4B76A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 211
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b76A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b76A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b76A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A03
1AWHB 1P2IA 1JWTA 4Q1DA 1EZQA 4MH0R 1W4AA 1GBEA 3AK5A 3PG5A 3S9CA 2YNBA 2ZI3A 3ZS8A 1ZRKA 2F6RA 2OE2A 1OFUX 3WYGA 1KIGH 1CR2A 5BW8A 3OIVA 3I62A 4NYMQ 4Z1MD 4GMXA 1NFXA 1XTQA 1YYY1 1QRWA 2H92A 1F2TB 4TL8A 1HRTH 1E4YA 1QQUA 3D65E 1T8TA 4X1QU 2IYZA 1P2NA 3ADKA 2C8VA 1F0RA 4LRWA 4CVNA 1EKBB 4RI0A 3H84A 1JR3A 3LJOA 3I8SA 4B2BA 4M1KA 2ZU6A 3A7VA 4MYTA 4QHYA 2JIZD 1HV8A 3SR0A 4B47A 1T8NA 2XXLA 1XEXB 4GFDA 4BECA 3MLEA 2FWRA 5DYIA 1N6OA 2GJ9A 2JH5D 4JLMA 4Q18A 2A5FA 1ONBA 3I92A 3CH5A 3AF4A 3AV0B 3W8NA 3MWLA 4Q1AA 4XWKA 4AWXA 2AD5A 4M9SA 5EPYA 2ZVPX 1Z6EA 2A5AA 1S96A 3TR0A 1L4YA 2ORIA 2CMYA 4OJKA 1C5PA 2CHVA 3S69A 1HAVB 1G7SA 4UJ3A 4QBGB 2G4UA 2PLRA 3KUDA 3WHKA 4ARZA 3QXHA 2R6FA 1QJ7B 4NA7A 3NEYA 3A4NA 4SGAE 4X1SU 1XMNB 2QU8A 2P0EA 2ODNA 4CRAA 1P09A 3B1XA 5DIFA 3RXAA 5DN6D 1M7GA 3GLIE 5AVDA 1P2JA 1TPOA 3A84A 3T12A 1R10A 1GJ5H 1HAVA 3VX4A 2QV1A 2HCJB 7KMEH 2JLZA 2RDLA 2ZU1A 1XF9A 4OKSA 4JVLA 1DAEA 1G3MA 4AYWA 2XC5A 1J9CH 1OXUA 2HXYA 5DH9A 4JKYA 1AVGH 2C8XB 4M0LA 2VHCA 3QLPH 1B0UA 2A2QH 1G20E 1NLYA 1Q3XA 1QBOA 3CZPA 1KTVA 1MRSA 2GF0A 4DC9A 2QXHA 4M1YA 3IBGA 1GJ4H 3HGPA 3MU8A 1TUEA 4ZXXH 1VCMA 5CITA 2B6HA 2GKVE 1NIJA 1OWJA 2AKYA 4UNNA 2VLIA 1BH2A 3TLOA 2Q3MA 4U00A 1A4WH 2Z9GA 3VB7A 3CS7A 3QGNB 1EJAA 1HJAC 4GI7A 1N0VC 1AS2A 4IHQA 1IOZA 2SHKA 2OBNA 4Q9HA 2JCSA 1G3QA 6CHAB 3VPKA 4PSKA 3ZV9A 3U4QB 1YF4A 2J0VA 3MH4A 1HH4A 1IY0A 1P57B 1BS1A 4F49A 5KYKA 3UATA 1KSJA 3T2NA 1OWKA 1DXWA 1MCTA 1IN7A 1MTVA 3PEWA 3NWJA 1FY5A 2ZFFH 4MUBA 1YU9A 4HB2A 4ZKOU 2J45A 1NRSH 3K9GA 5JS8A 3QXXA 4K1EA 1VIYA 3W9YA 4Y71A 4NWKA 4YLUA 2B7BA 3GDSA 3K9NA 5GCHG 2HYIC 4PFSA 3ZZUA 2XEXA 1G6HA 1QG4A 1CBWC 1SXJD 4WJG2 5DP8A 2KJQA 1C1SA 4DCVA 5FTNA 5DN6A 1EZUC 3PITA 3CF2A 4ON9A 2SGFE 5TV2A 1WQSA 2ZIAA 3LWNA 1A7SA 5DGXA 1TQ6A 4LJ9A 3FFBA 3GLHA 2BC9A 4MKFA 5EUQB 1C5VA 1GUAA 3PUZA 1NSTA 2FX4A 4AI6A 2YV5A 2QMEA 3T1QA 3MWKA 5AFZH 3SQEE 2FOHA 5A5GA 3U8TH 2CF9H 3ZV8A 1OV4A 3HK6B 3WNBA 1QR3E 3ZD7A 2ZJOA 3W34A 5UKDA 1FQKA 2Z43A 1PQ8A 1V2LT 1LHDH 3L43A 4HAYA 2VWMA 2C8YB 1O0DH 2O52A 1HQYE 4ISOA 2Z3DA 1DAFA 3CS0A 3ZZ4A 3ZIAA 3WRXC 1OLOA 3DOFA 2VP0A 1TABE 2H17A 3GLHE 3MU0A 4HLQB 3E3TA 5FX5A 3TQFA 1Y3YA 1TEVA 1P11E 4XFQA 4XH9B 3ODFA 5EP2A 1SXJA 3SU2A 1FAXA 3TH5A 2FM2A 1RW4A 2BDTA 1Y3VA 4DURA 1XPUA 5J40A 1ZUNB 1ELEE 3BTFE 3JVUA 4DY7B 1RJ9A 1XTIA 3O8CA 1QDEA 2BJWA 1O3LA 4KTCA 5L6NH 1NC6A 5HM2A 6CHAC 3TSOA 3M7QA 4RSPA 3NWUA 1O3FA 2VIOA 4PAMA 5L3SB 1T0HB 1O2GH 1UTPA 3W8RA 2JETB 1P2OA 5FFMA 1E36B 2PT5A 5KPJA 1IQFA 1OYTH 1G2LA 1P2QA 2OC8A 3KQEA 2DCUA 2XW9A 5C3NA 2REOA 4JJZA 4D76A 1V2NT 2XRCA 4YDSA 2BY6X 4AG1A 3ZH9B 4QXAA 1DAMA 2WJHA 2P5SA 1KLTA 4ZHAA 4X0WU 3HK3B 4UFGH 2B7CA 5FUYA 5TY0A 5J4HA 1A5TA 3SNEA 4TQAA 5CLQA 3PV2A 1QA0A 1GGDB 4BTTB 1ZW6A 3QGJA 1DE0A 3MMPA 4KTUA 4Q47A 3BFVA 3NC1C 4DDWA 1VIAA 4NG9H 1UCYE 3THOA 4DT1B 3SBEA 2X8AA 1BTPA 1J99A 3V13A 1BTYA 1MCVA 1N6NA 3FYHA 3IIMA 1VGCC 2TGAA 2ZE6A 5E2PA 1XMJA 2RA3A 8KME2 3A58B 3AF0A 1R0YA 1AB9C 1T0JB 4B2CA 3AB3A 3W3AA 2P16A 4NSYA 1KXBA 4D2IA 4V0LA 4IMZA 3H1TA 1L2TA 2VSFA 5E0JA 3VGCB 1XNJA 4PAOA 1XPRA 721PA 1T4VH 1LVBA 1H65A 3AKCA 3P26A 3ZQ6A 3IPXA 2VHTA 3G01A 1C5RA 1K1PA 1QHSA 4Y0VA 2TMKA 1SSXA 2PGBB 3Q3KA 4MPWA 1AD8H 2ZPRA 1QB9A 4FMCB 1K22H 1TB6H 3C27B 4X2WA 2W3KA 2ZSDA 4B48A 1ABJH 3PTBA 4B3XA 5GCHF 1GNRA 3QKSB 2ALPA 5HYOA 1NP6A 3LAWA 3C1KA 1O5FH 5A4JA 1TX7A 3KXKA 4DIDA 4BZQA 1HURA 2IJD1 4YMVA 1ELBA 5KNCA 3BH6A 1XUFA 4TYYA 3KF2A 1F3OA 1UAAA 3VHXA 1JBUH 4PHGA 4TN1A 2E87A 1T8MA 2O8CA 2YZ2A 4Y76A 3EA8A 5EXSA 1A1RA 2GZ7A 2PLXA 3SU3A 5KPDA 2WINI 3VNVA 4UXIA 3MG9A 4MKHA 3EWSA 2VP9A 3CZQA 3LV8A 1AVWA 1CQQA 4IFEA 1P2UA 1DWBH 2ZITA 1GBCA 4DEXA 1ESBA 3F1SB 1SVPA 2RGXA 4UE7H 1ZM3A 1I2DA 1Y63A 5TDHA 4BRWA 2WAYA 1T3SA 3RXCA 2IXEA 4KYIB 4TTPA 2BZAA 2OC1A 2UWPA 1HBTH 5F3WB 1AE5A 3I4LA 4XBCA 3B9PA 2BLWA 2PMKA 3PV4A 2OK5A 5JPMH 3WMEA 4OI4A 3SJ8A 5FBWB 2QQ0A 2RCEA 2BKUA 1LHFH 1VCPA 3GJ6A 5C2ZA 1WA5A 1UVUH 3JZMA 5C20A 2BDIA 3A87A 2I6QA 1ZD9A 2YWFA 2A5GA 5E7JA 2FYRA 4C30A 2P67A 1DSUA 4B2AA 3EAJA 3L8ZA 5LD2B 5B6LA 5F9FA 3KJGA 1UEIA 4RZUA 1OYWA 2RMKA 2H5DA 4P4SB 1A1VA 2DPXA 3QUSA 4X1NU 2QPAA 1ZNWA 3X1XA 1BTHH 2ZRPA 4YDHB 3VNUA 2GETA 2OP9A 1DICA 2RA0A 1YR7A 1YQTA 3KUCA 2ZR7A 4AKEA 2H57A 3N2IA 1NRRH 4WF8A 4ZCLA 2XTNA 4DW2U 2TIOA 2FDCA 1XEWX 1GMHF 2V6JA 4AYVB 1ZNYA 2E1RA 1QHXA 1G4UR 4O3MA 3RUOA 4EJSC 4MNVA 2Z9LA 1EJNA 2CLSA 5FOWA 2RH5A 4HZUA 1TLDA 1ZPBA 4LX0A 4LJAA 1H8ED 1B23P 2MMGA 4OS5A 1HT1E 4JBYA 1HE1C 5IDKA 1EFRD 1NY22 2FDAA 1FLEE 3LGVA 3M35A 2ZGBH 4A8JC 4A6LA 4FU9A 2HYDA 3SV7A 1ANDA 1L2EA 2BDGA 5A0CA 1G64A 3BTWE 2F91A 1L4ZA 1VCOA 2BQ7B 4XSKU 1GL1A 3EGKH 4I8JA 4B1TA 3VAAA 1JR3D 1DITH 4Z6AH 1N6IA 1U0JA 1DUAA 1W5TA 3CH4B 3BV9B 3HKJB 1X1RA 4G3XA 1DY8A 2A5JA 4B34A 4RKJB 2WWXA 4G0NA 2VB0A 2ZANA 2NU2E 4LJYA 1T4UH 3ADCA 1C2FA 2NPIA 4PPNA 1GI4A 4U02A 3GJ7A 2O8LA 2A4QA 3R20A 1E1QA 1AN0A 4A82A 2VWLA 1CR1A 2J0UA 3ZVNA 4OQMA 4QGAA 5C1YA 3S7KB 4IVPA 2V1UA 1NKSA 5CHAB 5A8ZA 2GHIA 1P3EA 4LC0A 1TAWA 4TPYA 1LCYA 1NG9A 4BFUA 5GADl 3GLFE 2R3UA 5JMTA 1NN0A 4AURA 2N46A 1MTSA 1E96A 2VP6A 1A0LA 3FMFA 1ZCBA 4WIAA 2BDBA 2XC0A 2PKSC 3BRWD 1DWCH 2Y80A 1LDTT 2IC5A 4I1UA 2TRMA 3ZD6A 4NMMA 2GV6A 5BN5A 3MMGA 4Q4HA 1TQ4A 1S84A 4PZYA 3M6AA 4KO8A 5GJBA 4GZLA 3AF3A 5TVKA 1ZYOA 3OFNA 1F5NA 1US8A 1FL9A 1ZAKA 1BO6A 4R8TB 1UTQA 1EJMA 1BZXE 1M2OB 1Z28A 2WIAA 3ATWA 1VTKA 3IKJA 3TH4H 4JLAA 1E6CA 4GPGA 2D2FA 3A37A 2FI3E 1O3KA 2XNIA 3KHVA 4NCKA 3AGQA 1W7XH 1RIFA 5E7IA 5JI3E 2BLQA 1JJ7A 1RD3B 1E2IA 2X1VA 2PR3A 3UQVA 4GP7A 2NMVA 3H09A 4DIIH 1C5QA 3B1WA 2Q21A 2ZJBA 2Z9IA 3THYA 3ZS9A 2G83A 1AQYA 1P3CA 3EW9A 1FUJA 2QPOA 4HAXA 4KODA 3CWZA 5J4QA 3SORA 2C9YA 4GZMA 3IEUA 5DPAA 1YKTA 3AKYA 3NDBB 3R7WB 1RXPA 1O2OA 4Y6DA 3KIDU 5F8TA 1O3DA 3RP2A 2QAGC 1GKIA 3SZNA 1GBLA 1E2NA 2ZRLA 1D3PB 2A32A 2BLVA 1PVOA 3STJA 1W0JD 2W26A 4TY7A 3MU5A 2AK2A 3QO6A 4BFTA 2QXJA 1YR8A 1UJ2A 5C5NA 2PTNA 1KDOA 2AFIE 4PXAA 3SBDA 1ZZZA 3PJRA 4KFSA 1W49A 1N1LA 7ESTE 2QF3A 3MUFA 4J1YA 3NHBA 1XRJA 1NBMD 2J46A 2P93A 4WBSA 3NZIA 2ZPQA 2ZAMA 5EZ6B 1JJVA 4B33A 4Y0YE 3ONWA 1B5GH 1DY9A 2PJRA 1BMMH 1M9UA 4F4CA 3TJNA 3OYPA 5JBAS 4TT3A 1Q1EA 5DO4H 2VVVA 3H7TA 5LBIA 1XJQA 2OUKA 2ZJ5A 1XCMA 1OFIA 4NH0A 4B3GA 4PX9A 1DG1G 1ZTJA 4D4JA 4DLXA 1F2UA 1WDTA 1QHNA 1C1QA 5IRCD 3O8DA 1K8RA 1S3GA 1R4AA 1GG2A 2EFGA 2QMHA 2YWHA 4NFFA 4EFLA 4CR9A 4ZUHA 3DZDA 4ZDIA 1SMFE 2ZI2H 4BLTA 2J0QA 1JB1A 1Z0AA 4JL6A 1UTLM 1G7RA 1QRXA 4M9ZA 1C5UA 4Q4AA 2P8OB 1CULC 1THSH 4JLVA 1ESTA 1FX0B 1E2MA 3W94A 1NKTA 4K2YA 1G3EA 1E1RD 1C5LH 4UKDA 3JZAA 1V2UT 2OAQ1 2CNWD 2QG6A 2OD3B 1ETUA 1A82A 2YC4C 4ZV4A 1N0UA 4RD3A 1GJDB 4GMDA 2ZRBA 2V7QA 3NEJA 1MO5A 1BTUA 1O37A 2ZGHA 1D3TB 1GRRA 2JLYA 3OEEA 5KOYA 4EDHA 2G1JA 1O2XA 4Y8ZA 4BFWA 5CMXH 3SJOA 3TJZA 2BBTA 4MVNA 4ZH8A 3GJ5A 1AVXA 4LWZA 3U2QA 1ZPCA 5ESTE 2NG1A 3K6ZA 1QQ4A 3THXB 3P27A 1YVDA 4KBFA 2QZ4A 4LHWA 3U44B 1OYYA 3LA6A 2CE7A 1SVSA 1JOUB 2C03A 4ITRC 2WWHA 3TNFA 5EP3A 4ABIA 1KO8A 4UNQA 4OS7A 4ZKNU 1K21H 3T1TA 3HU2A 1V2OT 1Z3IX 3RXGA 4OHZA 5BWMA 4WVFA 3LY5A 3SJCA 1Q12A 3PWBA 4IC6A 1G7TA 1GZSA 5IT5A 2GVFA 1C4Y2 1QB1A 1IN5A 1HYLA 4Q4JA 5DP4A 4V0ME 3SU6A 4U5XA 2THFB 3T62A 1PLJA 1Y3UA 3FVQA 1AGJA 1OSSA 2D7DA 4LBWA 3FOZA 2BWJA 1UVTH 2UUYA 1Z6AA 4ZAEA 2Q3FA 4Q7LA 4ZXYH 5DI3A 3U3OA 3TUIC 1ZOMA 5CIQA 2W2XA 5B64A 3TSZA 2OSBA 2NU1E 4D9QA 5C4GB 1ID5H 4TYDA 1DWDH 1BDAA 1UBFA 3S0NA 2GJKA 3NVAA 1QGFA 1K1NA 3GJ3A 4ISNA 3GEEA 2Z6BD 1GDQA 4RKOB 2EVWX 1LKBA 2FOMB 1HUTH 3LBHA 4FMDB 3G0HA 821PA 1HNEE 4LJ7A 4MQBA 2V1XA 1XDBA 2DUCA 2XSZA 3NTUA 2STBE 1RFNA 1HDTH 3P8FA 1C5XB 1QA7A 1S9HA 3DM5A 4HDCA 3CP7A 2RGGA 3PLPA 5EU8A 1YZNA 4DB2A 3U3JA 2UWLA 2R8RA 1JXOA 1KMHA 3GEIA 5AUNB 4ZDWA 4IEEA 8OHMA 1BYIA 2ZDMA 1A3BH 1OT3A 3RXKA 1T6NA 2HCBA 3MO6A 4O9VA 3CNLA 2WJIA 2WV9A 1TX6A 1ZCAA 3M5LA 1LMWB 1SKQA 5AR1A 1GVLA 1EGAA 1FW6A 3P92A 2FPZA 4AKIA 3GCNA 1GIAA 4UXHA 3K70B 2ZUCA 5CYOA 1P2SA 2AYWA 4XD7D 2O8DA 2EW1A 4RFVA 2DE9A 2D26C 1HV7A 1KI7A 4BRUA 4NCYA 3H2YA 2WKRA 2XTZA 4BZPA 3I72A 1PQ7A 2G52A 5G4BA 2QQEA 4O2LA 4AG2A 3V12A 1A0HB 1SHZA 5EPNA 1K1IA 1I4TD 5JEEA 3L8YA 4PPFA 6GCHF 3EIHA 4D4KA 2H1LA 2VIVA 2FFAA 5FUWA 3I5XA 3ZVMA 3WP1B 2VIDA 1R0WA 2AGGX 1VHLA 2PSXA 3LX5A 3KTAB 3ICEA 2BHGA 1BOQA 2B7DH 1PUIA 1TNHA 2ZQ5A 1C2DA 3Q3YA 4C0BA 4D9RA 1RRKA 1TNDA 4LV6A 2KE5A 4S35A 4URZR 1GOTA 9ESTA 2YJTD 5DI9A 1OP2A 1SKYB 4BPBA 1GHVH 1FDPA 3SN6A 3CBQA 2AIPA 4G5QA 2OILA 1QF9A 1S1CA 1GNPA 1BKDR 3GY7A 1AJEA 4BANB 1J8YF 3QG1A 2H9HA 2UUJB 5ANRB 4IW4E 5FCRA 3TGJE 4BUJA 2F9VA 3M5NA 2FYQA 2XZOA 1GI6A 3KKQA 4D26A 3ZZ6A 1H8EA 3KQBA 4AX9H 5JRZA 1YP9A 4LYHA 4NE2A 2GCPA 3CRMA 3DDCA 2VTKA 3N5CA 2DFLA 5AFYH 3K70D 1SB1H 1KNXA 3U7HB 4L9SA 1NO9H 1O3HA 3GDVA 2KB0A 4TWZA 2D7CA 1TNIA 2GXUA 5FBLB 1F5RA 2Y5HA 3QBTA 4DJZB 2O8TA 4M1SA 3GY5A 1FPHH 2ZDAH 1C5SA 3U8OH 3ZIAD 2V54A 3MCAA 1Z2CA 2EC9H 2ORVA 1U9IA 5JJLA 3UUZA 2JJ8A 4MGYR 5TCAA 1OXSC 2XJ9A 4HZHA 4P33A 2WM9B 4P4TA 3VMFA 1NIPA 2BCJQ 2ANYA 1SLWB 3R9IA 2ZFTA 3ZVDA 1C5TA 1II8B 2LKDA 1O2SA 1KKMA 1LB1B 4OHXA 3QZQA 5HPYB 2PV9B 1SULA 3CRQA 1E1QD 2ZE8A 3U60B 4FD2A 2FFHA 2P8OC 4QJ5A 2IYVA 4ZHLU 5EW2H 1EPTC 221PA 1F2TA 2ZRGA 4M1WA 4K8OA 3QF4B 5A8YA 1F92A 1O3NA 4DG4A 5IF9A 5FBIA 2RB4A 3OIYA 4N1AA 3V9PA 4B2IA 4DCSA 2OCVB 3GLGE 2M5TA 3Q8XB 1KO1A 1XXHB 4TMZA 3BFKA 3FKSD 1MABB 1C2JA 3ZVGA 4BFYA 5EW1H 3KQHA 4K5ZA 2FWWA 4TMXA 2ZDNA 1E0AA 1UF9A 3L6PA 3PO1C 1JBKA 2W6JD 4M8NE 2F9BH 2GCNA 1N3BA 3TNSA 4DDVA 1KZ7B 3VXFH 2GCOA 3V00A 1TA2A 1X8KA 2GBLC 2WKPA 1VCNA 1QY6A 3BXZA 4DXAA 2K5UA 4Y11E 1E9CA 1OFTA 4AFQA 3AVTA 1XUHA 1D9XA 2D4HA 1W0YH 1QIXB 1E79D 1C9PA 4KFUA 2C8WB 5DE3A 1E38B 2ECKA 5GJWC 1V2MT 2IEYA 2CL0X 3IHLA 1VG8A 1WB9A 3BG8A 3EAQA 3AP3A 4TL9A 4ZIRA 5JJKA 1IQGA 3OX7U 5H1YA 3M3VA 1SOZA 3CWQA 1AFQC 3ZZ7A 1MO6A 3U5ZB 1ELGA 1TMUH 2WPIS 3RXTA 1IM2A 3A8AA 1WTGH 5HTKA 3KL6A 2D06A 2QRZA 4GBMA 2R3YA 5FR2A 2OC0A 3QE0A 5DO9A 4KSCA 4DSNA 4HEJA 3BC1A 1U0HC 2FLRH 3K0EA 1UTKA 4PSVA 5F6MA 4AY2A 2IS2A 1VPLA 1ZMJA 1ZVQA 1BTXA 1Z2AA 1AS0A 4X8UH 2FJUA 3RXFA 3MOCA 3QY0A 4X8SH 1GRNA 1YCPM 1LVOA 2P3FH 3KFVA 1AKYA 1O3EA 1BBRH 1W14U 2QF0A 3IDQA 2BQWB 4PQRA 2G5NA 4ACAA 2W7UA 4HAZA 3SQHE 4TLEA 1VG9B 1ARBA 1YLCA 4IOLA 1Y5BT 1G16A 1YZQA 3ZYCA 4N0DA 3BG4B 1TOCB 1S82A 3AM1A 2XNDA 4XTRA 3BIUH 2VH6A 4DZZA 4FU8A 2QT0A 5AK0A 1HAXB 3GLIA 2Z9JA 4KJZA 3F9EA 4A15A 2PZGA 1E9FA 3KZ1E 2WJVA 1KJYA 1JPNA 1MOZA 2CF8H 2FTMA 1SXJC 5P21A 1ZNZA 1OPHB 4H4FA 2QENA 2J1LA 3SO3A 3AH8A 2ZFSA 4Y79A 2QMUA 3A8TA 1H9HE 2OV2A 1THPB 1HXFH 3H86A 3B85A 2WZQA 3P4XA 4JT2A 3QKTA 421PA 2C9CA 3SNDA 1U6QA 2STAE 1ESMA 2GKSA 5L2YH 1QHRB 1YCPH 1NFYA 3FAOA 3KFXA 2EU8A 4OS6A 2ZU3A 1DVAH 4GSOA 1KI9A 3JZ2B 2ZFRH 3AAUA 1IQIA 4TMVA 4AORA 4G01B 3LBNA 4NFEA 2BM0A 4DHEA 1GMHG 4MKGA 5CE1A 3V4FA 4Q1BA 3FE2A 2G5VA 5KNDA 3GCHB 2EFCB 2PCJA 4DLTA 1MKWH 3THWB 1EFCA 2QAAA 3AVUA 1TL7C 1ZUIA 3GFTA 1IONA 3PROA 3T27A 3SHCH 3GY2A 3QPVA 3BB1A 3LXRA 4NYJQ 4C0QC 1HAYB 3RU4T 1SHHB 1WRBA 2Q3HA 4CF7A 5BXQC 1HLTH 2ANKH 1A46H 1PPHE 5I46H 1P06A 5LB4A 5C4MA 3PUXA 4DLUA 1CRPA 1PV4A 4V03A 5JBCS 2YOFA 2VSXA 4HGCA 4PZLA 3SU5A 4JS0A 2GTBA 1P9WA 3B9FH 1GG6C 4HB3A 521PA 1Z0IA 2IWRA 3KQKA 1QRAA 3D8BA 4Q9KA 3GCGA 1W46A 4FCTA 2NU4E 4K46A 1IN6A 3SOPA 1E0JA 2PZFA 3PCRB 4IS5A 2OCBA 2P95A 1Q22A 3U7EB 3MO3A 4JZDH 4PO8A 2XZPA 3FZDA 3WBKA 2TGPZ 1AQUA 1C2IA 2CHAC 3K09C 2DFNA 4X8TH 5FAHA 2WUBA 3G82C 3IO5A 3OIWA 1S5SA 2OBMA 2YOLA 4BAMB 5KHOC 4CW7A 1GG6B 2VP2A 1CA0B 2A45B 1C4OA 2QRNA 2Y81A 1Z6XA 4NCJA 1CGIE 3CX6A 4K1SA 3BFXA 3PXGA 1DPFA 4X6OA 4LOYH 5J4KA 5F9HA 5LH8A 3GPLA 4BLRA 4CBNA 4ZHMU 4FUGA 1F48A 1ZPZA 4X6PA 1EG7A 1X7AC 1Z7KA 2ZUBA 1ZJDA 2NWNA 2PJZA 2BDYA 5IK2A 1XUJA 3GJXC 3C8UA 5DP5A 1TNGA 1NMXA 2PT7A 3L0PA 3BEIB 4N0EA 5FPHA 3EPHA 3U69H 4DLRA 1CRQA 2VH0A 3DL0A 2B8WA 2QSZA 3ZZDA 2P59A 3UIRA 1M1YE 5M04A 4Q03A 2RCNA 4JK5A 3EARA 4OGXA 4JZEH 4IDHA 5H68A 4S2EA 4TLDA 2FEQH 1LNZA 2ZTXA 2V7QD 3FTQA 1G6OA 5CIWA 1JAHA 3FDIA 3ADBA 2SFAA 2C95A 2MSEB 2X2EA 4NP6A 4ISLA 3LW8A 2PKAB 3IG6B 1GBFA 3RWMB 2BJVA 3U98H 1E94E 2G1KA 2QP9X 2REXB 4WH8A 2SGEE 2FPMA 3G5UA 3RXPA 4X8MA 2GA8A 2CEAA 4IDQA 3R9WA 3L3TA 3EA5A 1O3CA 2IS4A 1GCTB 4YZUA 3QUMP 3AVWA 4WAUA 4Q1CA 4YMSA 1Y3WA 1EFUA 1RIWC 2ZRAA 2ZGXH 4AD8A 3WXMA 3P8NA 3IEVA 1PLLA 1O2TA 4WXRA 1C2GA 2OFOA 4KLNA 1W0ZU 2ANMH 1ACBE 5BN3A 4MNWA 3MNCA 1JRSA 2VVCA 1NFUA 2BQ6B 3ATMA 2SNWA 1GWNA 3C16C 3K9LA 3O8BA 1VCQA 2CCGA 2O8BA 3MO9A 2FOAA 2OBLA 5JLJA 1KSNA 5HMAA 3ZVAA 5L3QA 1M7HA 2Y82A 2R2WU 1MU6B 4YO9A 4OK6A 2H1UA 2P65A 5JB9S 1LTQA 4A4DA 2EA3A 3UWJH 2J7KA 4FCWA 1DT2A 2WAXA 3WHLA 1E9AA 1MZAA 1FQJA 2VU8E 1NVUQ 4Q4HB 2ZYTX 1E0SA 1UTMA 3LGUA 2F9PA 4R2IA 2VSOA 1NVXQ 2ZR0A 3Q9LA 3VB5A 1O35A 1OB5A 3I8XA 4NONA 4ABYA 2ZG0H 1PPCE 4YC7A 2WMNB 5FI0B 2OQ5A 4URUR 1J17T 1UKEA 1ELAA 1XTJA 2OCPA 3DT0H 4TLCA 1E98A 1KI8A 4M1MA 2CVHA 4IXMA 2F83A 3AVVA 2OBQA 4H6SB 2VP4A 2EYQA 4CDGA 1OHHA 4IN2A 3M37A 5AHGH 4YM9A 2FE4A 2ZI4A 3PYHA 3AF1A 4JYBA 1HYQA 2BD7A 1C2HA 3ZZ5A 4QOSA 1Z1IA 2YWEA 5E0HA 2I6SA 3F9GA 3J81k 4ZI3A 5ETXA 2FOBA 3CPJB 5H4IB 4OM9A 4FN5A 2PW8H 3VEQB 3AVYA 3P8OA 2AKAB 5DP9A 1Y3AA 5FOTA 2WUCA 4MRVA 2Z3EA 1A61H 1KSGA 2B92A 3ZZ9A 4D80A 1K1LA 3R7WA 3TKLA 3UNSA 1FY8E 4IFBA 4GCHF 4HZUB 1E1RA 2O0JA 1C5MD 2ZCKP 3OEHD 2JLUA 2QORA 1YPEH 2Z83A 1D2NA 2R62A 2BY7X 2PH1A 1DLEA 1D5CA 4DCDA 4CH8B 1GHBF 4B6FA 2WICA 2JLXA 4LPSA 3GY8A 1TGTA 1R5OA 4ABHA 1Q44A 4JT4A 2ANBA 1NN5A 2ZI7A 1UADA 5JYIA 1O32A 2G4TA 2PUXB 2FZZA 2FLBH 2MSDB 1LW7A 1P05A 1SI5H 3QXSA 1KMHB 1E2KA 1QHYA 3REGA 2AWNA 4QFMA 3TMKA 1FMJA 3BTHE 3TH2H 3WMGA 2F3CE 2FPLA 4A1VA 1FJSA 2QY0B 2FGKA 1DTSA 4W5HA 3KKPA 2F1IA 4RZ3A 1F2UB 3X1ZA 1FN6A 4KFTA 3A88A 2WWGA 3A1TA 1ZC3A 3NC0C 4HI0E 5EGMA 4QRHA 2FI4E 5F8ZA 1WUNH 2J0UB 4LHXA 2XXAB 4JZIA 5GWZA 2VQSA 4OGYA 1TA6A 5EQRA 3LRPA 2IYYA 4LBYA 2FOCA 2VIQA 5C1UA 1G3IA 4I4LA 1XCPA 1JQJC 3RABA 4MG3A 3EA7A 1UFQA 1BCUH 3SS8A 1WMSA 2PX3A 3RXIA 1P5ZB 1QBVH 1TPZA 3AVPA 1YPJH 3B1ZA 5A0BA 1EOLA 2D74A 1FNNA 3RDPA 1N6KA 1FXYA 5CYPA 5EOKA 3Q77A 3K0AA 4ZDKA 3HDTA 4FWTA 3S1AB 1O30A 2H5CA 1ZSLA 1OFHA 1MKWK 3PUWA 2XOKA 2HPPH 1R5BA 2ZJ8A 4E5UA 3SI7A 4WY3A 3A8BA 3SI4H 1J2JA 6GCHG 4EAQA 2XC4A 2ZXUA 2WOJA 3AP1A 1H9LB 4VGCB 5AJXA 3GP8A 1DAHA 1BJUA 2V0BA 2FESH 5B30A 1JIMA 3L2OB 4D7FA 4F4JA 1G3DA 2QP3A 3A6PC 2GAOA 2ZI9A 1GCDA 1COWA 1D6WA 2GVDC 3T29A 1O3IA 2GAAA 3TNTA 4CRGA 4LCBA 2UVQA 4MQAA 3U44A 1AHTH 4HUQA 2FS8A 3DEFA 4ABDA 4ISIH 2DY1A 4CEJA 2IPHA 2V3CC 2Y5GA 2C4FH 3TQCA 2A5DA 4Q1EA 1KY3A 1SL3A 3FANA 2ZHQH 4QM7A 2VP5A 4ZKSU 1CJUC 3MGCA 1FAKH 2RKOA 1JPJA 3ZZ0A 2IYXA 1GMCG 2ONKA 3BG4C 4K60A 2GJAA 1CT0E 1XTKA 2WIBA 1HE8B 4QHSA 3P1JA 2ODYB 5FPSA 1YZKA 4Q7JB 2W0SA 1MD7A 1G18A 2XOKD 3NCLA 4GSYA 3L82B 4AOQA 2JJ2D 5FTKA 2ZTYA 2C9OA 2ZQ2A 3EZFA 4IVRA 4LJ8A 4INKA 1ZJ6A 2ZR9A 1C1MA 1GJ7B 4FI3C 3HATH 4Q1FA 1U0LA 5ABWA 2JLRA 2ZDKA 4CRDA 4P31A 1SFQB 3FHCB 3GCHC 2I4IA 1LHGH 4QGGA 4HLCA 1C1UH 1N5IA 1XMSA 2CL6X 1EQ9A 3BH0A 4KGAA 2Z7FE 2LNCA 2ZKSA 2BYAX 1P3JA 1G8YA 2HNTE 2RHMA 3VU9B 2A2XH 2ANCA 4POAA 5J5CA 2Y7ZA 3B7GA 3RC4A 1AMHA 1T31A 5TARA 1B0EA 4JVSB 1IAQA 3RC3A 4Q01A 1KDTA 3FFAA 5SZKB 1KDQB 1UM8A 2OT3B 3K8YA 1VJAU 5DP6A 4YESB 4CT5A 1Z07A 4OYHA 3RXJA 1AIPA 3RAPR 2HALA 2BCGY 1QHGA 3AVQA 1MT0A 3TAUA 1GILA 1EPTA 2XNDD 4MPUA 1P9SA 2ODWA 4CRBA 4JYVH 3UY9A 3LIWA 4C0LA 2HF9A 5EZ5A 3U1JB 2QM7A 1T91A 5D3QA 1DFPA 1KDQA 1QJ1B 4I8GA 2ZRHA 2DFTA 4M53A 5AF9H 3T5GA 1RJXB 1BB0B 4Q00A 3U1IB 4JLOA 4I81A 3PQCA 1CF4A 2QUZA 4PC1A 2TPIZ 4LGMA 3TLXA 1TFXA 2GNOA 3L0SA 3QDZB 4AB8A 4DB4A 1AZTA 1XXDA 2FX6A 1KAGA 1VYUA 4TZ6A 1Z0KA 4L4UA 1G7CA 3TE6A 2FFBA 1Z0FA 1KK1A 3DMDA 2K1QA 2IXGA 5BRRE 1O2VA 3EA9A 3E91A 1GJ9B 3I77A 1WBDA 4D4LA 3PUYA 1EUFA 2ZPTX 1ANCA 1T3HA 1RRPA 5JI2E 2VGCC 2Y7XA 2R6GA 1AZ8A 1G8FA 4I32A 5EP4A 2FOGA 2XWAA 3SUGA 1W7GH 2JLQA 1JR6A 1LVYA 5DK1A 4YT7H 5GJCA 1GBHA 1O5DH 2HUPA 3W3ZB 1W1WA 1NLZA 2HLCA 5FPKA 1PPGE 1KI2A 1G8HA 1Q20A 2GDEH 3LVRE 2QROA 1W2KH 4Z8XA 3MAAC 1DO2A 3U6KA 1PPZA 1T8OA 4JIMA 1GHZA 1Z6TA 4MPXA 1OH8A 1NBME 1Z6GA 2NU3E 1PQ5A 2XITA 5HKKD 2GILA 1SLVB 1MR3F 1NN6A 1ZBDA 4AKHA 3DHWC 2CE2X 2FMJA 1GHXH 4LBVA 2QSYA 4AFSA 3UPUA 2IYLD 2BZ6H 2WKQA 5TJXA 1OW3B 3P20A 1T4GA 1LPKB 1LQEA 3GFOA 3OAAD 1BYUA 4A7IB 1P75A 3M1IA 3A8CA 3VX3A 2IA5A 5KO2A 1QHHA 2VHQA 4PZZA 1A4RA 4B74A 1HAZB 1UO6A 5A09A 2OAP1 1IQMA 4AG5A 4GL2A 2G00A 2ODBA 4IN1A 1TEXA 4RN6A 1ZYUA 2ORWA 1SQTA 4JZKA 4CHAC 3U3MA 3LDXH 1Z6YA 3RXBA 3GJ8A 1YZGA 4UONA 4TYPA 3KDSE 1ZTKA 1C5OH 2GEDA 3F8TA 2IYQA 1WV7H 3RRZA 1NU9A 4TMTA 1OS8A 3ZVEA 2ZSFA 1C1NA 1K6MA 1DDJA 3UR9A 2BEKA 4QJ3A 3T25A 2A7QA 2X77A 4DCNA 5HKKA 3EPJA 3BTME 1HGTH 2BD8A 1V2TT 2O8CB 4D8NA 4NYJR 2JLVA 2F1HA 4Q66C 1ETSH 1EP5A 3T5FH 4JSTA 1ZMNA 4X1PU 1T5IA 2YOHA 1IQLA 1Y59T 1YGCH 3T15A 1CHOF 2P3TB 3OAAA 2GCOB 3VB3A 1KIMA 2QXIA 1HFDA 3SNAA 1J8AA 4XVRA 4OK5A 3AVXA 4X2XA 2C3SA 1FIWA 1BRCE 4V0NA 1UCYK 1MBQA 1HXEH 3TK5A 1CXZA 1UHBB 1E99A 2H9EH 3E70C 3SJBA 4EPVA 1O2UA 2WWYA 4B43A 1AWFH 2ZVQX 4W9MC 1FY1A 3GCTF 1H1BA 1BIOA 1O33A 1VYVA 4FW9A 1XXFA 3WNDA 1BRBE 1HA3A 3SYJA 1ZR0A 3F68H 1QFKH 1K9OE 2HGTH 1XMVA 3KTAA 1GI3A 1O2IA 1W47A 3RMMH 1GMDF 4ZKDA 3PTNA 2GK6A 2FOEA 5J47A 2CHGA 3BORA 2BB4A 4G5RA 2H18A 4DUGD 1WBBA 3RC6A 2XBXA 2FSIA 1P9RA 3QTVH 1SGTA 4A8JB 2W2TA 2GEVA 4IOJA 2AK3A 1ZU4A 1DPOA 1C5YB 2C98A 5CM9C 1GL0E 4Y0AA 1Q1QA 3PR1A 2SNVA 3D3QA 3FMPB 5JB8S 2NU0E 4PHFA 1AS3A 3T1OA 1AFEH 4MRPA 1DAKA 3EASA 2QA5A 5DJ7A 3GMTA 4YMUA 1X6VA 1BOFA 5FUXA 1S0QA 3UNQA 2QPTA 3IQWA 2P6UA 2EFDB 5C1XA 3CNOA 1S85A 2WTUA 1OYQA 3UFAA 3NIBA 3BTTE 2ZCLP 1TTTA 1QZXA 1DVRA 1P61B 1J14A 1JEDA 3KJEA 1W44A 5C46F 1NRQH 1T9HA 3I61A 3FWYA 2F1JA 1GCTC 3KQCA 4L16A 4LJ6A 1IQPA 3LKWA 4NKRA 4NIXA 2WJGA 3VR5A 3W5JA 5TCCA 4CEHB 1F0UA 2ZC9H 3FP8E 2GXSA 1LS6A 2O8EA 1KDPA 3ASZA 4H6TA 2XB4A 4KFRA 5HE8A 2GCHF 2GVZC 4NYIR 1CGJE 2VVUA 1VCIA 4TZ0A 1MRNA 3VB4A 4U01A 4IXNA 4UQOA 3MH5A 1C1RA 1RZ3A 3E0NB 2X2FA 4C0AC 1MO3A 1JALA 4XTCS 4FXGH 3OY6U 2PWXA 4Q2KA 1UEJA 1P04A 2ASEA 3GLFA 3R0FA 4JLBA 5EODA 1TBZH 4LC1A 3RS7A 4DIEA 2BVRH 1Z08A 4DCTA 5IK2D 1GBIA 3D49H 3QF4A 3TW8B 3IGFA 2IF0A 3QK1A 3P4YA 4TWWA 2ZSAA 3T06B 3U7GA 3SFZA 1GHAG 1QTFA 3IO3A 4KI0A 1BHXF 3SHAH 2J4IA 5EE9A 4DCUA 2D1JA 3THWA 2J3EA 4JSYA 5TXGA 2AN9A 3F9HA 3OEHA 4MLFB 1WYKA 1P9NA 4RCYA 3OU0A 1MABA 2J0SA 3E0PB 1Z83A 1CHOG 5K7RA 5EQQA 1Z0JA 2QGRA 1KY9A 1EATA 4X6MA 3RDZA 3KQNA 4EQ6B 2WJJA 2QI9C 4ESTE 4IMQA 3SUEA 4HZIA 1OWEA 3D7MA 1XKAC 1VG0B 1KLIH 1P7CA 4CREA 2VINA 2FPKA 4PO9A 2HLDA 2PHBA 1SGCA 2WV4A 4LV8B 2SGDE 1HAHH 2A7HA 4WMEA 2QAGB 4ISHH 3FP7E 2ZZUH 3FKQA 1E32A 4LZZA 4M9FA 3ZZTA 1SGFG 3T34A 2VL7A 1DLKB 3GICB 3OIUA 4BOHA 4JL8A 4R71A 4XWOA 4V0MA 3DKPA 3PLKA 4DVAU 2XJ4A 1OWDA 2G8TA 2EWVA 2O8FA 4XBBA 3A7WA 1KI3A 4Q02A 2UWOA 2KAIB 2HVXA 1XVOA 3MU1A 2AS9A 3HPTB 3MJRA 4Z54A 2AGIX 3PVSA 3PMAB 3IQXA 4JLJA 1GNQA 1YPHE 4QBFA 3CRW1 4PPGA 5EUMA 1G3CA 2IF2A 4JZ1A 2F9LA 4ILEA 3EPLA 4Y8XA 5EE5B 1KDRA 1N6YA 1JXPA 4PC7A 3DHKH 3GFPA 3RHFA 4M21A 2D2EA 3TVTA 2BVSH 1CA8B 4UJ5A 3EC2A 4A2QA 3IUYA 1K2I1 4NA8A 1UDWA 4A0HA 3QF7A 3RVBA 3GOVB 3IITA 2XNSA 2IS1A 1P8VC 2HDNB 3FFGA 1GKUB 1E2FA 3PWCA 3BTEE 2DR3A 1N6HA 1R8SA 1TGNA 4KVGA 1TQ2A 1N6LA 4FMCF 3A81A 2LKCA 1F7ZA 1KK2A 2OM2A 1DADA 3BF6H 2UZIR 3T5DA 1COWD 1A5GH 1YHNA 1GJAB 3LT3A 2ZDVH 2Z0MA 1VG1A 2G77B 2WWFA 2QC2A 3QKSA 1O3BA 2F9OA 2A3RA 2IWHA 4I31A 3GLGA 2J9NA 3A4LA 1C1VH 3O8RA 1AA9A 1E2PA 1RPZA 2HLDD 1N6RA 1HB0B 2WWIA 3B23B 2ZRDA 1W10U 1E0FD 4D82A 4KV9A 1CHGA 4XOJA 1W2GA 2GT7A 2DBYA 1ZM7A 3BN9A 1TIOA 2IN2A 3F3YA 3ZYDA 3S9BA 3SFVA 1U99A 2MSCB 3BBPA 3PFIA 4B3FX 5JHGB 1T32A 3S7HB 3U6BA 3C7KA 3FB4A 1GI5A 3AASA 8GCHG 2FSFA 5HXFA 1G5PA 1W36B 2GF9A 4M22A 1U98A 2KBFA 2VPPA 3H4MA 3PMBB 1E79A 2TGTA 3U3RA 1XVMA 7LPRA 4A0FA 4MNXA 2R0LA 2CLDX 1KI1A 2ZROA 4BTUB 4KYUA 4A2WA 1GBAA 1P10A 2UUFB 5BYKA 3P6ZB 5GVSA 4LUCA 5BN4A 3E6PH 1UTNA 4IOMA 1L1NA 4C2UA 2R6CA 1G37A 3S1AA 2JJ2A 2I3BA 1NESE 1HAGE 4ZROA 1I4LD 1HT2E 9LPRA 1U2RA 4DIHH 5L3RA 2OG2A 4ASUA 4P4SA 2N42A 3HYRA 3H5CB 2C77A 1S6HA 4F38A 1K5GA 3BGWA 4K3JA 5DNYB 3SU0A 4AYYB 2YHSA 4I1SA 3SYKA 2A0QB 4ARZB 2E9SA 4XIGS 3EX7C 3EC1A 2HRVA 1S83A 4CH2B 3THYB 3EIQA 3B5JA 4PC3A 1TPSA 2D8WA 2WHXA 1U8YA 1WBGB 2W3IA 3HWSA 4GDFA 1Q57A 1ZIPA 2LCFA 4UFDH 2KSQA 3NG1A 1OH5A 5JWRA 3EQ0H 3KXIA 1KHTA 3HYTA 1P0SH 2X19A 1G21E 3DOEA 2W83A 2ZIQH 3OTPA 1UDXA 3B2EA 4EFNA 5IYTA 2CVFA 1CP2A 4WMDA 3KKNA 2AFQB 4OHWA 1G3RA 4NYMR 2FSGA 2BX4A 1S1MA 2ZSEA 4LY6A 1A5HA 4EKDA 1D2EA 3ENSB 1NTPA 1YZUA 2BV3A 4Q48A 1P2TA 1MTWA 3GCOA 3SN8A 5KDDA 1KZGB 1AUJA 5JSZA 3U9AH 1HTWA 1AUTC 2C5LA 4BFVA 3K65B 1AGRA 4X2YA 3BJIC 2ZFPH 1FOEB 2WJYA 1XX6A 3B8HA 1AZZA 1TRYA 8LPRA 2WSMA 1YE8A 1CJVC 3KKOA 5JEDA 3ZVFA 5B57C 2YNMA 1P4SA 4RSGA 1WSSH 2AEIH 5DGJA 2ZU4A 1G5TA 4NPHA 4LZ1H 4WXVA 1X3SA 4FUJA 1KK0A 3LBIA 1E2GA 1GSIA 2BHRA 3D31A 4QL3A 1O3YA 1KSFX 1TX4B 3M5OA 3A4MA 1EFRA 3C15C 5EXXA 2QN6A 2V55B 3T35A 3VFEA 2GX4A 1E2HA 2B0FA 1CJTC 2BDCA 3FMOB 5HZKA 5E7MA 3MNXA 4GAWA 1XUGA 2NOAA 4Y7AA 3UKDA 1CVWH 3RXQA 2ZU0C 5EG4A 1YBWA 3MTYA 5G53C 1CS4C 1FY4A 4LBZA 2VA8A 5BYJA 2G55A 2HNTF 4XBDA 1NJGA 1U9IC 4Q9JA 2EFEB 5B58C 3VR2A 3A83A 4E07A 3LOXA 1LQDB 2ZRCA 2QY9A 3TW4A 1KXCA 1YRBA 1AO5A 1NVVR 3VKHA 2R2AA 3RNLA 1YPGH 1GFIA 2W7SA 1U81A 2GJ8A 1KNQA 1PJRA 3E16B 1DS6A 4DBLC 1MH0A 4B3DA 2ZP0H 4XE4A 2ZE5A 3W90A 1E9RA 1DX5M 4WZAE 3MU4A 4QBIA 4U7DA 3LXXA 1SLUB 3K9HA 2ZUDA 3URDA 1T3LA 1O2KA 1FI8A 3LJJA 1FZQA 1SVOA 2NO9A 2WWWA 1OWIA 2Z5FA 5FR1A 2QBYB 1CT4E 5I25A 3K09A 1GMDG 4INLA 5KDOA 4I8KA 4MRRA 1IHUA 2XGJA 2QT1A 4MITA 2C78A 1O5AB 3TGKE 5JHHB 1XUIA 3AVOA 1GGDC 1KXAA 4IDOA 2BMEA 1E35B 1C1TA 2H6MA 1FTNA 4HUQB 2FS9A 2ZHEH 4RD4A 3QSYA 2OESA 1WQ1R 3U3KA 4MYUA 4CRFA 3EPKA 1GITA 1O2JA 2G88A 4RJLA 3LH3A 5JWHA 4XVQA 1IY2A 1TWXB 2FNAA 5EE3A 2J41A 8GCHF 1NSFA 3LH1A 3N70A 4U32A 3RXMA 3EWAA 1DS2E 4A8JA 4JKIA 1BT7A 1VITH 1W36C 2AFHE 1EZSC 2O0HA 2G0TA 1LV7A 1E0KA 2GDJA 2JH6D 4K8YA 4BAOB 1M74A 5DP7A 3QKUA 1GL7A 1NI3A 2TGDA 1UVOA 4LI0A 2OHFA 1A3EH 2Z3CA 3E8LA 4XVUA 4X2VA 4SGBE 1GJCB 4RVCA 3NUMA 4FVDA 3DO6A 2ZCHP 1N6PA 2B21A 5G41A 5K8TA 1OIVA 5CDFE 4NHOA 1SKYE 2P5TB 1SGPE 1P2VA 2ZQ1A 3Q7QA 3TVDA 3W6PA 4V02A 4X1RU 1P62B 4HAWA 3P32A 2VJ1A 4GT1A 2AXPA 4TMWA 4L5BA 1W0JA 4ZMAH 2NGRA 3VR4A 2XBVA 1L1JA 1GJ6A 2CJWA 4W7SA 4NBSA 2LWIA 3DFJA 4AYTA 4LHYA 2HF8A 2F3TA 1J70A 1NF3A 1N25A 2OXSA 2GEUA 4DLYA 1DG3A 2FU5C 2QTVB 2EI8A 2ZRKA 1C4U2 1PUJA 3TUJC 1LO6A 4TT3D 2OFXA 1XKBC 1UKYA 4DEYA 1G17A 3A7TA 3I1FA 1R5NA 2CJIA 3GD7A 3B1VA 1O5GH 1J90A 3IPYA 3MWJA 1FNMA 1MMJN 3URCA 2A30A 2AHOA 3TGPA 1Z0DA 5L3VA 1GJ8B 2CNWA 4PC6A 3SGQE 3KB2A 5A2MH 4DWJA 1XEXA 4Q4AB 1AKSA 1KY2A 2O8UA 3GCTG 1IN8A 4UFFH 2HJGA 4RD0A 4PO1A 4R98A 5KDLA 1TU4A 2Q9BA 1ZLRA 3TU7H 4FCVA 4M1TA 1YPKH 4Y10E 1EFTA 3T61A 3SU4A 2PZEA 2CN0H 1YR6A 3A7YA 1TBQH 2JIZA 4QC2A 3VR6A 4UD9H 4A6XA 2WPHS 1TADA 3TSWA 1SHKA 1P01A 1QB6A 2HOBA 3Q5EA 3Q00A 1F5KU 1YR9A 2FX3A 1CA0C 1ZHPA 1CLUA 2HEIA 1ZSJA 4L9WA 4U30A 3I5YA 2SGPE 3AQ4A 3TITA 3GYMA 1O34A 1P2KA 2VHUA 7GCHG 2BM2A 1DOAA 2IXFA 1VMAA 2O8WA 4AGKA 3A89A 1LHEH 4NGAH 2CHAB 3MD0A 4D4MA 2XZLA 1YM0A 4PPQA 1OPXA 1EZXC 1GBMA 3B60A 1EASA 1NY6A 4LV5B 2GDDA 5LPEA 2BDHA 2G81E 2FZ4A 5H8WA 5AUOB 3KJHA 4JJKA 5K8UA 3ZVLA 2FEOA 2IBMA 1F5LA 2PX0A 1THRH 2VF7A 4E06H 2EFHB 1OB2A 3RC5A 2H5EA 1Z63A 2FI5E 1ARCA 4Z8YA 1BIFA 2AMPA 4FIDA 4GOKA 4EPRA 1XP8A 2V35A 2NO0A 3CUEF 4JLKA 1HJ9A 5CJ2A 3TIFA 3FP6E 2AERH 3KL4A 1FTSA 2OQUA 4C7OB 4NCIA 3BOSA 3L33A 2IUTA 3HPRA 1IOEA 3LLUA 3QKRB 4QNRA 4D25A 1C1YA 5JBQA 1S8FA 1XEFA 3H0KA 4TQUS 1NZQH 4FUCA 4R2HA 4R7ZA 2IS6A 2N1BA 4UXJA 2BDAA 2W00A 3TAHA 2NQ2C 4BTIB 1ANBA 2RAPA 3C4JA 1O2WA 3BH7A 4NSVA 3SUFA 4QHTA 1V2JT 1IQHA 2QTHA 2Q0HA 1DM4B 3ND8A 3QVVA 1WQVH 1C4V2 2CK3D 2BMFA 4A6PA 3IIKA 4HUTA 3MH7A 3DM9B 3UTUH 4EPWA 1X8LA 2O8EB 2CCKA 4FMDF 4JZFH 3OY5U 5AJYA 2HWLB 4FUEA 4MTBA 3O47A 2GZ8A 1OF1A 1TU3A 3SV2H 4TSFA 1ORFA 1FNIA 1Q21A 1OHHD 4EIWA 1O2RA 2GCTB 1H9IE 1EAXA 3SUDA 5EJEA 4JCNA 4PTLA 2AD1A 4YOGA 5G3YA 3QENA 1V43A 2QNRA 4D6PA 1EXFA 3EG5A 1TAGA 4OQXA 3QG5A 4XD7A 4D81A 1CBWB 2ONJA 3Q3XA 4LHVA 1XXHE 3AKEA 1GVKB 2ZS9A 1IJFA 3SU8A 2YKGA 3MNSA 1O2YA 2CCJA 4BNRA 1D4PB 1A2BA 1R0XA 3SJKA 3FVFB 2L0XA 1SGEE 4KTSA 2ODPA 2Q6FA 1EOJA 2F55A 3SQXA 2IW3A 3BAFA 3RU4D 1GJBB 4BZXA 3LVQE 2WPLS 3C41J 3NPSA 4LZ4B 4BLSA 1YZLA 2V6NA 1IBRA 2FSHA 1ANKA 2RG3A 4GCHG 1O5BB 1S2MA 4OL0A 3BIVH 1UBEA 2O8BB 4B3BA 3RLWH 5K0HA 2RGDA 4TL6A 1L0ZA 2Z4RA 4QJ4A 1ELFA 3CM0A 4AZ2B 4DJTA 1NL3A 2FMXA 2JATA 2OBOA 1HEIA 4EJSB 2ATVA 3NK8A 2DWQA 3RXRA 5FI1B 3DVLA 1CGHA 4X8VH 1XZPA 2BD9A 3FMIA 1EESA 1SGNE 5EE1A 1TGCA 4THNH 1E34B 2FV8A 1SR5C 1O2HA 4Q7ZA 2ZSBA 2R0KA 1G2MA 2GCTC 4NTZA 5HE9A 4FUBA 1O3GA 1R8QA 1KKLA 3CONA 2EI7A 3ATIA 2QBYA 1OWHA 2ZE7A 2ZM5A 1PPEE 1OIWA 4EPTA 3BB3A 3QEOA 4XSGA 2VGCB 4X8HA 1GBTA 5HR5A 1KMQA 5EE0A 2CL7X 3BE4A 2A4GA 6Q21A 1DEKA 1OKKA 2BD3A 3EE0B 1P2MA 4ZPXA 3BIFA 5JBTA 1EAUA 1A7JA 1ZP6A 1KK3A 2B5TB 4X8LA 2GV7A 1XX9A 1FPCH 4V0KA 1GWAA 3F6UH 1W4BA 2JJ1D 4QM6A 3W6OA 1QURH 5SZJA 3SV8A 1BMFA 1ESAA 1YCPK 4RD2A 4DT7B 1E69A 1GPZA 4KELA 3I32A 3NKKA 3IWMA 2QCYA 4OHVA 4ASUD 5IHPA 2B8OH 3LC5A 1XMIA 2WSSD 2J92A 1G41A 5TB5A 3SJIA 2ANWA 4KSBA 1Q3HA 1W0KA 3LO5A 4JLDA 3NBFA 2JEOA 2ESTE 1FV9A 2XAUA 2R2MB 5HCIA 4RD6A 4MDFA 1Q0UA 1JECA 2YNAA 2GK7A 2RGNC 3PMJA 5G40A 1RRCA 1KGDA 4QT8C 1KLJH 4C4PA 1X8JA 1BRAA 2VBCA 4NDZA 4IW3B 1GRQA 2BXUH 4LJ4A 4YXWD 2P94A 3QOFA 2W6IA 1RTFB 2CXVA 1EAIA 4H42U 3QJYA 3GJ4A 4GP6A 3A7ZA 2JAQA 2FODA 3SEAA 5K8IA 1WE2A 3CNNA 4WZBE 3X1DA 3RXLA 1VYTA 4L8GA 2ZAOA 3K2UA 2JLSA 4I1OA 3A82A 1CTQA 1WOFA 4RKFA 1RYHA 1OE0A 2ERYA 1VKJA 1XXHA 4OK3A 3F9FA 3GLFB 1TPAE 2V9PA 1IJEA 1TALA 3WY8A 4HYYA 4L15A 3HGNA 1C2EA 3HR7A 2ZHDA 2AH4X 2IOTA 4Q80A 3SYNA 5EXNA 2R6DA 5KSPA 2ZPSA 1ESNA 5HGGA 2VIWA 1O2LA 1LHCH 1FFHA 4ZO4A 4WH6A 2Z94A 5SZIA 2C04A 1IN4A 5CDFA 1PPBH 2ZFQH 3SJZA 4PQFA 1MTUA 2FXRA 4V0OA 2KI5A 2ZU5A 1XZQA 2W6JA 3ZZ3A 4E05H 3K0AB 1TNLA 1NVWQ 3B9QA 4JLPA 3ICQB 1S6FA 1DWEH 2XB2A 2RGCA 1RTKA 1OXTA 2ZGCA 1T8UA 1C9TA 4P0TA 2HT1A 4ZIRB 5GNDA 1VGCB 1FPMA 1IQNA 3F0TA 2WOOA 1LTOA 4B3CA 4AFUA 2PBRA 4FU7A 4KLZA 3AUXA 1HAPH 3EZ7A 2R9VA 4D0NA 5JJIA 1KXEA 2PGQB 1A2CH 1YRAA 3M36A 5A0FA 3SE0A 1SLXB 3EYDA 2BY8X 3QTOH 1O5EH 4URWR 2YC2C 1C9KA 3LGIA 1UBGA 4M4SA 1H8HD 1XD2B 1Y8TA 3SDZA 3DPUA 5GJ4B 3KQLA 1PQAA 3QPWA 5JECA 1IQJA 3KNXA 3VGCC 2ZTZA 3LONA 1O39A 3REFA 1ETTH 5CLLA 1OXVA 5FOXA 4LXBH 4BE7B 1CSOE 4GOXA 2OUAA 4RFSA 1XD8A 2G0NA 1ZGVA 5FTMA 3BD9A 3SOSA 3E90B 3DUXH 2TBSA 4ZI2A 1INCA 1BQYA 3VFDA 5AUPB 3ZZAA 3X1YA 3E1XB 1BMLA 1ELOA 3RLYH 5CK5A 2R9PA 5F2EA 4ABAA 1AZSC 4CBOA 2ZS7A 2VH5R 3ND9A 4O97A 3M4YA 4YMWA 3RRYA 5GDSH 3WRYC 2VWOA 1C2MA 2GJSA 1GDNA 2WMOB 1QHIA 4M1OA 4EPXA 1R0ZA 3RXUA 4Q7MB 3K53A 2J95A 1PJPA 4I33A 2VF8A 3ELAH 1KJZA 3K0SA 1VITF 5FHTA 4BXWA 5KTYA 3QN7A 3SNCA 4JYCA 2Y5FA 2WPJS 1ZD8A 1BMNH 1CKEA 4US0R 1D3DB 3RMLH 2I1QA 4B35A 3N2EA 2ZEJA 2V4ZA 1ABIH 3EZ9A 1WTHD 2BTCE 3OF5A 2JKHA 4BLOA 1ZM4A 3RANA 3DKVA 3TBKA 2J7PD 2D62A 3QNUA 2AMDA 1HIAA 4CRCA 4OHYA 1LY1A 1RKBA 1KSHA 1SBWA 3TPIZ 3R3GB 4O3UA 3PM3A 1P73A 1JR3E 1XB2A 2O0KA 3W6NA 3TK6A 2GP9B 3I29A 4YQFA 3VR3A 1EX7A 4XSHA 2WPDA 1ZSKA 1ZRHA 1ZMLA 3RYTC 1V3XA 3V4RA 3C5CA 2PSYA 3T26A 1UHBA 1ZC4A 1CE5A 3K0FB 1C5NH 2O8DB 1VJ9U 4WXIA 3U8RH 2CV3A 1JIRA 4MA4A 1ZGIA 3P8GA 3ATLA 5GPIB 1YPHC 3LX8A 5D3MA 1AQ7A 5F03A 4URXR 621PA 1MBMA 1YLDA 1M6NA 1Z8GA 1FUKA 1UK4A 4H1VA 1F6BA 1F60A 1G32B 4IEIA 4QGFA 1O36A 3M3TA 3QBVA 1V2VT 5FXLA 4Q7KA 4LYJA 1GI7B 2ZA5A 2AR7A 4HSEA 2VEDA 1GMCF 2BVNA 1KI4A 1SGYE 1Z29A 4EJSA 1G4AE 5FL7D 5C18A 1ELDE 3UPEA 4G5SA 2YWGA 1S0RA 3WP0A 4MYCA 1EWRA 3Q85A 5AUQA 1UVSH 3M5MA 3TR5A 2BIFA 4NZLA 1U94A 1OIXA 4TQ9A 2WPDD 2RGAA 1E9SA 4Z1MA 4A0GA 1KI6A 2IYRA 3K9XB 4DUGA 2FA9A 2PUQH 3A1VA 4OI1A 1MQ5A 1HCGA 2J5XA 5FBRB 4OS1A 4FVBA 1D9IA 1QJ6B 1TE0A 2AX4A 4DRZA 2H9TH 3WMFA 1ZHMA 1ELCA 3SZRA 4Q21A 2V3OH 3MI4A 2BY9X 4LJ5A 4DOQA 4ZKRU 3BTDE 1XTRA 1GBJA 4YOIA 5T6GA 6LPRA 2CK3A 3U4QA 2A5YB 5SZHB 1O2QA 1KOFA 4A2PA 1KI6B 4FUIA 1OXXK 4F91B 1GVNB 2JASA 3ZYEA 1QCPA 4VGCC 4Q9LA 5DSZA 2JDIA 2H8KA 3SHWA 2FO9A 3HJNA 2P6RA 2ALVA 4DSTA 1TNKA 3RLFA 5T1VA 5LDDC 4LK4A 4YMTA 3RM2H 2ILNA 3BEFB 5B6OA 1UKVY 4JL5A 4EPYA 1LVGA 4FUFA 3NBXX 3SV9A 5JZVA 2B8TA 4GVUA 4BAKB 1JI0A 1SGIB 2J34A 4TY6A 1K1MA 3E1SA 1U90A 3D62A 1LPZB 2BMJA 3CR7A 2BD2A 5LPNA 1IY1A 1G9IE 2GTPA 4TTRA 3BERA 4R0IA 2SGQE 4MNYA 1RTLA 2EYUA 1OKXA 4FUDA 1SVKA 1MKXH 2CXXA 4MUAA 4MDEA 1Z47A 2A9KA 4IVQA 4DDUA 3RRMA 1LKAA 2UKDA 4ABBA 1KYNA 3Q3JB 4H1UA 5EQTA 1DARA 1GP2A 1TX8A 5FBVB 2NO7A 4US2R 3UANA 1E2QA 3NXSA 3MSXA 4A92A 7GCHF 3I3SR 1XBTA 2OC7A 1H8DH 2YINC 1GI8B 2WYJA 2GMTB 3U61B 1E3MA 5FOVA 2BXTH 1W12U 2Z9KA 5L3QB 4Q4LA 5CM8B 1P03A 4IDPA 5KSZA 1Q31A 3A8DA 3VTKA 1TNJA 3UWIA 3C14C 3PUVA 2JLWA 1RRFA 1NRJB 2Q6TA 3K0CA 2AXNA 1TBRH 2BM1A 1UBCA 1I2MA 3IBYA 1QVAA 2FN4A 1KAOA 4XDEA 1G1MA 2RGEA 3DD2H 2ZRMA 3T1VA 4B32A 1O3OA 3LLMA 2HJVA 3TRFA 2FOLA 2Z4SA 1AE8H 1GI9B 1XUKA 4CEJB 4HLUC 1TF7A 2YYZA 2SGAA 1NLFA 4QKQA 3LPRA 2Q9CA 1V2QT 1W11U 1GDDA 1BITA 3UK6A 4KAXA 1MU8B 1OH6A 1TRNA 2WV5A 1E37B 2F7SA 1HAIH 4LSGA 4GUXA 1FIZA 1CBUA 1GL6A 5GJVC 3BSQA 4HI3A 2J2UA 1V6DA 3PENA 4JMPA 3AUYA 1EXMA 2ATXA 2W2VA 1V5WA 4BFZA 5L2ZH 2J9RA 4B6EA 3ZVBA 1BTWA 1AFQB 3VR1A 2WYGA 1W0KD 4HDOB 3PV5A 1BBRK 4BEJA 5SGAE 3BTGE 4URVR 2VYFA 1NRNH 3UXMA 1WU1A 6ESTA 5E4FA 3OHMA 3GY4A 3CR8A 4ZCMA 3LH5A 3UNRA 5JSZB 3SV6A 5A0AE 4II7A 3CPEA 4BGDA 5F8XA 5F98A 4B76A 2BBOA 3VKWA 2IL1A 1W4RA 4B2LA 1BMAA 2XTTB 2ZREA 3QVUA 1D9ZA 3VU9A 2Q6DA 3QIAA 4CEHA 1N2CE 4UDWH 2XYAA 3V3MA 2XCFA 3LD9A 5HM9A 4PQYA 1W3CA 3KJIA 3Q5DA 3AW0A 1LVMA 1SC8U 2W5EA 4UFEH 4AKGA 1K5DA 4ZKEA 1EB2A 1J7KA 4AN7A 2C8ZB 1KTSB 1S4QA 5FPTA 1RYFA 4U2WA 4WZ6A 2RGBA 3AW1A 1S9DA 2OFWA 2JJ1A 3BK7A 2ZRIA 2B9LA 5ESBA 2A5IA 2W6ID 3GLHB 3B6EA 2J38A 5KU1A 4Z51A 2AMQA 1XM1A 3HU3A 5H70A 1T7CA 3BB4A 1TF5A 5FTJA 1FP6A 1HIAB 2ZECA 2RHDA 1KO4A 1DO0A 5EQSA 2BOVA 2IJOB 3A80A 4P32A 3GISB 1OX1A 1FP7A 5KSYA 2BX3A 2O5VA 1WP9A 5AJZA 1UK2A 1G8PA 4QNMA 4WMFA 2OCYC 3B8JA 1SVIA 1UMAH 3R8FA 2QYIA 2GT8A 4JMYA 4W5JA 3CPHA 1N8OB 4CHAB 2F43B 4BLPA 1BMFD 4O03A 5B2ZA 4KKDA 1EX3A 4DGJA 5G3ZA 1YJ5A 1AK2A 2IHYA 2DYKA 1FMLA 2RGNA 1OH7A 4Z0KA 1NG1A 5PTPA 1MTNC 1ZNXA 2IYWA 4TPIZ 5TMPA 3OZXA 1Y3XA 5CB6A 3UMRA 1W4CA 3KX2A 2GXAA 3D6TB 3ODDA 3MNBA 1KO7A 2BLOA 3D23A 4TYQA 1H8HA 5C2JB 3ZZBA 2JA1A 3LGTA 2ZYWX 3FHOA 1O3MA 1Z1JA 1TQDA 5L3SA 1EAWA 1Y5UT 4O2RA 4A1FA 2EEKA 4DSOA 1S0UA 3TIUA 2LPRA 1ZJKA 3U7FB 4AGJA 1TUIA 4KCGA 2A5KA 2D2DA 4GNKA 4A5TS 2XX3A 2VRWA 5C1BA 2V3HH 2CHQA 1JEEA 4LHZA 3P70B 2WPMS 2PFEA 3SJ9A 1D6RA 4HATA 3CO5A 3M7UA 1W48A 1N6XA 4INHA 2C90B 121PA 1W13U 2A1DB 4X6NA 1MQ6A 1GM5A 1NS3A 2GCHG 3QXCA 4ESVA 2A31A 4F7WA 4E7NA 3AKDA 1L4UA 2C93B 3GJ0A 1S3SA 2CMKA 3ESTA 2ZO3H 1U8ZA 3UREA 2NIPA 5JCPA 1UVPA 2A7JA 1IAUA 2ZJYA 3OE7A 1E2LA 4OI2A 4QGHA 2ZGJA 4FINA 4BLQA 4ABJA 1E9EA 3CRVA 3GY6A 4YLGA 1VITG 1TGBA 3DMNA 2PKSB 3AGPA 4PSAA 4NIVA 3SI3H 1W36D 1FN8A 1L1GA 1XTSA 4CEIA 3GLGB 1LPGB 4N3NA 4RZ2A 1JRTA 1TF2A 4EUNA 4ESHA 4BFSA 2H7VA 2A7CA 1GI0A 3TJVA 4C3ZA 5FBEA 3VKGA 1L8QA 3TK1A 1G5RA 1FONA 3RXVA 1UJ1A 3ETLA 1NJFA 3K70C 1NN1A 4HAUA 1JMOH 3LFUA 3ITIA 1BJVA 2PL3A 3B1YA 4ABGA 1PLKA 3P95A 1HJ8A 1XU4A 1BUIA 4YOJA 1MAYA 1KO5A 4TLBA 3C5HA 1O3JA 5FTLA 3CF6R 4ACBA 1V2PT 2NZ8A 4E7RG 4KITB 2ZJZA 1L7VC 4TYWA 3GQBA 1FUUA 1AB9B 1ANEA 3A7XA 3NDPA 5JBBS 2ZRNA 3B78A 2IHBA 4Y8YA 3UG7A 4UNSA 4NCNA 2UZ3A 2W0MA 2FF7A 3FHTA 1B0FA 2F4LA 2ZRJA 2CDNA 4NIYA 3M3SA 4B71A 3KKMA 2DE8A 1C5ZB 4KBGA 4RCZA 4E09A 1BA8B 4DDTA 5FOSA 3PO1B 2ZYVX 3VXEH 1H8IH 1Y5AT 4TL7A 1ZU5A 1WCZA 1SXJB 1AGPA 4YXWA 3HU1A 3FKSA 3UWKA 1O3PB 1NMZA 1J8MF 3UWOA 1HAOH 1TMBH 1Z8JB 5EP1A 1VCWA 3MYWA 3ZJYA 3RS0A 2QN5T 1I4DD 2OO7A 3K1JA 3KN2A 1ELVA 2FTLE 5T6FA 3X2SA 4XJXA 2GRJA 4B73A 2QA9E 3ECCA 1SHYA 2GZHA 1V2KT 3SYLA 2J7PA 5AWFC 4IOKA 2ZI6A 4OQFA 4KP0A 1SZPA 4E22A 1A5IA 2ZETA 1C5WB 1SG8B 2GXQA 4HFPB 1V2ST 5EXLA 1JQLB 2OXRA 3KEEA 2ODQA 1W2HA 2GZ9A 4LDJA 1XD2A 2I1VB 2CLCX 4FWIB 1N0WA 1ZRBA 5LPRA 1SVWA 5FL7A 3BTQE 4DLWA 4C2TA 2ZHWH 1NNEA 4JVMA 4F4IA 4PROA 5CB8A 3GEHA 1KTTB 1H4WA 5DHAA 1UCYH 4PHHA 2IK8A 1SFIA 4OI0A 4MKIA 5LGOA 1QHHB 3CRRA 1G30B 1E2JA 1HPGA 5CK4A 4A1TA 1SGDE 3W95A 2GZDA 4CT4B 3FPAA 5E8EH 4OQNA 4B2PA 4C0KA 1K1JA 1BTZA 5DHFA 1WXRA 4IC5A 5J4YA 1PYTD 1HY3A 1AN1E 5DLQC 2R65A 3GLIB 1RGQA 1KXDA 1O2PA 1TQ0B 1NVVQ 3SC3A 4DKXA 2GZAA 8ESTE 3KQUA 1IHTH 4A36A 1AM4D 4ZDJA 1EP6A 4UEHH 4DLVA 4LYFA 3L0IB 2NZJA 4IJMA 5E2OA 4YLQH 4IRUB 3EA0A 2R6AA 4O25A 3VHLB 4JBWA 4F92B 1ZHRA 2GWHA 4GHQA 3LU9B 4YONB 5T6DA 4PHTA 4UNRA 3A36A 3M0EA 1XD9A 1EFHA 2WBLC 2QGNA 2ZYUX 4AFZA 1P60A 4J2YB 2GMTC 3AEZA 3CW2A 3UOUA 2W58A 3VB6A 3FGNA 4GOJA 1MKYA 1VECA 2BBWA 3ZDQA 1PZNA 3MH6A 1RE0A 4CIDA 4K1TA 3GYLB 3AF2A 1S81A 2P2LA 3HPQA 5E0GA 2JDID 4EQ6A 1OXGA 2ZU2A 3UMSA 3MWYW 1NN3A 2PMDA 5AJVB 2BBSA 2VIPA 1A0JA 1DBSA 4XWAA 5J4SA 1UK3A 3MHWU 3ATKA 3UR6A 5DYGA 1ETRH 3CENA 4ASHA 1D6JA 3RXSA 5EXTA 4WWYA 4Q5IA 1HUQA 1QBKC 2Y6TA 3TK9A 5KNBA 1O31A 1EK0A 4OS4A 2FP7B 5J4LA 1CJMA 3RC8A 1JAIA 1RJ9B 1G3UA 1KXFA 4WOPA 1QNJA 5AJWA 1TMTH 2AGEX 2A78A 4OS2A 2OLKA 4TWYA 1YPLH 3SZEA 2EWWA 4OQLA 3BWDD 1RVDA 4WW0A 3RXDA 2QMOA 1IXRC 4DLSA 3THXA 2DWOA 4I1VA 5LB2A 4M7GA 1D2MA 1GVZA 1RS0A 5GVRA 1M8PA 3RMNH 1NM6A 1SQOA 4CYMA 3LDAA 4GLYA 1NBMA 4CR5A 2KWIA 5JFGA 1C1OA 1V2WT 1J16A 3EDXB 1XPOA 4O0MA 2QL6A 1C1WH 1IQEA 3NKVA 2D3WA 5FBQB 1UKZA 2BD5A 3V0XA 4A9AA 1SVLA 5K8LA 4DSUA 2WPKS 4JYUH 1G8GA 4Q19A 1UTJA 1EB1H 3RXEA 1BBRE 1QL7A 2F9MA 3TGIE 1LF5A 5FL3A 4DLZA 1GBDA 4NL4H 4RFSB 2QE7A 4OBEA 3HKIB 3LC3A 1XCGB 3CIOA 2KBEA 1E4VA 1MUEB 1VHTA 4DVGA 4I8HA 2Z6VA 3CB4A 3E2IA 2DWPA 4PC2A 5A8XA 1PPFE 2OINA 3DZ8A 4MPVA 1QL8A 2C2HA 2P3SA 4AIIA 1VZQH 2IEZA 2G51A 1FY3A 2Q1JA 3KB1A 3BEUA 4WA7A 4H9GA 4TSFD 4RY2A 1NROH 4MRSA 3Q76A 1DANH 2ZJ2A 2NTYC 3K0CC 4LOAA 1IXZA 4G5GA 2BY5X 5JCZA 2F3RA 1A2KC 4NWLA 1OJLA 3RSLA 5FUVA 4ABFA 3LGWA 3CKLA 2REBA 5FOUA 3EZ2A 3RMOH 5EXPA 2CJWB 2MMCA 4BXSA 4RZXA 3A86A 1FMGA 4ERNA 1II8A 5LPFA 2GBLA 2PEYA 1ZMXA 2G3YA 4B44A 1DSTA 2PCLA 1FZZA 2G6BA 5ELXA 4FMBB 3IHWA 3PV0A 1J15A 4PANA 4AK9A 4IDNA 5GIBA 3ZZCA 4BASA 1MO4A 3WYFA 1NFWA 3QX5H 1YPMH 4FUHA 2J59A 4X8OA 4K8BA 2A4OA 3RS4A 1RIWB 2NO6A 5DISB 4NZQA 1VR1H 1MZDA 3ZZ8A 1GI2A 1TGSZ 3A85A 1UPTA 1NY5A 2IX3A 4JLNA 3W5IA 4NYIQ 4BQSA 3OESA 1FQ3A 4Q7XA 3KQDA 3RS3A 3H7OA 5FCKA 3CF0A 5DP3A 3JVVA 1E2DA 4LYAA 1F0SA 2FIRH 4ZCIA 2FEMA 2F1RA 4TLAA 3ZGXA 2XWBI 1M34E 4MGKR 1NPMA 3SNBA 1AKEA 3RS5A 3OSYA 3K0FA 3RXHA 2QE7D 4OJQA 2QXGA 1AIXH 1II9A 3HP1A 4CZ2A 1ELTA 2O9QA 1O38A 3LNCA 1R7RA 4C0HA 2VHJA 2FGJA 1SOTA 3SHFA 2C96A 3Q7PA 3V7TA 1GTVA 3BTKE 3RM0H 1BHXB 2PEZA 2EQBA 3QI2A 4YTAA 1P12E 4NCHA 3PMHB 2C99A 1U8AA 4M9QA 1B7XB 1EWQA 2CBZA 2KAIA 2PLFA 2FH5B 4HAVA 1VDZA 2PTCE 4Y0ZE 1SGQE 4A1XA 1MV5A 5D3MB 1KYIA 2OZEA 2WVJA 3QQ5A 4I8LA 3BS4A 4ABEA 1GL9B 1E9DA 5C67A 3UQOA 5FPYA 1C1PA 3STIA 3A1WA 1G291 3RSOA 3KXLA 1OOKB 1AY6H 1E9BA 1SGWA 3QWCH 2Q6GA 3KGPA 4AB9A 1Z22A 2HV8A 1N5JA 3CX8A 1HQCA 5EXMA 2OXCA 1XJCA 2QGZA 2FOFA 3ADDA 4O3TA 1CR0A 1LS1A 4DT1A 2HNTC 1LFDB 4NU0A 3LW7A 4C7OA 4MDSA 3EXAA 4D0GA 1UTOA 1N5KA 1C2KA 2XBWA 4KU4A 1QBNA 4AYXA 1OKKD 4LK2A 4JYTA 5DKMA 3QZRA 1NMYA 2VO1A 4EFMA 5L30H 3OTJE 1KJWA 3SBKA 1CT2E 1SGFA 1ODFA 3KCGH 3MFJA 5BPEA 2OTVA 3I78A 4GHTA 4HB4A 4P3YA 5FX6A 1ZTLA 1GAJA 1GBBA 3X1WA 1AI8H 3M61U 2GGVB 3OE7D 1N8OC 1WAYB 1TYNA 4MGIR 1MH1A 2ZI5A 3SW2B 1XJ0A 1ZD1A 2QM8A 3B13B 2NPFA 3I73A 2ULLA 1DAGA 5CHAC 4CEIB 5FH9A 3L0OA 1D3QB 2H16A 3RXOA 2G9NA 1R2QA 2BMGB 2ZTSA 2ZWLH 2XSZD 5E95A 4G5OA 1JNYA 2IUUA 2ZJAA 1Z6JH 3PEUA 3DFLA 1MD8A 5J4VA 2PKAA 3QXJA 2IT1A 2QIQA 4YT6H 4MGZR 3RRNA 3AAVA 2JGNA 3AP2A 4NIWA 2UUKB 4GPTA 3QPUA 3Q72A 2JH0D 2P3UB 5KSOA 2FZLA 1LF0A 4J0QA 1K28D 3MRSA 5HCNA 3NBYC 3F5FA 1K1OA 1QL9A 3SGAE 3SJAA 2XXAA 1NRPH 3M7TA 5HZHA 2IYTA 4Q7YA 2XBYA 1O5CB 1XWIA 4W5WA 3PLBA 1AU8A 1W8BH 1XFAA 1T8LA 1X1SA 1ZINA 1RRGA 1Q2WA 2H2ZA 2BMDA 3GY3A 4HB0A 1YKSA 1QG2A 1SQ5A 3WNCA 3R9XA 2F43A 1QRZA 4HDQB 3DA9B 4CRWB 1P6XA 2NO1A 3NHAA 2BOKA 1MAXA 1QVRA 4AC9A 3S9AA 1US8B 3ZVCA 4URYR 2GESA 5DG6A 1ZUHA 3P17H 1MKXK 4TTQA 4C9BA 1DE7H 4PR0A 1II0A 2P6NA 4FXPA 2V8OA 2ZHFH 3IILA 4KHZA 3TH3H 1TPPA 1DAIA 4LPKA 4BEBA 3TUZC 4Q4JB 2VWNA 2ZNKH 1O3AA 2HT6A 3QEJA 1C2LA 5LD2C 2BEJA 1CJKC 3VQTA 2YOGA 2JETC 4US1R 4UNPA 1Q1ZA 1O2ZA 3NH6A 4HLDA 3UMFA 2R44A 2ODEA 3PEVA 5DI3B 3ASYA 4F93B 1RFLA 1P02A 1HJAB 1MTNB 1ZM9A 3WYAA 1V2RT 1W7AA 2DFKB 4D0LB 1G3BA 1CU1A 5GXPA 2ZRFA 5BQ5A 3MWIU 2Y8EA 2DB3A 2F9NA 2OCAA 1O2MA 1G19A 3T28A 2ZEBA 5IDVA 3E5HA 2AIQA 2ZF0H 4QG7A 1DOJA 1XEWY 4B75A 4Q9IA 2AL7A 3K6YA 3PIRA 3GDUA 4IBLH 2HPQH 1P72A 3NH9A 1TMKA 4MYHA 5JDUB 1NT1A 1Z06A 4F4OC 1OSNA 3CX7A 1YZTA 3WY9A 1DXPA 5KUTA 1SGRE 3EIEA 2QP4A 1WCV1 4I7YH 2A4RA 2ERXA 4RKEA 1O2NA 4E03A 1ZIOA 1ZM2A 1AKSB 4NA9H 1CR4A 1DELA 1TQ7B 3ZVRA 3RWOA 3LQQA 2XCNA 2FFQA 1T5LA 4IKEA 1Q3TA 1FX0A 1M7BA 3ZLJA 4R9UC 3SQWA 1CIPA 2WSSA 1TRMA 4Y7BA 1L4DA 4M9XA 1JXMA 4M2LA 4WVPE 3SU1A 4BAHB 3TJUA 3JZ1B 1TOMH 1EPTB 1P9UA 3IIJA 4BFXA 2IYSA 1R6BX 4XOIA 3UOPA 1IXSB 1SVMA 4BWYA 2A2ZA 3MJHA 3CLVA 2BD4A 3UIEA 1F0TA 1GHWH 2QTFA 1Z71A 4D7GA 3TVJB 2IUSA 1GDUA 1GBKA 1Z8RA 4BAQB 5E3HA 2V6IA 4K81B 3R8CA 3A1UA 1G36A 1YC0A 2OLGA 2ZS8A 5JRJA 2VIIA 4MRNA 2BKEA 4C0SA 3LGYA 1PYTC 1W5SA 3EZ6A 2VNTA 2BOHB 1PFXC 1BRUP 4G1UC 3AVZA 4IGDA 2EI6A 3NXPA 2HXSA 2QEQA 4P4UA 3ZQJA 2DHRA 1CO7E 1OP8A 1WXQA 4CGZA 1D8TA 4I99A 3PEYA 1SQAA 3LQRA 1Z5ZA 1GHYH 1Q1BA 3RU4E 4C0JA 1GHAF 2GD4B 2QAJA 1Z8IB 2BVXH 1GI1A 4WXPA 2QAGA 3TJOA 1EX6A 4TYNA 3WBJA 2O8MA 2CGAA 1GHBG 4JK6A 3HR8A 3QKRA 3RS2A 2XTMA 1NU7B 3SNHA 4TMKA 3A1SA 2IYUA 2AWOA 5T3HA 2F9UA 3FZZA 1IQKA 1GKYA 1OP0A 2O8FB 4HTCH 3B82A 4QBHA 4JBXA 4RD1A 2Q9AA 1SPJA 3NBZC 2ASUB 4PAQA 4AG6A 1Z8FA 1G9XA 2YVUA 3OEED 2ZDLA 5L8VA 3OFND 1TONA 4GRAA 5JS7A 1DUEA 1X86B 3SGBE 1F2SE 1SXJE 1IHSH 1RC8A 3N7OA 5JWOA 3PB1E 1N5LA 2OEPA 4K69A 1E2EA 4KVAA 2J94A 1WF3A 3MFYA 1O87A 2FG5A 4A0RA 1CEEA 3UG6A 5CJPA 4HLUA 4JVNA 4NZYA 5C5OA 2J87A 2OLJA 4KXFB
chains in the Genus database with same CATH superfamily
1AWHB 1P2IA 4WOCA 5AXAA 3UBMA 4C76A 3RAEC 4RELA 1JWTA 1J0DA 1EZQA 3L6EA 1W4AA 1BD3A 1GBEA 3AK5A 2C5HA 3LRTA 3GT7A 3PG5A 4MH0R 4F55A 3S9CA 4RK0A 2YNBA 2ZI3A 3F71A 2WY2D 3SQLA 3ZS8A 3W4IA 1ZRKA 2F6RA 3SPXA 3KJXA 3R0XA 3NHPA 2PKXA 1MVOA 1OFUX 2OE2A 1KIGH 1CR2A 3WYGA 2B2XA 4YP6A 3OIVA 5BW8A 2QT9A 1R4NB 3I62A 2R6ZA 4Z1MD 4NYMQ 2JI4A 4FR5A 2PPLA 1NFXA 1Z15A 3DJFA 3JD2A 3KK0A 1WU8A 4GMXA 4KR7A 2CUTA 1XTQA 1YYY1 4JCOA 2GD6A 2YTZA 3H3JA 1WVIA 3OE4A 3RADC 4FD3A 3DNMA 1QRWA 1NW5A 2H92A 2JEYA 3N2LA 1F2TB 4IPTA 1I7LA 1M34B 3S2IA 5IZCA 3P0RA 4MEAA 4L4XA 2PUFA 3FVVA 1FVXA 1HRTH 2G9UA 1E4YA 4TL8A 1U0EA 3S68A 1QQUA 1USIA 1U6IA 3Q6MA 3VU8A 5JPDA 1TJPB 3D65E 1XVTA 2GZRA 2W8BA 1H94A 1T8TA 2WG2A 5ALLA 4X1QU 2IYZA 1TCCA 3BQ9A 3RF6A 2WYUA 1P2NA 3ADKA 3FYUA 2C8VA 1F0RA 2L18A 4L2IB 1EKBB 4LRWA 4GQAA 2G70A 4PCUA 4RI0A 3H84A 3V80A 1JR3A 4AQDA 3LJOA 3I8SA 4B2BA 1HSZA 1Y9EA 3IKVA 1BDIA 4M1KA 2ZU6A 1W35A 3I9FA 3A7VA 5A4IS 3G5AA 4MYTA 2H4YA 4QHYA 4I4TB 2JIZD 1HV8A 1SUSA 2DJIA 3BUSA 3SR0A 4XM2A 1U3TA 4LMRA 4NMWA 4UAJA 1QHFA 4JH0A 4B47A 1T8NA 2EL9A 3JQQA 2XXLA 1NBOA 1VKHA 2FF5A 4L75A 5D8DA 4JGBA 1XEXB 4GFDA 1FW8A 4BECA 4DR2B 3MLEA 1I5RA 3OD5A 1H2ZA 4LOJA 2FWRA 5LIRA 1HF3A 3A2MA 3GXOA 1K7YA 2YHIB 5DYIA 3A2KA 3TB6A 2QL9A 1N6OA 2GJ9A 4J1TA 4MCJA 2Y93A 2R8ZA 3DV9A 1ECBA 5IHXA 4EFDA 2JH5D 1C1XB 4JLMA 3FO8D 2A5FA 4Q18A 2ZUFA 2YIVX 1PEDA 2NUBA 1F38A 4LSWA 1ONBA 3I92A 3NCHA 5NULA 1FEZA 4RMJA 1ZW1A 1OX5A 2VJDA 3CH5A 4KO2S 1UPFA 3AF4A 3AV0B 3DMHA 4RNDB 2OA0A 3W8NA 4FJ2A 1N32B 1J8QA 3MWLA 4Q1AA 2XCOA 4HQKA 3ME5A 5BOSA 4XWKA 2ZIVB 4PLHA 2AD5A 2P0AA 4M9SA 1RADA 5EPYA 2WTNA 3QMPA 2ZVPX 1Z6EA 1MVLA 1T9KA 2A5AA 3LPAA 1AHNA 1X7XB 4NE7A 1S96A 3CMCO 3TR0A 1X0XA 1J39A 2O19A 3CX4A 1L4YA 2ORIA 2QYTA 4JC0A 1T9GS 2CMYA 2E3JA 3GRAA 5AO9A 5EIBD 5CB4F 2P35A 4OJKA 1SOUA 4WXEA 4X94A 3FNEA 4UM7A 1C5PA 3IUSA 3NM5A 4LISA 3W5DA 3SOZA 2JNWA 2CHVA 3AZOA 1W1UA 5AIBA 3MJ4A 3FPGA 3S69A 4D96A 1HAVB 1G7SA 1YTLA 4QBGB 4UJ3A 2G4UA 4UHKA 4NDAA 3NGMA 2PLRA 3C0KA 1STOA 3NIGB 4GLBA 4LAFA 5ELLA 5KYVA 3UGQA 4NLLA 5C53B 1R1DA 3KUDA 3BZWA 2LBPA 3EWIA 5G0WA 5A06A 2Q8PA 3DMFA 2GR9A 2Z3VA 2ZYDA 3WHKA 5EAIA 3KQWA 3FNRA 5FLEX 4ARZA 3QXHA 3I0MA 4K0KB 2R6FA 2WF6A 1QJ7B 4NA7A 2OXIA