 4Q4JA 2G55A 3I8XA 3TSOA 2O9QA 2F6RA 1XUHA 3RYTC 1WF3A 4NZQA 5BWMA 3K6YA 2XXAA 3ADKA 2B6HA 1Z8FA 3A82A 2BDAA 4DIIH 3GJ6A 5K0HA 1SXJB 4CVNA 3X1YA 2DPXA 4TYNA 1V2LT 5LPEA 1UMAH 4BFSA 2O8BA 4INKA 2VWOA 3T35A 2WSMA 4ZH8A 1KJWA 4KVAA 2B5TB 3RXKA 4BZQA 5KU1A 2WMNB 1CRQA 4TSFA 1DOJA 2XEXA 2H9HA 3M7UA 1O5CB 1Z5ZA 1QB9A 4LJAA 3URDA 3OY5U 2CEAA 1II0A 1J14A 1NVUQ 2ZRPA 2B7DH 1FY3A 3BC1A 3CNOA 1LPZB 3EZ6A 1OXVA 2AFHE 3JVUA 1G6HA 1P3JA 2WPJS 4KU4A 4HLUC 1X8JA 3O8BA 1MBMA 3B5JA 1IHSH 4P4TA 2A4OA 4A2WA 2NO9A 2VJ1A 1P11E 1W0JA 3U9AH 1W36C 1ELGA 3H86A 4PAQA 1YPHC 2C93B 4PSAA 1V2OT 4FWTA 4KGAA 3JVVA 2HF8A 3RMMH 4HUTA 2WOJA 1KXFA 1NRRH 4XBCA 3SU4A 1TPOA 2NTYC 3K6ZA 5DP7A 1HE1C 2FX3A 3NG1A 2J3EA 2GCOA 4Z54A 5C1BA 4Z8YA 5B6LA 1D9XA 1EJAA 1OJLA 1DWDH 1H8DH 1VDZA 3QI2A 1M6NA 1KTTB 2W6JA 1V2WT 3NBXX 1UEIA 2BDTA 1SQTA 3K70C 5LBIA 1BBRH 2RCEA 1JOUB 1QG2A 1A3EH 5E3HA 1RPZA 3RXHA 3EPHA 2FOMB 1Z0AA 2VNTA 1VHTA 1YM0A 1MD7A 3SQEE 3ICEA 2HCJB 3AVPA 2P3TB 4DLYA 2D7CA 1RW4A 4GHQA 5HKKA 1NPMA 1C2HA 2P0EA 1BQYA 2BKUA 2FOLA 3GY6A 4JS0A 3LH3A 2YJTD 4XVRA 1KI9A 2XX3A 3CLVA 1N6OA 4W9MC 4ISLA 3P8FA 4BEJA 2HJVA 1BMAA 2IXFA 2Y8EA 2JJ1D 1OH6A 2TMKA 1ZU4A 4EPTA 2IL1A 4EQ6A 2XWAA 5FPTA 1MUEB 4HLUA 1ELCA 3C16C 5IK2D 2JH0D 5CHAB 2G6BA 4ZAEA 3GJXC 3R9IA 2CMKA 3CF0A 2BOVA 2HOBA 2ZI3A 1FP6A 2ANYA 1XTQA 1O5FH 4TQUS 2FZ4A 1F5RA 1VYUA 3ZYEA 2F1RA 1GBJA 1KMHB 1O3DA 2CNWA 2ZCLP 2GJ9A 1OWKA 3SU8A 2RAPA 1BDAA 1KK3A 3DA9B 1Z6AA 4CT5A 1Q1QA 3E0PB 4ZDKA 2YZ2A 3GLHB 3KKPA 1FI8A 1K5DA 2V9PA 4J1YA 3NH6A 3RXDA 4GBMA 1KLTA 1IOZA 4KHZA 3ZVDA 2OCYC 2QMUA 1UHBA 2UUFB 5J4VA 3ZVNA 2PSYA 3TU7H 3MWJA 4F38A 2XTMA 3TR0A 3QKSA 2DCUA 4DLXA 1GBKA 2XJ4A 4Q21A 1AS0A 1KZGB 4WY3A 4L8GA 4K1SA 4N1AA 1XPRA 3RC6A 4D0NA 3EIHA 4Z1MD 2HDNB 1O3HA 4LJ8A 3TJOA 1TQ6A 2JAQA 4C0QC 2XZOA 3CM0A 5BN3A 1D6WA 3OEHA 1UF9A 2GDJA 2AKAB 3AK5A 1GCTC 2H2ZA 5CITA 4CREA 4ASUA 9LPRA 1WTHD 5EXNA 4O25A 1UFQA 4A6LA 3PLPA 3PFIA 5IK2A 2NPFA 4ABYA 1C4OA 1XBTA 2PTCE 1DFPA 4QHYA 3NPSA 4JYUH 2LPRA 1XEXA 3KTAA 1DPOA 1V2ST 4IN2A 3K0AA 2A7JA 2A9KA 2ODBA 5DYIA 2BHRA 4F4CA 2ZRDA 3R8FA 1ZBDA 4TLDA 2P59A 1IONA 2QP3A 1BTZA 1TPAE 4KTCA 4ZMAH 1N5JA 1MO6A 4Z6AH 1JR3D 1H8ED 1SVLA 1FUKA 4X6NA 1O39A 3MU4A 1ZJKA 4ESVA 5E2OA 5E8EH 4ZUHA 4OQFA 2JLRA 2E1RA 4FIDA 3E1XB 2H1UA 3CX6A 2BB4A 3WBKA 1XTSA 1TAWA 4DY7B 5GJBA 2ZEJA 5H8WA 3SU2A 4Y7AA 3SN6A 1YLDA 3WYFA 2XSZA 1ZM9A 1W7XH 5F8ZA 5FPYA 4YXWA 4A9AA 2W5EA 2PUQH 3DKPA 2IJD1 3AW1A 3Q3YA 1TWXB 3SBDA 2YHSA 3BB3A 4ERNA 4DEYA 3Q9LA 2RMKA 1SXJD 4C30A 4GMDA 5TY0A 3E90B 1TRMA 1NN1A 4D0LB 2Z43A 1QL9A 4DSTA 4B2IA 3MOCA 4KITB 1P09A 1UTJA 1C5NH 1DWCH 1XXHE 1MO3A 4LOYH 3ODDA 1GM5A 3DOFA 4ZCIA 1GGDB 3STJA 2P3UB 1NRJB 1ZPCA 1PPCE 3K0EA 5H70A 1X8KA 4WOPA 2Z3EA 4FINA 4Q1FA 4MPWA 1LDTT 3A8TA 4LHVA 2PZEA 3DM9B 3FP6E 4FUGA 1GJ9B 3QVUA 4EPYA 5CHAC 1EZXC 2HALA 3K53A 2ZDLA 2ZE5A 4KFTA 4FN5A 2ZRHA 4BFUA 5EODA 3LX8A 1MQ5A 3U5ZB 1R8QA 5TMPA 4KV9A 1NY6A 4TL6A 4I8KA 1Z2AA 3LAWA 3NWUA 1V2TT 1M1YE 3KEEA 1BYUA 5BXQC 4ZHMU 3EX7C 4OS2A 1AK2A 1EFHA 2J0SA 4RD3A 4AFQA 1XFAA 4XOJA 1CJMA 1KDOA 5HE8A 1TQ4A 1TGBA 2QM7A 4WXVA 1FPHH 2GZDA 3K0FA 4IMQA 1ETRH 5AHGH 1AKSB 3DM5A 1H8HA 1JXOA 2PX0A 4CEJB 3Q3JB 1UBGA 3CX7A 1GDNA 1Z6GA 5TJXA 2REBA 3PIRA 5TDHA 4CRCA 1OF1A 1TUEA 4M9SA 2L0XA 4MITA 4BRWA 2Y82A 1BMNH 1O37A 3BS4A 3QG1A 2OHFA 5FTNA 721PA 1H9HE 4P31A 4B47A 2HT1A 2IXGA 1SVWA 1GVKB 2BLWA 1BTWA 1CA0B 2AH4X 3SHAH 1ANCA 2TRMA 5D3MA 2CHQA 4B44A 2IS2A 1OYYA 1GWAA 2F1IA 2KBEA 3TUZC 4TY6A 4ZKSU 3M7TA 2A4RA 1QGFA 2ZHDA 1W2GA 1JAHA 1XJQA 3IITA 4TT3A 1SGFG 2R8RA 2QQ0A 3ZIAD 2ZCHP 3HPTB 4H42U 1YPGH 5KSOA 1Y3WA 4JLDA 1PPBH 2VIIA 2A30A 4QHTA 1Z29A 3C5CA 1N6LA 4M9FA 1T6NA 5EPNA 3VB4A 1ID5H 4A1VA 5JECA 1HIAA 2M5TA 2JLSA 1T4GA 2P94A 1UKVY 3OFND 2RGCA 4JL5A 2PX3A 4JLNA 1YZKA 4PSVA 2VHTA 4XVQA 2JLZA 5TVKA 1P2QA 2CL6X 1LQDB 1GMHF 1JJVA 1YQTA 2B7CA 2QP4A 2D2DA 1IQJA 1S3SA 1YR6A 2TGDA 5BN4A 3DUXH 1CGJE 1F6BA 4Y11E 4YMWA 4CF7A 1XUFA 4BTTB 1A2KC 1UVSH 2W3KA 4Y8ZA 3SJBA 2FDAA 4PZZA 3GFOA 3MTYA 2UUKB 4FWIB 4NCNA 3EE0B 2WJYA 3K0FB 5AUOB 2Z9JA 1WQSA 4D4KA 1NJFA 3UPUA 5ESBA 2V1UA 3GLHE 3FP8E 2WVJA 4TL9A 3IIKA 1RTFB 2PKSB 1F5NA 1W0KD 3RXJA 2QPTA 3Q8XB 2EWWA 1TOMH 3PWCA 4CEIA 2OQ5A 4OM9A 4IBLH 3TJZA 3H4MA 4OK5A 2F1HA 1VCQA 3FKQA 5A5GA 1O2YA 5DP5A 2FJUA 2OQUA 3BN9A 3P70B 4I1OA 1N5LA 4OI0A 1TGCA 2ZRCA 4RY2A 4AYVB 4R7ZA 3ZVRA 4W5WA 2FWWA 4ZCMA 4LZ4B 3EZ7A 5A8XA 1KJZA 3VR6A 4SGBE 3TAHA 4A6PA 3PEVA 3KKNA 3QZQA 1O3CA 4M1TA 3KFVA 2J7KA 3L0PA 4JVSB 3LQRA 1NVVR 4LHYA 4X8OA 3LNCA 2A5FA 3FZDA 5GADl 2YINC 3O8CA 5L3SA 2Z7FE 1PPHE 2UWLA 1ARCA 2THFB 1A4WH 3KXIA 1KI8A 1VG9B 1OFTA 1WV7H 2Y5GA 4CH8B 2ZC9H 4MRPA 4O2RA 3KKMA 1TX8A 1O2HA 5BRRE 1UAAA 2JIZD 1YGCH 1MR3F 1EFRD 4XDEA 1P9SA 3LBNA 1F2SE 2G3YA 3HR7A 3MO3A 3OSYA 2PEZA 2ZRFA 2PHBA 4MNVA 2FDCA 1EUFA 1MKYA 2MSDB 1GAJA 5GNDA 2GA8A 4SGAE 1GNPA 2FFHA 4GAWA 1G9IE 2CNWD 1B0EA 4R2IA 2FH5B 8GCHG 1XEXB 3CRQA 2JATA 1T5IA 4YDHB 1O2NA 3B1WA 3PMHB 3RXAA 4HI3A 4WA7A 1EJMA 3AVUA 1GJBB 1L4ZA 3SYJA 1EOLA 2LCFA 4DCVA 1EATA 3LKWA 4Q1CA 1S96A 1S0QA 3QO6A 5KDLA 4BOHA 2PUXB 2VGCC 1KK2A 3RLWH 2B8WA 3M37A 2BMDA 2ASUB 3RXTA 1LHFH 3KTAB 1G3IA 5HZKA 2XITA 3CUEF 4O97A 4CRWB 4AFUA 1KO7A 2ZSEA 4EJSC 5JBAS 1F92A 3VGCB 5BQ5A 1BITA 1GHAG 2GT7A 3AEZA 1VGCB 2FODA 2ZR9A 3V7TA 1G30B 4IDNA 3BSQA 2W2VA 1D3DB 1G3EA 5FPSA 3A83A 1CP2A 2SGEE 2VSXA 2QBYB 1QVAA 4FVBA 1DUEA 1C1NA 1ZD8A 3BTTE 1FV9A 4TTRA 1K9OE 2GT8A 4Y10E 3RXGA 1CBWC 4OS7A 5EW1H 3AVZA 3SBKA 3KJHA 2FFBA 3SOPA 3MWLA 2OAP1 1EWRA 3CX8A 1TX7A 1ZTJA 2GCTC 1GRQA 4R0IA 1PUJA 1Q21A 1V2NT 3WNBA 4JLBA 4UJ5A 2AHOA 1GI3A 4WZ6A 4UEHH 1ZD1A 3G82C 4RKFA 3KHVA 1SLXB 1Z1IA 1SG8B 3RS0A 5KHOC 3SNHA 1ZMNA 1S5SA 1OT3A 3VR4A 3IO3A 3DHKH 3L6PA 5J4KA 4MTBA 1O3NA 4QBIA 3GCGA 3RAPR 2QY0B 4BXSA 2AFIE 1XZQA 3LXXA 1Y3UA 1EKBB 1RTLA 3THOA 1Z71A 1JBUH 1DXPA 5EE9A 2BEJA 1D2EA 4Q9IA 4Q48A 3SBEA 4UXIA 3RXQA 5EQSA 3ZVGA 1S4QA 2ZU3A 6LPRA 4A1FA 1XEWX 5KYKA 2UUJB 4NYIQ 5JFGA 2FLRH 3PLBA 2JETB 1EJNA 3EZFA 2XAUA 2QN5T 4MH0R 1G8YA 3SGBE 2OE2A 1E2HA 4A7IB 1FY1A 1E2GA 1K1IA 2VP5A 1SXJC 4Y0ZE 1SQ5A 1UTMA 4HDQB 4UXJA 3GLFE 1DT2A 1GZSA 2J0UA 2GJ8A 2IYWA 3TITA 2D8WA 3V9PA 3ENSB 3RC3A 4CR9A 1TF5A 2HYIC 3I29A 2QENA 2VGCB 2ZRIA 3M7QA 1QQUA 1ESMA 1C5ZB 2JLWA 2TIOA 1MO5A 1XXDA 1AFQB 3FVQA 4Y79A 2KE5A 3GLGA 4YO9A 2VP0A 4LJ4A 2OC0A 3CPJB 5C1UA 5GDSH 1AMHA 5IYTA 3EIEA 3KQNA 1O31A 1G3QA 1IHTH 4TMVA 1AUJA 1GBTA 2CV3A 4DT1A 2FOFA 2PEYA 2W58A 3Q5DA 3SV9A 2G4UA 4MYUA 4YLGA 4OQMA 4AGKA 5E0JA 1TYNA 1JEEA 2C98A 2DWOA 2O8CB 5JB8S 4KFUA 5HCNA 2OZEA 4IOLA 2GEDA 3GEIA 4AY2A 3K09A 4NP6A 5FI1B 4M21A 3SI3H 4LK4A 1P2SA 2QEQA 2WJVA 1SFIA 2D26C 3VR2A 1GI1A 1YBWA 2A3RA 1FN8A 2QXIA 4IMZA 1RFLA 3P95A 2XW9A 4BLTA 3L8ZA 4IVRA 2WPDA 2PGBB 1RRCA 1DITH 1EK0A 3NXSA 3N70A 2ZI9A 4HLCA 2IW3A 2C9OA 1N6HA 2ESTE 1YCPK 1E99A 3DVLA 3SU1A 4U5XA 1YZQA 3EA9A 4FXPA 1G3BA 4BE7B 1W5TA 3X2SA 1T8TA 3IDQA 2HT6A 1X7AC 3GEHA 2QROA 2EI8A 3HDTA 3TUIC 1M2OB 5FI0B 1TNLA 1JAIA 3AP2A 3K1JA 4URVR 3KN2A 1QHRB 3C5HA 4Q7LA 2IK8A 2NO6A 3SYLA 1BRAA 4X2XA 3QY0A 2C95A 1ANEA 2IUUA 2JJ2D 2PJZA 1UM8A 1GVLA 4NKRA 4YONB 2O8DA 1GI5A 4XSKU 1UK2A 2ZTZA 2SHKA 4FUBA 1NTPA 2I6SA 2ZGBH 1ZM7A 1SVPA 2P5SA 5FCRA 1CO7E 4MLFB 4NSYA 3RRZA 1CJVC 3NKKA 1Y5BT 3EG5A 2ZSDA 4JLMA 4C2TA 2NQ2C 3UTUH 2ZDAH 4Q1DA 2AWNA 1BJUA 1NC6A 3LVQE 2QU8A 4ZI2A 1SLWB 2Q6TA 1C2EA 2UZ3A 2CJIA 4NIYA 3GCOA 3H0KA 3LRPA 1XTIA 3IIMA 2W00A 3B85A 3A87A 2OXSA 1JMOH 1CJTC 3GCHC 3A85A 1EP5A 2H17A 1KIGH 5KO2A 3MU5A 2ZJYA 1KSHA 1EFRA 1T91A 4X8TH 5FUYA 1V2UT 2CHVA 3WXMA 2XSZD 4PANA 1GHAF 1SKQA 4IGDA 3ZZTA 1NN3A 5EUQB 1FLEE 2XTZA 2FLBH 3U44B 4R9UC 4PTLA 4TWWA 1I4DD 3ECCA 1AM4D 3FFGA 5FH9A 1PQ8A 4RD0A 3RS4A 2V7QD 4MRSA 3B9QA 5L30H 1CA8B 1RYHA 3MNCA 3CWQA 5HPYB 2R2AA 2Q3FA 1T3SA 4AK9A 3FOZA 2XTNA 1GI4A 2XGJA 1U0JA 4HAYA 2CDNA 3ND9A 1FUUA 4QXAA 2XYAA 3SV7A 3F6UH 2RGEA 3KXLA 1OH7A 2XB2A 1O87A 2O8FA 1VYVA 2O8EB 2IYTA 1R5OA 2P95A 1HAIH 5B2ZA 1J15A 3NC1C 4TN1A 3C14C 3TQFA 1WBBA 4X0WU 3T5FH 3RVBA 2V3OH 4LYJA 2CL7X 3ATWA 1AGJA 1O3IA 1ZMXA 3A4NA 1ZHPA 4I1VA 2J41A 4DRZA 3WRXC 3QLPH 2H5DA 1SBWA 1QRXA 1ZRBA 3GLIE 3U61B 1HAZB 5JRJA 1ZHMA 1Z8IB 4W5HA 1CVWH 4A2PA 1ZRKA 2ZCKP 4BPBA 1II9A 1C2GA 2NU4E 4HLDA 2JLUA 4IVQA 1KYNA 2IYVA 1E96A 4Q01A 4JZIA 4PZLA 2CJWB 1TNJA 1MKXK 4GUXA 1J99A 4AWXA 1W4AA 3VX4A 1D3QB 4ILEA 1TEVA 2IX3A 2C8XB 3WNDA 2QXHA 2O8CA 5B64A 2R9VA 1VCOA 1A46H 3VU9B 3LGTA 3PLKA 1E2LA 1O3MA 2DUCA 1E32A 1G3DA 3T1QA 4Z8XA 2AGEX 4HYYA 1O3KA 2ZS7A 2ZRBA 4QHSA 2QIQA 1CIPA 4MQBA 1XMJA 4P32A 3QQ5A 1GITA 1V3XA 2I3BA 3K9HA 4ZKDA 2VH5R 1AWFH 1XXFA 2EFEB 4DVAU 4B2PA 1NP6A 4AKEA 3SV6A 3JZ2B 1B7XB 4CEIB 3F5FA 4RKEA 3GLFA 2Q6FA 4IOJA 3THWA 4NWKA 1G6OA 3BE4A 4RKJB 2F43A 2AR7A 3L3TA 3SR0A 2ZPQA 1AE8H 5F9FA 4NA7A 2XCNA 2QTHA 3C15C 1PPEE 5EZ5A 3SS8A 2G52A 4PQRA 1ZC4A 2QT1A 2R3UA 2FEOA 1YE8A 1ZPZA 2BMFA 5GWZA 3PMJA 4MNWA 1G21E 3GCTG 2BJWA 2BBTA 1SC8U 2W6ID 4DLWA 5HKKD 4IDQA 4UONA 2TPIZ 4AYXA 3RXUA 1A0LA 4QT8C 2Q21A 1MU8B 2ASEA 4FUJA 1ZGVA 2FOBA 3TUJC 5HM2A 4QGHA 3LA6A 2HEIA 1RIWB 4U30A 5J4QA 2ZNKH 4V0LA 3AAUA 4D2IA 2A4QA 2MMCA 1WB9A 2ZTXA 1A0HB 4MPXA 3RC8A 3OIYA 1QHIA 1WE2A 1BRUP 3CS7A 8OHMA 4F4JA 1FZZA 3LW8A 3BTQE 2UWPA 3U7EB 1P02A 2H57A 1O36A 3RMNH 1GNRA 4JT2A 4NYJR 2JH5D 5HYOA 1JI0A 1KXDA 1FQJA 3I78A 4K3JA 3BB1A 4IFBA 1KTSB 4A15A 2OCVB 1FQ3A 3VNVA 1O2SA 1O3FA 2R6CA 4H1VA 4RJLA 5FBVB 3SHCH 5DGJA 1W36B 3ZDQA 1GL7A 4P4SA 2XBWA 5AVDA 4KAXA 1ZINA 1FDPA 1TU3A 2FM2A 1C1SA 2EWVA 3BEUA 1J8MF 1GJ7B 4LV5B 5CLQA 5LDDC 3HU2A 5AJXA 3SJIA 1UJ1A 1O30A 1E1RD 4Q2KA 1CR1A 2WWGA 1EFUA 3SI7A 3B13B 5E0GA 4G3XA 5GXPA 2IOTA 3MMGA 2FI4E 1SVIA 2C8WB 2FMXA 4JLAA 1Z8RA 4PC7A 3GY5A 2B92A 2BD7A 3QKTA 1O2JA 2RH5A 3ND8A 2ZI7A 1AUTC 5JSZB 1XPUA 1C5XB 3L0OA 2V6JA 4FD2A 4QGFA 4Y8YA 4ZI3A 4Z51A 2ZDNA 5G3ZA 3PUZA 5FL7D 3SJOA 5FL7A 3SOSA 3NUMA 4A5TS 4JYBA 4B3XA 1W0KA 3PV0A 1NRQH 1NJGA 3LU9B 1ZNXA 4I31A 1A0JA 3DEFA 4OL0A 1ZNYA 3EARA 1SHHB 1P2KA 4K8YA 2QMEA 3K9XB 4PHFA 4URYR 2JEOA 4FMDF 5FL3A 3BIFA 1K1LA 3S1AB 4TWZA 1U99A 2F3TA 1AN1E 4YTAA 1BB0B 1BBRK 4E09A 4B1TA 1QNJA 3U8OH 1MTSA 4YOIA 2REOA 3GJ0A 3AKYA 3E91A 5L3VA 1D8TA 4PX9A 2EU8A 3ZGXA 1GMDF 1PFXC 4I8LA 2OFWA 1G5TA 1TBZH 1Z0IA 2PZGA 1L4UA 3RXLA 4O9VA 1XX6A 4KSCA 2DB3A 1G36A 1KK1A 2ZVPX 2GZ8A 2CHGA 3RXFA 2XBYA 1SVSA 1VPLA 3KNXA 5CM9C 2OAQ1 3HU3A 2HNTC 3QBTA 3THWB 4AN7A 3P8OA 5KTYA 1SHZA 2W83A 4MYCA 1FNNA 3FP7E 1ANBA 1M7GA 2XNDD 2BQWB 3FAOA 2OBQA 2ZFSA 4O3UA 5CDFE 4A8JB 5E2PA 2C2HA 4KBGA 1WXQA 3IHWA 3QN7A 2IUSA 4KKDA 3WYAA 1D2NA 1Z6EA 3K9NA 4LBVA 1Z07A 2AX4A 3B2EA 1DAKA 4BQSA 1P57B 5D3QA 3TMKA 1C4V2 3GISB 1AS3A 3L43A 3ASYA 1VCMA 4M9QA 1E1RA 5EE0A 3AVWA 1KY9A 3MRSA 2H1LA 3C27B 7GCHF 2IBMA 1DAEA 3D31A 2WMOB 1NN5A 1SL3A 1W47A 5C46F 4G1UC 2QQEA 1RJ9A 1LV7A 4IKEA 1TNHA 1DARA 2VIOA 3ZZUA 2LWIA 1ZJ6A 3QUSA 3PV4A 1A2BA 4HFPB 4ZO4A 1JR3A 1W36D 4OQXA 5HE9A 2GDDA 1GOTA 3HPRA 4CEJA 2B7BA 4NL4H 2BTCE 2BXTH 2ZECA 1O3BA 2QZ4A 3ADCA 1U2RA 3VQTA 4DT1B 4CRBA 3UR9A 3K0AB 1NFYA 2ZTYA 1FP7A 3QEOA 1Z0DA 2FSFA 4F93B 4RFSB 1MOZA 3B1YA 3EPLA 1XWIA 1BOQA 3G5UA 4DW2U 5FFMA 3U6KA 3W34A 4X8SH 2TGPZ 4AB8A 2J7PD 1HJAB 3B9FH 1GCTB 2EFCB 3WBJA 1VGCC 3KDSE 1SVKA 2GXUA 4LJ6A 1XXHA 1IN7A 1UBEA 2DFKB 3FGNA 3BG8A 3I8SA 2ZP0H 1BTYA 4MYTA 4DB2A 1MV5A 2NO0A 3LBHA 2VPPA 4X1SU 5FTJA 1G37A 1N6IA 4TMZA 1AY6H 3FPAA 1KDPA 1TRNA 2CF8H 1OLOA 2AWOA 4PO9A 2ZXUA 4XIGS 1Z06A 3F9EA 4HAWA 4DVGA 5EZ6B 1SGTA 2AMPA 2GZ9A 4PPFA 4FUEA 1KDRA 3GFPA 4XD7D 4URUR 3RMOH 1T4VH 3UUZA 2OV2A 5BW8A 1RC8A 1HTWA 2DWPA 4OQNA 5DP8A 1IQIA 1QR3E 2Q3HA 1OSNA 3MH5A 4RZ2A 3PWBA 3KJGA 1ANDA 3A89A 3ASZA 1KMHA 3TH2H 2A5GA 1FIWA 1KIMA 5CYPA 1GNQA 3KXKA 4GCHF 2J1LA 5FR1A 4LCBA 1C1TA 1YZNA 2UKDA 2V55B 3AH8A 4LDJA 4UE7H 3T1TA 1FMGA 5HZHA 4E7NA 5JEDA 4A8JA 3THYA 4NHOA 3VAAA 1DAGA 4C0KA 1XRJA 1QBKC 1LHCH 3CENA 4BLOA 2P6NA 4LRWA 3HJNA 3PO1C 4XBDA 421PA 4QBHA 3EIQA 5JWRA 1I4LD 1P72A 1ZM3A 1K28D 2P3FH 1D5CA 2QAGA 2ZSBA 4NCHA 4QJ3A 1QJ6B 2TGAA 1N6PA 4LPSA 2XRCA 1C1QA 4NBSA 2OO7A 1Z6YA 3Q85A 2F83A 3OIUA 1UDWA 1CQQA 6Q21A 3W95A 1I4TD 3IEVA 3OHMA 3MNBA 5B57C 1SOTA 1U81A 2OINA 4KTUA 2FPKA 1Q3HA 1V5WA 2WTUA 5FAHA 1GRRA 3A4LA 2QTFA 2GVZC 3W8NA 4HAZA 5GJCA 5JBQA 2F9NA 3UMFA 3SDZA 1OWIA 2ZFTA 2FTMA 2AGGX 1AZ8A 4IC5A 2F55A 5L3SB 2AK3A 1C5LH 2ZGXH 1GBIA 2I4IA 5AFYH 1AA9A 4BFWA 3E8LA 1ESBA 1VITF 3PJRA 2WKPA 4E7RG 3D65E 1PLKA 3KQKA 2GXSA 2ZHFH 5L3QA 3RM0H 1W4CA 1NKSA 1MH0A 3W8RA 4WH6A 1CGIE 4FU8A 2BCJQ 2W7UA 3MU0A 5CE1A 1CR4A 1PVOA 1QHXA 2WHXA 1FW6A 8ESTE 4KODA 2J9RA 2J46A 2FS8A 4AFSA 5EUMA 3U1JB 5FBIA 4GMXA 2ZDKA 2CLDX 2OBMA 5JCPA 2FOEA 1F3OA 1Q12A 4YT7H 4ESTE 2XCFA 1FONA 4EAQA 4ABAA 1UCYK 5CB8A 4C0SA 4TY7A 3GEEA 1US8A 4RD4A 2FYRA 1VG0B 2C99A 2IT1A 3A7TA 1O2PA 4CRDA 1O3PB 4BXWA 3MLEA 4PPNA 3UFAA 4Q47A 1TMTH 1GDUA 1LPGB 1B5GH 1VKJA 2HLDD 2HLDA 1XTKA 4B73A 1ZNWA 1P61B 2GJSA 1C5TA 1J7KA 2J5XA 4X2VA 3AKEA 3JZ1B 3V12A 4KLNA 2OLGA 1GBLA 1MZAA 2WPHS 1G7SA 2EFDB 4AGJA 2GF0A 1WYKA 4OI1A 1AI8H 3E2IA 4Q9JA 4D4LA 1SGNE 3SNEA 1YCPM 3AAVA 4MUBA 3UANA 1C2JA 2ANWA 1TNGA 3S9AA 3NC0C 3GCHB 1L1NA 3HYRA 1HAXB 3PG5A 2A5IA 4Y0AA 2H7VA 4Q4HA 4YMUA 1UTOA 1UEJA 3RS3A 5KNDA 3ZVEA 3ZQ6A 5DP3A 1PUIA 3RP2A 4Q19A 4JVNA 1TF7A 1YVDA 2AERH 1GGDC 3VB5A 3TGJE 4IXNA 4IXMA 2V3HH 2BIFA 1VCPA 3U3OA 4E05H 1GP2A 3CIOA 2PCLA 3THYB 4A36A 4JVLA 2C8YB 5AJZA 4X6OA 1V2VT 1Y5AT 3RLYH 1E0AA 1W3CA 4D4JA 2QA9E 2FZZA 1QA7A 3F9HA 2FEQH 4CHAC 4I99A 1BMMH 1OKKA 3CW2A 2QC2A 1MABA 2GETA 1QCPA 2ZZUH 2BM1A 1E36B 3U1IB 3V13A 2IYXA 2IYYA 3NH9A 3Q3KA 3FMFA 2FG5A 1U94A 1QFKH 2VH6A 2FZLA 3SUDA 5KSYA 3VR1A 3QXHA 2H5CA 1G32B 4BAHB 2H8KA 1UTPA 2W26A 2BQ7B 3W6NA 2N46A 1RXPA 4UFEH 1BS1A 5KNCA 3A1SA 4QGGA 1DELA 2QE7A 1GBAA 3K09C 3PITA 5CMXH 2KBFA 3PROA 4IDOA 3IIJA 3A7XA 1S0RA 4PQFA 4TMXA 2NU2E 2DWQA 2BBOA 4QKQA 2QL6A 1NBMD 2JH6D 3U44A 1QHSA 2IJOB 1RFNA 2H9EH 1IXZA 3C41J 4JBWA 2D2FA 4K8OA 1SGYE 2PR3A 3ESTA 3T2NA 3LT3A 2GAOA 2HF9A 1W44A 3DD2H 4NZYA 4OK6A 4YMSA 2JGNA 1KI6A 1VZQH 3OYPA 1EWQA 2GBLA 4V02A 5EGMA 4JLVA 1BT7A 4X8MA 3TJUA 3B1VA 3KQCA 4ARZA 5FPKA 1W11U 2YWFA 2V0BA 2VVUA 3NWJA 2VBCA 2R0LA 4ZPXA 2GK7A 5P21A 1AB9C 3AVXA 4D26A 1K1PA 2GTPA 4D7FA 2ATVA 3UWIA 2FOCA 1F5KU 1DE7H 1O2RA 1C2FA 1A3BH 2GCOB 2ONJA 3OX7U 4WVFA 3RU4T 1VHLA 2W2TA 3UWOA 4GNKA 4Q4LA 1DPFA 3NEYA 1NM6A 2R6FA 3C7KA 5JB9S 5G4BA 4AG1A 1G8PA 2OTVA 4F7WA 1GKUB 2REXB 4PSKA 2ZYWX 2ZI5A 3L2OB 2A4GA 1HAOH 1HRTH 4IFEA 1W13U 4I7YH 2N42A 5T1VA 2LKCA 1ORFA 1QVRA 1G9XA 2OG2A 2SNWA 3A36A 5JWHA 1NNEA 3G01A 4DC9A 1K1NA 1Z1JA 4DLRA 3T29A 3WMFA 2G4TA 2JLXA 2CJWA 4GFDA 2BM0A 1YHNA 3A4MA 3UNRA 1T9HA 2J9NA 3SHWA 2V35A 3QGNB 4A0GA 2NO7A 3BH7A 5GCHF 3P6ZB 1HBTH 1TRYA 2VVCA 4K1TA 1MMJN 2VF8A 1L4DA 3HYTA 4I1SA 1XD2A 4JKIA 3SUFA 1GIAA 2BDHA 4RZXA 4MGKR 1LKBA 3X1WA 2F1JA 2FP7B 2ZIAA 2ZHWH 2G51A 1KHTA 2HYDA 1E2MA 3CRMA 1P8VC 3CRRA 3THXA 1SGQE 4ISNA 1XDBA 3ODFA 1NROH 3ZH9B 2NU0E 2QM8A 4TLAA 2GX4A 1LVBA 5EXSA 3W6OA 2WJIA 4TYWA 1BTHH 2IS1A 4ZIRB 3WNCA 2ZSFA 1AU8A 2OK5A 2JLVA 2BDGA 3HKJB 1MTNB 1ZMJA 3RXCA 2SNVA 2ZHEH 1SQAA 1VIAA 2GJKA 3E3TA 5EP2A 3MU1A 1H8HD 3JZAA 5AJWA 2W2XA 5K8LA 4PPGA 4RFVA 1F2UA 2PLXA 1FL9A 1G17A 3HPQA 1GCDA 3GMTA 1AJEA 4DSUA 1NFWA 1VCIA 1OKXA 2FX6A 1H9IE 1OIWA 1N5KA 4JL6A 2BLVA 4L16A 5IDKA 3MU8A 1GL9B 3TH5A 1R2QA 2ZTSA 5KDDA 3I4LA 121PA 4Y76A 3DO6A 5EE3A 1P04A 1Z28A 1WCZA 4DURA 1Y63A 4OI4A 4TL7A 1YF4A 1CF4A 2EC9H 3KL6A 3BG4B 3V4RA 4LJ9A 1DADA 3ZYDA 3SJ8A 4BECA 1KO5A 7KMEH 1I2DA 1GBFA 1ARBA 2QAAA 4XVUA 5C5OA 4H6TA 2R0KA 3RXVA 2C78A 4XE4A 4UNSA 3ADBA 2GTBA 1BHXF 3MFJA 1LF5A 3E6PH 3IKJA 1O2KA 5DP6A 1LMWB 2WUBA 4KTSA 5PTPA 3TJVA 3BBPA 4C0BA 4IRUB 3ZZCA 1D9ZA 1DAHA 1IOEA 1Q1ZA 2IF0A 2RB4A 3OFNA 4A92A 5L2ZH 2R44A 2CVHA 4TYYA 4FUCA 1P3CA 2CHAC 3ZZ4A 3F9FA 2ANCA 2P8OC 2R65A 2WIBA 2GGVB 4FVDA 1GI2A 2WWIA 1BMFD 3N2IA 1BHXB 4LV6A 4HDCA 2ZFQH 2Y5HA 3IQWA 2ZJOA 2IYLD 1TQ7B 4B3BA 4OJQA 1TBRH 3R7WA 4N0EA 4OKSA 1HAPH 5CJPA 1CHOF 3URCA 4D6PA 1KXCA 1NKTA 1CE5A 1XUGA 4CGZA 2WV5A 1O2TA 2VWMA 3LY5A 1IQGA 2BY8X 1CTQA 1M8PA 1QURH 2J0QA 3SJCA 1FNIA 1O2MA 4IW4E 2YWHA 3HWSA 2P5TB 4TLCA 1FPMA 1TPZA 3RRMA 1TNDA 2ZANA 1A1RA 3OESA 1P01A 3W6PA 1XD9A 5JYIA 4HB0A 4LX0A 2VSOA 1BTPA 2J59A 1E38B 3T25A 1UADA 3PTNA 3EC1A 2VIWA 2ZU2A 1JR3E 4JYTA 4A8JC 3TR5A 2VU8E 4M1MA 2YOGA 1BH2A 1HIAB 1TAGA 4BFYA 4LYAA 2E9SA 3EWAA 3HR8A 1SPJA 1QDEA 1CKEA 3P4YA 1EAXA 2WM9B 5KDOA 3BTGE 4MPUA 1RTKA 3EZ2A 1Z8JB 1SGCA 1W1WA 1XX9A 1P03A 3KUDA 3M5MA 2ZUDA 1KDTA 3QSYA 2H9TH 2QY9A 4KFSA 1ZLRA 3ZIAA 3EGKH 3O47A 4Y8XA 4N3NA 1K5GA 1AIPA 1PZNA 1HCGA 1D3TB 1SLUB 5C5NA 1AGRA 2DE9A 1II8B 4LC1A 1O38A 3VFDA 2RHDA 4BRUA 5DJ7A 1A2CH 4DDTA 2WAXA 5CDFA 1G3UA 3M4YA 4XWOA 3UXMA 1OXUA 3T1VA 1ZNZA 1IM2A 2C4FH 2JJ2A 3HK3B 2Y7XA 1O2GH 1NS3A 4LZZA 4UNNA 2ZETA 5AR1A 4LBZA 5CIWA 7GCHG 1R5BA 2Q6DA 1DXWA 3WP1B 4J0QA 5C3NA 1XMIA 2RCNA 1GI0A 3NDBB 1VECA 2BMJA 4YMVA 1YC0A 4URXR 4QNRA 3TAUA 1N6XA 1HJAC 3B1XA 2HCBA 3BH0A 3UY9A 2Y80A 4IVPA 1Z22A 1HUQA 1COWA 4DIDA 3WY8A 4JZ1A 1G8FA 2J95A 4JVMA 1G16A 3RSOA 1H65A 1OSSA 1TALA 1ZTLA 3IO5A 1P2TA 3KF2A 1KO4A 5SZKB 3CF6R 1DLKB 2EW1A 1YPMH 3UOUA 4GSOA 1CHGA 1E34B 1KSNA 5EP4A 1OP2A 4DLZA 1KKLA 4B76A 1ZPBA 5JMTA 1KI3A 2FEMA 1WTGH 3HGPA 3RRNA 1X8LA 4BLRA 4C0JA 3U7HB 1CRPA 3RXOA 2GV7A 3LBIA 1ELEE 2NZJA 4PHTA 1C5MD 1P4SA 4Z0KA 1YR7A 3I73A 3B78A 2FOAA 5LPNA 5TARA 3KQUA 3EA8A 1A5HA 1CT4E 4D80A 2JDIA 3T06B 2VQSA 4X8HA 3PUYA 4AYWA 3BB4A 2VINA 1ZP6A 2QCYA 4GI7A 1LCYA 1J8YF 1W4RA 3IBGA 5DO4H 3GJ8A 5HXFA 1JR6A 4M2LA 4Q4AA 1OXSC 1YZLA 3VR3A 4DLUA 2X1VA 1OYQA 1Z0JA 3P32A 1O3GA 3VNUA 5DE3A 1K6MA 1V6DA 3A8BA 1XVOA 1MTNC 4B2LA 1MBQA 1L8QA 4MKFA 1KLJH 3ZD6A 5JCZA 4QGAA 4U2WA 1J2JA 4R98A 4ABEA 1DDJA 3BTFE 2OILA 1ZUIA 2W0SA 1JIRA 1GJ6A 4BEBA 1NMZA 1JRTA 1SMFE 4FCWA 3TH4H 4JMYA 1TABE 1TFXA 2GKSA 4GPGA 3F68H 1ZGIA 3QEJA 1GTVA 3ZZDA 1G3MA 1O2OA 1IJFA 2QMHA 4NDZA 1LHEH 3AF1A 2NO1A 1RYFA 1VMAA 4QM7A 5EJEA 1VCWA 3LONA 4K69A 2EI7A 1L4YA 1SB1H 1GJDB 4F4OC 1WU1A 3RU4E 2FFAA 3FHOA 1IBRA 2HUPA 3OE7A 1EFCA 4PR0A 1E2KA 4PO1A 1C2KA 2FN4A 4YDSA 1NF3A 4UKDA 2D4HA 3OZXA 5HTKA 4AFZA 2F9BH 3M5OA 1VR1H 2QG6A 2KJQA 1C5UA 3ADDA 1PQ7A 2A78A 2BV3A 2PSXA 5L3RA 2PH1A 2ZM5A 5KUTA 4TT3D 2WJHA 3SHFA 3F3YA 4WXRA 3ZV9A 3FFAA 1B0FA 1KXAA 9ESTA 1XB2A 4GT1A 4FU7A 6GCHG 1ZYUA 1TE0A 3U3RA 1IQEA 2ERXA 2ODYB 1TADA 4MNXA 3MH4A 5CK4A 4DCTA 4LUCA 2NWNA 1HEIA 3CH5A 3VHLB 3CB4A 2IHBA 5F98A 3ZVMA 2YOFA 4IDPA 3FE2A 2GD4B 4K1EA 2WKQA 2HNTF 5J4SA 2HXSA 4CRGA 2A45B 4KYIB 4EUNA 3BTDE 1DAFA 3U3JA 4LBWA 2A5DA 5J4YA 4OGXA 1VG8A 4C0AC 1HB0B 2B8TA 2G0NA 2ZSAA 2QT0A 1W8BH 2ZREA 2C90B 1YLCA 2VB0A 1CXZA 2GVFA 1EESA 4WMEA 1SVMA 4JMPA 1MKXH 4E07A 4YQFA 4B3DA 3TLOA 3GCTF 1OIVA 3FFBA 5JEEA 3QPVA 1DEKA 1P9UA 2MSEB 1GBMA 3TVTA 2WAYA 4OK3A 3UQOA 1K1JA 3Q3XA 5FOTA 1VCNA 1FUJA 4K2YA 5T6FA 1WOFA 4M1KA 2WV4A 4F92B 1DICA 5GIBA 3LGIA 1JECA 1OPXA 3BTHE 4PC6A 2A2ZA 3QE0A 1SGIB 5F2EA 4MQAA 2JIZA 5AFZH 1XKAC 2PL3A 4D9QA 1ELTA 1TMUH 2D06A 1FTNA 2IUTA 1AIXH 2RA3A 3QTOH 2P93A 1OWJA 4ABHA 1NI3A 4A0FA 1DY9A 2ZS9A 3IPYA 1GJ5H 1YPLH 3BWDD 4S2EA 3UG7A 3HU1A 3RXPA 1R0ZA 1ZJDA 2KAIA 1EPTC 2VP9A 4NYJQ 3CR7A 1HH4A 2NMVA 1SKYB 4RN6A 1G2LA 3IBYA 1MRNA 4JIMA 1W14U 4KXFB 4Q9LA 2B8OH 1OKKD 2V6NA 1D6JA 4PHGA 4IN1A 2IYRA 2HXYA 3MWKA 1HA3A 2BC9A 1TX6A 4QJ4A 2GZAA 3P27A 3BTME 1ZU5A 4BAMB 3RWOA 1EX7A 3LO5A 1JXMA 4DB4A 4LC0A 4OQLA 5A0CA 3BV9B 4Y7BA 1P2MA 2QXJA 1AVXA 4JJZA 3TJNA 2OUAA 3AGPA 6GCHF 1GBDA 1E0KA 1E9AA 1MAXA 4W5JA 1XMVA 2OBNA 1A5IA 2KSQA 1NMYA 2QE7D 2WWYA 3AVVA 4V0KA 3ZVAA 2A2QH 5DLQC 4AG5A 1L1JA 4MRNA 2JCSA 3PTBA 2PKAB 4NGAH 3K8YA 3H09A 2FFQA 1WUNH 1R0XA 2V3CC 4Q02A 3TH3H 2VLIA 2JLQA 3RXBA 3TK9A 1XEFA 2ZHQH 1WP9A 3VB6A 3TBKA 4RCZA 1Z6XA 2DBYA 3W9YA 3AM1A 4HSEA 4JK6A 1E3MA 1S9HA 1GG2A 1KO8A 5AWFC 1A4RA 1ONBA 1HAGE 4ASUD 3SYKA 3W90A 4WIAA 2FXRA 4B3GA 5C20A 4DGJA 1Q0UA 4E5UA 1KTVA 4X1PU 1OWDA 4Q9KA 1F2TA 3U8TH 1SKYE 1NIPA 3V4FA 1BA8B 3UMRA
chains in the Genus database with same CATH superfamily
3VG8A 3ZDZB 5CFNA 1WUHS 1BBRE 1THSH 2GCNA 5DKMA 4G4SO 1NF2A 2JFYA 4UQOA 2I71A 1RXEA 1P10A 4L57A 5E95A 1ZI8A 2J34A 1FYVA 3KZCA 4OHZA 2DLNA 8ADHA 4PCUA 3B9RA 1U7OA 2VJKA 2A31A 5KI6A 3MMSA 4I8GA 2FMFA 2Q99A 3IAS6 2I87A 1CUVA 2FZGA 1F8FA 2YVLA 1B73A 1YB6A 3AVOA 3GDHA 2W9XA 4RHFA 2FF7A 2WRZA 1QSGA 4X7RA 5F03A 1N0IA 2PMWB 4EUHA 3LPMA 2EP8A 2HX1A 4N5IX 3UJ9A 1U1CA 2O4CA 1O2UA 1T5BA 1YBVA 4HRAA 5FBQB 3OY6U 1DTWB 3SF8A 2YW2A 2ZDHA 3OD1A 4B35A 5IAAA 2CJFA 3L0CA 3LT0A 2Y6UA 3EWIA 2XJ9A 4FFSA 4RGQA 4EDHA 1ANKA 1TGTA 5KYVA 2F4LA 5EPEA 2FDRA 5LQUA 1GMCF 1TJYA 2KM0A 2AUNA 4NYIR 3DPUA 2ID7A 1T8YA 1DLEA 4D41A 4JLPA 2WIAA 5F2KA 1NURA 4EG5A 5JHGB 2QF0A 3FYUA 1RACA 2CLEB 4KSBA 1GZDA 3SNAA 4FNMA 4QBFA 3PC8C 1X7YB 3RB8A 3LLUA 2H4ZA 1DCKA 2R85A 3DBOB 4M9XA 3MJ4A 5T3HA 3I1FA 2PUCA 4MR7B 1YK1A 3U48A 3AFGA 5DSXA 1OAKA 2JAOA 3JD4A 5EXEA 1WUIS 5LQSA 1C4Y2 4PRYA 2OK8A 3FFXA 4MKXA 1S84A 3UCEA 3CZMA 5EJZA 4KC0A 3H7TA 5MGBA 4AO6A 3JYHA 4BIIA 2GCHF 4HWPA 3HKCA 3TLKA 1P1BA 4KE6A 4XW2A 4EPVA 1YZHA 3W5JA 2EX1A 4CR5A 2G08A 2QU7A 2F43B 5KYTA 3IX7A 3VKGA 3MJRA 2HW8A 1HDTH 3KYFA 4EL0A 3DKVA 4QJBA 3I0NA 1I0IA 3T34A 3M33A 3LFTA 5G3YA 3Q8LA 8KME2 1SO8A 4G5SA 2WTXA 2WDZA 4HL6A 3ZQKA 4C3ZA 1P9OA 3QELA 3BFVA 3KQQA 3KT0A 4RVDA 1Q0LA 3RNLA 4KR3A 4RH0A 4DWJA 2H6EA 4PU0A 1ZZGA 4OIFA 3CV3A 2WHEA 3KB6A 3M0EA 4Z99A 3JQAD 1LVGA 2NU9B 1ELVA 5KTNA 3K9CA 1G2MA 1NMSA 3ELBA 4PLHA 3V7FA 1O94A 3H2YA 5IZCA 4H7JA 1UDBA 2ODNA 3OSZA 4F5WA 4EHFA 3BG4C 1H1TA 3FOAA 3C3YA 3T7IA 3VR2D 3T9DA 1C4KA 3BA1A 5E0OA 1AKRA 4UVIA 5JAMA 1KRXA 3EDXB 3KQMA 3LCJA 1VITG 4EG6A 2JHFA 4DM3A 2K1QA 5CM2Z 1RQ7A 1O03A 3SX0A 4M37A 3KQBA 2A0WA 2C9ZA 1WUJS 3MHPA 4G0NA 3L0DA 1OE0A 2YXBA 3C4JA 3H17A 3OQIA 2DLDA 3GT3A 2GHTA 5AI9A 1OWLA 4CIWA 3NXKA 2AN3A 3HB4X 4EKNB 1RXVA 1TTHA 3CLRD 3AOGA 3D6AA 3AT1A 3OU7A 4GSKA 4C22A 2GOYA 3AU8A 1K9SA 4U9IS 1KH2A 3K8QA 2Q2NA 4BO9A 2GH1A 4M53A 4M0UA 1KGDA 2DQKA 1DANH 1IULA 2IDKA 3TK1A 2UUBB 3GRUA 3KZMA 2Z1DA 2Q9AA 3DDOA 5FI3A 2Q1JA 4JLJA 3ZVBA 4QNMA 1OC4A 4URZR 3VHQA 2XCIA 1H5QA 2CKMA 1UWVA 2NAFA 4HAVA 4LOIA 5DXFA 5AW9A 1M10A 4DSOA 4ARCA 2DCMA 3A7ZA 2VL7A 3OOSA 5DRTA 3TCNA 1A9OA 1KC3A 4LVCA 4Z4QA 1YS2X 1R4ZA 3SNBA 2CNOA 2H7XA 4Q93A 1SGPE 3MRXA 1P62B 1C1MA