4B8ZA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, rhombohedral crystal form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
MRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-FUCOSE SYNTHASE
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Rhombohedral Crystal Form
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8zA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8zA02
2P9CA 1UJMA 4FGWA 3S2IA 4OXYA 4L75A 4WPGA 4BNMA 3GAFA 4E2ZA 1T1RA 1FDUA 3TDKA 3DMTC 3GFGA 1XIVA 4A27A 2RH8A 1MB4A 2EP5A 3Q0EA 1DB3A 4OM8A 5DBGA 2I66A 1QORA 3LQFA 5GZ1A 4PLTA 3I9NA 1EVJA 4XEHA 3QW2A 3HNPA 4OXKA 4CLHA 1Q7BA 3GPIA 4L9RA 3D64A 3GOHA 3NV9A 3C1TA 4KTTE 3RC1A 4JIGA 4HNHA 2Y99A 4LN1A 2BELA 2ZIZA 4NHEA 4BNGA 4E31A 1GUFA 3W1VA 3C8MA 3V1UA 4BIIA 2FMUA 2HK9A 1LX6A 1PWXA 2VWQA 3WGOA 1GYRA 4ZD6A 3JQBA 3WGQA 1I2BA 3RVDA 3FWZA 1VLLA 4BO2A 1RM0A 4BNYA 2EJVA 4GX2A 1E92A 3EHEA 1GV1A 4G5HA 1YH3A 3N74A 5KTKA 2C7GA 4XR4A 1DPGA 3P2OA 3AUUA 1L7DA 4XDZA 1Z75A 2E4AA 3E03A 3KO8A 4J91A 3PWZA 5K6AA 3AFMA 3WFJA 4KDFA 2X5KO 4DPMA 2B4RO 3DHEA 1FMCA 4CM9D 4M1QA 4DLBA 2GN9A 3GVCA 5ER6A 1ZFNA 4XX0A 1HEUA 1CYDA 1AGNA 4Q3CA 1T24A 4IZIA 1H6AA 2PNFA 3VTZA 3PZBA 4BO8A 2QZZA 1NXQA 4FGSA 3H65A 3K92A 3GUCA 4YJFB 4D45A 1OMOA 4MIEA 4LMRA 1N5DA 4BHTA 4Z3KA 2IZ1A 4R4JA 3BMQB 1T1SA 1Y5MA 4A5OA 5JCJA 4BV8A 4CMEC 3MCVA 1SO8A 3MEQA 4E2YA 2BHLA 5IF3A 1ZEJA 4AJIA 4EEXA 4Z6KA 1T2FA 4WE3A 1O8CA 1H6CA 3W8FA 3U4IA 2R2GA 2ZB7A 4PIVA 2P4QA 3DZIA 2CNBA 3ZNQA 1I01A 4R1TA 3X2FA 3LT2A 1AN9A 4MOWA 1WMBA 2J3JA 1QG6A 4Y67A 4U7WA 1XR3A 3T7EA 8LDHA 2WYVA 3DDNA 4J3FA 3CINA 2PGDA 4B8ZA 4B3HA 2H9IA 1ISMA 1ZCJA 3KB6A 4YAJA 2W2KA 2FHSA 4F45A 3FSRA 1ZK2A 3GFBA 4YBZA 5A02A 4ZJUA 1U7TA 2SCUA 4PG4A 2EW8A 1EEHA 1QXSA 1UH5A 1V6AA 3VH2A 1LDYA 5L9AA 3F5QA 3SC6A 1BWSA 3SEFA 3ZN2A 2HAEA 4BO0A 4CQMD 3JTMA 1T4BA 2CD9A 1DRWA 4IDGA 4CM8B 3PLNA 3H9JA 4P38A 4YCAA 2AQHA 2E82A 4RL6A 2QHXA 1I36A 1IOLA 1B7GO 3MJSA 4QT0A 3AM4A 4AJEA 1VL8A 1GTMA 3RC2A 4NJMB 3V2GA 1HSZA 1Z7EA 2HUNA 3SVTA 2J5RA 5TS3A 1PQPA 2Q2QA 3CIFA 4BMNA 2ZYAA 5JNLA 4HFNA 1AHIA 2X22A 5C7OO 4B4UA 2VOEA 3KLPX 1PJLA 2Y0DA 5A03A 2EW2A 2JL1A 3OA0A 4FOSA 3UOGA 3B6ZA 3W4IA 3DAPA 4EW6A 4JX8A 1VKNA 2GNAA 3AY3A 1OFGA 1XDWA 4PVDA 1BXKA 4JJFA 4I5GA 3JV7A 4HY3A 4YWJA 1HDXA 5L51A 3GF4A 4DYVA 5L40A 5KVVA 4XB2A 3H5RA 1V3TA 3A06A 3KYDB 4MO2A 3NDRA 2BI7A 1WPQA 3RU9A 4U0KA 4CMBA 1GPDG 4L74A 3K2BA 2Y1DA 4CM9A 4ND2A 1V35A 1V9LA 1X15A 1SB8A 5H83A 1E1KA 1KEVA 5JCXA 4I5FA 4B7CA 3HSKA 2D4AA 1C1DA 2Y05A 4WASA 4GGPA 3W8DA 1Y1PA 3Q9NA 1MXFA 3I3OA 2VWHA 3VH1A 5KJ1A 1ZXLA 1YBVA 2YZ7A 1N92A 2YW9A 1U28A 1U7HA 1XYGA 3NTRA 4FFMA 3WGTA 2AG8A 3F46A 1B26A 3MTGA 4OH1A 2VUTA 5T57A 4J0EA 4ALNA 3DZFA 1O89A 4R54A 1KERA 1YL7A 4GSLA 1DOHA 3WQSB 4JBIA 5AXCA 3GEMA 1YDEA 3RBZA 1C0LA 4N18A 3GG9A 3U4CA 3PQEA 3JYQA 4B4VA 4DIFA 4AJNA 4CL3A 2P68A 1GEGA 2FR0A 2NTJA 3LC2O 3JQFA 3P7MA 2A35A 4IDAA 4NBTA 4EGFA 4E30A 4OSPA 2H5LA 1WAMA 5CG2A 3FI9A 4Q3DA 3VPFA 2QRKA 3VC7A 5T8KA 2ET6A 1RJWA 1T25A 3FNHA 5A5FA 3KHUA 4YVFA 4MP3A 4E6PA 3D5QA 1HL3A 3FBGA 3LF1A 5EL0A 3VPGA 3AU8A 1AXGA 2WEKA 3ICCA 2A92A 3ZWCA 3JQAA 3H9QA 1P1KA 3NT4A 3KXDA 3PI7A 2YV1A 3M2TA 2WE7A 3RSHA 4G81A 2GYYA 1JWAB 1I3LA 2O3UA 2DFVA 3F3SA 1DHRA 1B14A 2XOXA 3LK7A 4MVJG 4JGBA 5L53A 3NGLA 4CUKA 4ROSA 3DAGA 1EUDA 4E5KA 4N5NA 5THQA 1E6WA 4WEQA 2Q3EA 2QQ5A 4E33A 5C5IA 1PZHA 1M76A 1R15A 3C1OA 3K5PA 4PLWA 3RUDA 1E3SA 3ZU5A 4G65A 3MOGA 4I1IA 3QWIA 4BNTA 2B4QA 2VWPA 2X4GA 3CZMA 3JYLA 2C5EA 4WOJA 4I9NA 2NU6A 2JHGA 1J49A 4EBFA 3A4VA 3ANNA 4KP7A 1PJ4A 4DC1A 2DBVO 1U5CA 1N7HA 3DMYA 1C1XA 4IJWA 5JO9A 1M75A 2Q2WA 4HFMA 4M86A 3ZDFA 2EEZA 4YJGB 1PGQA 4WLEA 1QV6A 4RDHA 1PQUA 3WG9A 4J6FA 1OZAA 2GZ3A 4H3VA 1YJ8A 2PH3A 3Q2KA 5L3ZA 4J4BA 4Q3NA 3VH3A 2GSDA 3KSZO 1P0FA 3QSGA 3OICA 1WZIA 1LUAA 2O3QA 3KSUA 2FSVA 1DFGA 4IDFA 4R1SA 1ULUA 1TT5B 4QXMA 2GDZA 1V3VA 3ONEA 3TF5A 4WECA 2BGLA 4CR6A 1Z6ZA 4LVCA 2BMAA 4NU5A 3PGJA 3MJEA 1T2AA 1TEHA 1Y8RB 4R68A 1GCUA 5FI5A 3JQCA 3IJPA 5ES3A 5JPIA 2VTDA 2AW5A 1BMDA 2FR8A 4RF5A 2WYWA 1P1IA 4YJHA 4XA8A 1A4UA 1DIHA 2CF5A 1Y8QA 4LRTB 1UZLA 1DBVO 3PHIA 3PJFA 5A4DA 4IJVA 4CQLB 2OBNA 4O1MA 5G0WA 3VDRA 1XCBA 2D1YA 2JCVA 4CMKA 3RWBA 3I23A 3AM5A 3VVCA 1FDVA 3O26A 2OMEA 1NYTA 4CJXA 1U3WA 5COAA 4D42A 2DTDA 2Q1TA 3GDOA 4JJGA 4XCVA 1TXGA 2X1HA 4P22A 5ICMA 3L07A 4KUGA 1PGJA 3I4FA 1BW9B 4FR5A 1I24A 3RROA 3HB4X 3N58A 1UXKA 1V3UA 1LSUA 3K8ZA 3ZHBA 3WSVA 4FDAA 2PKQO 2AMFA 4JBHA 4ND1A 5CHEA 4QO8A 4FJ1A 3M2PA 3OQBA 3BAZA 3NYWA 4PZDA 3UUWA 5K6AC 4KQXA 3TZQA 2Q2VA 2WTBA 3M1LA 3VHRA 4Q3EA 4QECA 4BL5A 5FEUA 2Y1OA 4OIMA 4R5MA 2DTXA 1E6EA 1A9YA 2Q1SA 3LVFO 4B3IA 2I9PA 3NJ8A 1N1EA 4HBGA 4L0QA 3HDJA 1DIAA 1RPNA 5EQDA 3ZW9A 3DFUA 1T2DA 4I5EA 4CV2A 1R4MA 4IIUA 3BMCA 2Q4EA 3BMNA 3NT5A 4GAEA 5BT9A 3ZU4A 3WGGA 1UP6A 2VYVD 4JP2A 3PLRA 4YJDA 3FN4A 1F12A 4II2A 5HA5A 3T7CA 3LDHA 2HCTA 3W4JA 3ZGYA 2HK8A 3UGKA 2DBRA 3DBRB 1JKJA 2TMDA 1S6YA 1QLHA 3KEQA 2X86A 3FTPA 4R16A 4IJUA 2YUTA 1KVSA 1PTJA 3FR7A 3ON5A 4NQZA 3DC2A 2W2LA 3VZRA 5EINA 2GERA 4O59O 5GZ3A 5B4VA 1U4OA 1ADBA 2P9GA 3GGGA 3T4EA 1JDJA 4A73A 3ADPA 1D4FA 4HWKA 2YHIB 1LLUA 5J23A 3DBHA 5ICSA 3QVXA 3UCXA 3VKVA 1DDOA 3OQ6A 1LNQA 3H5AA 3M1AA 3HADA 4ND5A 4RO0A 5A05A 1LJ8A 4F6LA 4K9DA 2DBQA 2HRBA 1DC6A 1Y81A 3BMOB 1P1FA 4U6QA 3GPDG 1HE4A 2ZKLA 5IDQA 1LRKA 2VYND 5CPFA 3V1YA 3PK0A 1Z45A 3ZH2A 5JXWA 3SLGA 3HDHA 3HN2A 2CF6A 3TOZA 1N8KA 3L0DA 4D79A 4WNIA 4F46A 3ETDA 4TZKA 1BG6A 2WD7B 1UZNA 5MGBA 3I9MA 2PZLA 3WR5A 1LBEA 5T67A 1WVGA 4RZHA 4OQYA 2EKLA 2ZYDA 4KQWA 4BUCA 3UW3A 5TSDA 1U3VA 3HB5X 2AEFA 4DIBA 4MDHA 4UREA 9LDTA 5KNLA 4FS3A 4GLOA 3MJTA 4JLWA 1X1EA 2XPCA 1V0JA 3KYCA 3Q3CA 5FI3A 4XDYA 1YOVA 2IRWA 1M6WA 1BDBA 2ZATA 4PG6A 1YL5A 3BYZA 4JP3A 3INTA 2AXQA 2H6EA 2EJWA 5TC4A 3SX2A 4IY1A 4WLVA 4UEJA 4J9VA 3NAQA 4EYEA 1MUUA 3RI3A 1PGPA 1PS8A 4JQCA 4WEOA 4NFSA 5C3MA 3OP4A 3PFWO 1B8UA 3RUEA 1EQ2A 2O7SA 2V6GA 3ZCXA 3LT4A 4XJSA 1ZZEA 2VRCA 3L9XA 2NVUA 4MVJF 4PCVA 3ZHZA 1GL3A 3O8QB 3WGHA 1PJCA 3PIDA 2GN6A 3I83A 1F0YA 2BI8A 2EHDA 3PQFA 3V2UA 1DC3A 3ZNNA 3UFXA 1UAGA 3ADOA 3KVOA 4DWVA 4BO7A 4HKTA 1I30A 3QIVA 4BNWA 4CMJA 3DWFA 3G0OA 5KIAA 1KVQA 1HLDA 3AI2A 4J43A 4Z0PA 1YQDA 3HE3A 1DFHA 1VM6A 4UVDA 4ALLA 2DVMA 3JQ9A 2B4TO 2R00A 1X13A 1PR3A 4M54A 5CDYA 1YXMA 4XRGA 1U2GA 4ZGWA 3WYCA 3ZZNA 3FPCA 1R0SA 1ZK0A 3BMOA 3PYLA 4LMPA 4WGGA 3ZV3A 1Q7GA 5F1OA 5IFLA 1E3IA 3P5SA 1NASA 4PGFA 3WGYA 2P9EA 4DA9A 3HHPA 2X9NA 4AJOA 1SEVA 3OFSA 4EJ6A 1BRMA 5IZ4A 4FW8A 3C7AA 5JAZA 5KVCA 1GR0A 3QVTA 3DZKA 2VT3A 3QE3A 2HJSA 4P4LA 1QV7A 3PJEA 4CM4A 4IDBA 2OZPA 4IS2A 1F17A 4OL9A 2RHCA 2GN4A 1UXGA 4PRLA 4OAQA 4OOEA 4WLFA 3L6DA 1EFKA 2NADA 4IXTA 3SXPA 2X5OA 1ZEMA 1UDBA 3BMQA 3L4BA 4D43A 3TSCA 4FC7A 4ILKA 1FK8A 4L4XA 2W2KB 4IPTA 1PZFA 1I5RA 2HJRA 3TL2A 3STHA 1TA4A 3JQGB 3OSUA 3ROQA 6ADHA 3PHGA 1EE2A 1PS9A 3GZNB 4DTIA 3MWEB 3FWNA 4Y6PA 5EERA 1KVUA 2PD6A 4BNHA 2EV9A 4Z3DA 4ALKA 3NX4A 1JVBA 2DQ4A 1YONA 1UZMA 4WLNA 4FFRA 3GRKA 3RIHA 3NRCA 5DOZA 5KWEA 4HV4A 3IP1A 1Q0LA 4FFOA 2AA3A 3UKOA 2AQIA 3GY0A 4JBGA 4NBRA 3E6AA 4GX5A 4FQ8A 5JY1A 3OMLA 4N5LA 3OJ0A 5FWNA 2AEMA 4D3DA 1T4DA 4DLLA 3GGPA 1D1TA 4QQRA 3WYEA 1MGOA 1ZMTA 3RKUA 4RPJA 2PK3A 3HUDA 1RM4A 1YWGO 3GHYA 4CM8A 4AJPA 1IPFA 1C1XB 4YAKA 1QKIA 1A4IA 1BHSA 1P1HA 1NHWA 2ILTA 3CE6A 4EITA 4NK5A 3E8XA 4BO4A 4YRDA 2CSUA 5G4LA 3VH4A 2HMWA 3A9WA 1HKUA 3FD8A 3RJ5A 4AJHA 1HYGA 4Y6RA 1IULA 3Q1LA 1HDRA 3HZZA 1QR6A 5HRUA 1SAYA 3GR6A 3TFQA 3DBRA 4TMFA 5G4KB 5A06A 2FY8A 1WXDA 2YY7A 4MP8A 2Q1WA 2PD3A 3L4BC 4DQVA 5JDIC 5JDCC 2VNSA 3JSAA 4PLZA 4B4OA 3GEGA 3DOCA 4I8XA 3EW7A 4E0BA 3WNVA 1DFIA 1ADFA 3H5NA 4TRNA 4ZN6A 3CPSA 4E3ZA 2P5YA 3ICPA 1EK6A 4XIYA 4U5QA 1O94A 4KDEA 4FFPA 3DTTA 5T8KC 1OBFO 2C20A 4RGBA 2G76A 3QV1A 2EG9A 1IHXA 1LTHR 1NPYA 4PLYA 1Z82A 2YDYA 1OC2A 3DZBA 2UUOA 3LT0A 1IUKA 3PHLA 4BNVA 1B2LA 3D3WA 1EVIA 4BO5A 2WJPA 2CMDA 4PLCA 2RHRA 2AEJA 4TWRA 1GUZA 1NWCA 4KWIA 2Q46A 5BSEA 1ENPA 4BB5A 3EAGA 1GV0A 3MJCA 3R0IA 2HMVA 4CM3A 2C59A 3GNTA 4CQMB 3NGXA 2DBZA 1QYWA 5JO0A 3WNQA 2A94A 3QRWA 3OJOA 3SJ7A 3H8VA 3OBBA 1XKQA 1VI2A 4OMUA 2ZQZA 4A26A 2FR1A 3GA0A 3GN1A 4J9UE 3MTJA 4RORA 4WCFB 1X7DA 3K30A 4L73A 3LZ6A 1DAPA 3CZRA 3OETA 3WTBA 3TPCA 4AJLA 2UUPA 4CMIB 3ETGA 5EMHA 3A1NA 3C7CB 1ENZA 4XQCA 3W8EA 2IYPA 5JAQA 3E5MA 4Q3BA 3U9LA 2PGLA 3WTCA 4JK3A 4NU6A 1Y9EA 2PA3A 4GMFA 3ORFA 1MX3A 5JLAA 4QEDA 1HE3A 2ZCUA 4URFA 4FBGA 1GZ3A 3E18A 1Z73A 3R3JA 4RF2A 1IHYA 2BGKA 2UAGA 4IQ0A 4J7CA 5TNXA 4E2WA 3G17A 3OJFA 4H7PA 1DRUA 1H94A 5U4QA 4B3JA 2AQKA 2EXXA 3B20A 3UF0A 1WDKA 4YJGA 5DP2A 4FFLA 5ENVA 1L1FA 2C0CA 1KY5A 1AUPA 4XWYA 3OHSX 1MLDA 4RLHA 3COSA 1EDZA 5BNIA 4NH4A 4RPLA 1UAYA 3S2EA 1ZUD1 5F3RA 1HSOA 3ANLA 2P2SA 5CDGA 2O50A 2ZTMA 4RF3A 4YA6A 3PQDA 3ZWXA 1I32A 3HJAA 4XQ9A 2WMDA 1E6UA 3BIOA 3FNFA 3SBOA 1OI7A 2PKRA 2O2YA 1KEPA 4L4SA 3A28A 2Q49A 1P31A 1Q1NA 2NQ8A 1YBMA 1RWBA 2ZTUA 3R1IA 2IZ0A 4B7XA 5KKCA 2NWQA 3TOXA 1CWUA 2OORA 4LCJA 4K6CA 1ISFA 4FN4A 3HFGA 3ABIA 1SOWA 5JC1A 5DCYA 4ALIA 4EDFA 3K73O 4XD2A 3NTOA 4YQZA 2VYVA 2CVQA 1HTBA 4UEKA 2C82A 3K2EA 1X7HA 4OJNA 3NTQA 5KVSA 1KVRA 3U3XA 5AQ1A 4YDRA 3NKLA 1M2WA 1O5IA 5I7EA 4DIOA 4U8GA 3BTSA 1PZEA 3IP3A 1YVEI 4J7UA 5KKAA 4GQAA 1LLCA 3DQPA 4CMGA 5GY7A 4Q39A 1H2HA 4IBOA 3QVSA 3IUPA 1R6DA 4OO3A 3VAZA 4IIVA 3DHYA 2F1KA 5F5LA 1Q7CA 3ZU2A 4Z9XA 3ULKA 4E13A 1A7AA 1LSSA 3ZWOA 4CMEA 2BRUA 2QYSA 3RC9A 2VQ3A 1BW9A 2PFGA 1SCUA 5LDGA 2YHUA 5KVQA 3AU9A 2D0IA 5G0VA 2RH4A 2Y66A 2NNLD 1NFRA 1JAXA 5HWSA 2Y93A 1J0XO 1ZMOA 3AW9A 4WLUA 2QZ9A 1XHLA 3ST7A 1R66A 1E7QA 1QYVA 2B0JA 1HETA 4E12A 4FJ2A 3E9QA 1QMGA 3HQ4O 2VZ9A 1A9ZA 4PLGA 3OA2A 4TVBA 4BNKA 4RV9A 5A3JA 1YDWA 3B1JA 1S7CA 5THKA 1YQGA 3TN7A 2PR2A 1XA0A 2WE8A 4D41A 4KUHA 2VUUA 3KYDA 1T2CA 2J6IA 3DXFA 4XRRA 1ADCA 3K6JA 3V2HA 5LDHA 2NLOA 1K6XA 1UP7A 4YEDA 3OJEA 4UVEA 2RBEA 5FYDA 1P3DA 1JW9B 2GZ2A 4N5MA 2HO5A 4RVSA 4R51A 4RZIA 4XB1A 2O3RA 1IB6A 3BZUA 3G1UA 1WMAA 5H82A 3EYWA 3MJVA 2EERA 5KJFA 5EN4A 5F1KA 3L6EA 3FNGA 3RFTA 4BMVA 4YACA 4UUPA 3GZ4A 4XIJA 2HK7A 5BSGA 5HS4A 1PJTA 3UCFA 2J3HA 1WW8A 4RJTA 2I99A 3EDMA 2PTGA 4PZEA 4W7HA 1U4SA 4QSMA 1W8DA 3PWSA 1BVUA 4MKRA 4R69A 1MG0A 4BKOA 4RQUA 4PG7A 1DAOA 4O5OA 4MJLA 3NJ4A 3G79A 3JQ6A 4J1QA 4DQXA 4W99A 1E3JA 1I33A 2E6UX 2JD2A 3FF4A 3QWFA 1KEUA 3EK2A 3Q9UA 4XQEA 4YRBA 1PJBA 1CQIA 2C5AA 1NX6A 1C3VA 4LRSB 4BO9A 3ZV4A 4CQLA 1LQUA 1QSGA 4A0SA 2AE2A 1XWFA 1NBOA 1LSOA 1GQ2A 2Z95A 3JD3A 4ZHSA 2IDZA 1E7SA 2Z5LA 3GVXA 4J4HA 1IY8A 4DQUA 4W7IA 1WZEA 2HKIA 3WX0A 1ZSVA 2EGHA 1CEQA 1KETA 4NNJA 5TT0A 1E7YA 1KIFA 1QYCA 1U3TA 5F1PA 3LC7O 4ALJA 4BKPA 1CIVA 3H4VA 3AK4A 4GVXA 1P9LA 1NR1A 1PZGA 4MVJI 1XELA 2FWMX 3GVHA 4GGOA 2JAPA 1GU7A 3KYCB 1ZKMA 2OO5A 3WGIA 1GD1O 1AHHA 1K5HA 3D4OA 1MXHA 4MKXA 4E32A 1RM3A 4INAA 2O2SA 4YPOA 1P44A 4GKBA 5JDIA 2YDXA 4ZA2A 1BVRA 1B15A 1KY4A 4A03A 3VTFA 1NAHA 4M87A 3AWDA 5TIIA 1YS4A 4WJZA 4EUFA 2NM0A 4ONEA 4BS9A 3F47A 3RAJA 1Y6JA 3H9UA 1EBUA 4GWKA 4LGVA 2DUUA 1VE9A 4D0RA 2OP0A 3ROKA 2HMTA 3JQ7B 3LC1O 1FDSA 3Q11A 5MDHA 1EFLA 1GDHA 4AJJA 1UXJA 3EZLA 1U2DA 4XYEA 2VWGA 1MA0A 2X58A 3I5MA 5I7FA 4H15A 1WWKA 5IDYA 1GZ6A 1K0UA 1R16A 1VJ0A 3CEAA 4CMAA 1A72A 4PG5A 4PN3A 2HU2A 1TT5A 2PWZA 2Q1UA 2VOJA 2YV2A 4P8RA 3AOGA 1U9JA 1GEEA 3LLSA 3GK3A 4TROA 3S1LA 4DUPA 4H16A 3AM3A 4BNIA 4B4WA 4BKRA 5A9TA 2WM3A 2HMSA 3NT2A 4ID9A 4YJHB 3RBXA 2ZTVA 4CM6A 2ZB4A 1CERA 1G6KA 1XU7A 4CUZA 4A10A 3VPXA 1RKXA 4CM1A 1PEDA 2D5CA 4BNZA 1HT0A 4K28A 2JKVA 1W0CA 1ZH8A 3FPLA 3JYPA 4BGUA 2JFGA 2O4CA 2PGJA 2PLAA 4IMPA 4OXNA 1ZBQA 1PU2A 5JYDA 1G0NA 3RUHA 3U49A 4ND4A 4D44A 1MFZA 3DO5A 3H2ZA 1PWZA 4YTEA 4IUYA 4G2NA 3DHNA 3HFSA 1DHTA 1I8TA 5ER9A 2QRLA 5U9CA 1SB9A 3WIEA 3GN2A 5A3VA 2Y68A 2UYYA 3C3XA 4ITUA 1I3MA 4ZQEA 1SOVA 1JA9A 5T6BA 1O9BA 4CMIA 1D7OA 2R00C 3R6DA 2OOSA 1VPDA 3WLFA 5JC8A 1I2CA 1ONOA 2RIRA 3O9ZA 3OJLA 1SPXA 3TWOA 3KBOA 4IXWA 1N9GA 1I0ZA 5IN5A 2HLPA 1VRWA 4KZPA 2NU8A 3GMDA 2A9FA 1Q2XA 4WKGA 4CUJA 1D1SA 3H7AA 4F6CA 1R4MB 4BQPA 1Y7TA 4MVJA 1UR5A 1CF2O 2X0JA 4AJKA 4PLHA 3IDSA 3O03A 4JJIA 5K9ZA 1XQ1A 1ZXBA 2D8AA 3PIIA 2I6TA 5JE8A 4YT4A 3AFNA 2JAHA 5JBIA 4XKJA 1NM5A 3CTMA 1EVZA 4YQYA 3K9QO 2CUKA 1GQYA 4GL4A 3RUCA 2GD1O 1LDBA 3IUSA 5JCJD 3AI1A 1WNTA 3BHMA 2NACA 3JQDA 1VJTA 3L6OO 1R0KA 4IM7A 4NDNE 4W6ZA 5DF1A 1LLDA 4RPGA 3WIDA 5BSHA 1TB4A 2AQ8A 2GN8A 3D5TA 3QVOA 4EJMA 2F00A 4ZRNA 2XXJA 4NMHA 1H2BA 1PX0A 4XGIA 4AL4A 1EMDA 4FIZA 3DBLB 2R6JA 3Q2IA 3PYXA 4K1LA 4KOAA 5IZCC 4PLFA 1YKFA 4NBUA 4CM7A 1LRJA 1PJSA 2VHZA 3IQDB 4HADA 4NBVA 2GRAA 3BHIA 3DR3A 1JTVA 2Y1EA 1CQJA 4PVCA 4YAIA 3EUWA 2JD0A 3PTZA 3NEPX 3ASUA 4CM5A 4IJKA 2YFQA 5B4TA 4J1NA 5JY6A 2G1UA 5L4SA 3DL2A 2P5UA 3ZWWA 4CODB 1PQWA 3P19A 3RASA 5CEEA 3JD1A 4DYDA 3B1KA 3U4HA 3WJAA 2Q4BA 1RYDA 4BKUA 1YGYA 2HMUA 4BO6A 1M67A 1XU9A 4Q3AA 4I9UA 2Y1CA 3EY4A 4MP6A 4NPCA 2OXIA 3PXXA 4KWHA 1W73A 3H9GA 1PL6A 1Y8QB 3KTDA 5IXYA 2GPTA 3I9OA 5I9NA 4C4OA 3GC6A 3UVEA 1JKIA 1N9GB 3D3WB 3I6QA 3MWDB 4I9HA 4UVGA 4WCFA 2PZJA 4BMSA 3JD0A 2YQ5A 1FDTA 1RM5A 2ZB3A 4ALMA 2VRCD 3R3SA 5COQA 1E77A 1FJHA 3IKTA 2BFMA 3OEWA 4A2CA 1NHGA 3ITDA 1H5QA 3PP8A 4MPDA 4PG8A 1ADGA 4KTVE 1ENYA 5HBRA 1WDLA 4CMCA 3PEFA 4IINA 2XXBA 2EWMA 1DC4A 4HNGA 1YL6A 2LDXA 3F1KA 1C0IA 2V6FA 1R12A 3C7DB 1NPTO 2G0TA 4CLRB 2QYTA 1DJQA 3HG7A 2DUWA 5KJCA 2NVBA 1HDOA 3WB9A 1ZJYA 4IDEA 1IE3A 3G49A 1OAAA 3EGOA 4TRRA 1U8FO 2PV7A 3VOSA 3RUFA 3S55A 3ZWYA 3IKVA 2OBYA 2NQTA 4E5YA 4TSKA 4UULA 2XAAA 2RAFA 3PPIA 5CAEA 2CVZA 3FTNA 3GT0A 3L77A 4XJTA 1Y9AA 4EUHA 3D4NA 1ID1A 5TLSA 2GR9A 1A71A 1UDAA 4YAEA 1A5ZA 1KBZA 4OKIA 2B37A 2DAPA 3OM9A 3TFOA 5L95A 1HYHA 3KRTA 3ITKA 4FJ0A 1A27A 1P74A 5I7VA 4WLOA 5F21A 4BQRA 4J7XA 5C37A 3WWYA 3GNQA 3ETEA 4CLXA 5IDXA 5EIOA 5CDSA 2DT5A 4IZHA 5FF9A 3QQPA 4OOFA 3ZNPA 1EVYA 2PD4A 3KM0A 3DOOA 5IDWA 2OUIA 2YV3A 4LVUA 4NK4A 4XYGA 3K96A 1DO8A 4MVJM 5G4KA 4XYBA 5KOIA 5AXAA 1D8AA 2XF8A 1MC4A 2X0RA 5B37A 1TLTA 3UICA 1B3BA 3F9IA 4IMRA 3ZWBA 4TKMA 3JQEA 3AJRA 5B12A 1M6HA 4WCDA 3IL2A 1HZJA 2X9GA 1YRLA 1HXHA 2VNAA 3H6KA 3I9LA 1X7GA 2FSSA 3PHHA 4DPLA 1UDCA 2E48A 1NVMB 4UEOA 2IE0A 4HFRA 4B7UA 3KZVA 2IODA 3DZHA 3OECA 1PSDA 4WUVA 4Y9DA 2X5JO 4QTZA 1PL8A 1H9BA 2GUGA 5G0TA 5DBIA 5F5NA 5A04A 3W6ZA 4BGEA 4ZU3A 5JMWA 3TJRA 2B36A 1K2WA 4IQ8A 4BNLA 4A7PA 3VPHA 4P4NA 3TZ6A 3V5NA 2PKQP 1PGOA 1E3LA 2O7QA 3KSDO 3QP9A 5TT1A 3DEYX 3D1LA 5JMPA 3PYMA 4GSKA 4OKNA 1G1AA 3ZU3A 4GX0A 2DPHA 4Z9FA 3TNLA 3KYBA 4HUJA 1ORRA 2EKQA 4C7KA 3WQRA 4M89A 5I8ZA 1H6DA 2GASA 4GBJA 3RQSA 4WCFC 1PIWA 2EGGA 5TQVA 4CR8A 3D3EA 3G3EA 3KLMX 4QFCA 1TVEA 4PZCA 3N7UA 3DTYA 4U6SA 1WLYA 4K6FA 4OSOA 1ISJA 1HDZA 4IGEA 3H2SA 4GWGA 5EQFA 5T5QA 1E3WA 2DC1A 4PRKA 2ZTLA 1HF3A 1ARZA 1NFFA 2D2IA 1OOEA 3E9NA 5JFOA 3JQ7A 5DCWA 1YB4A 5AXDA 2CY0A 3D7LA 4DLAA 4OYRA 1EBFA 2X8LA 1NVTA 3WJ7A 1PL7A 4XR9A 4E5MA 1GFSA 4P4GA 1XQ6A 4D7AA 3IMFA 2Z1NA 3GDFA 2DM6A 5AOVA 3ZWAA 1HDYA 2I76A 3PGXA 4RVHA 5G0UA 1NVGA 1B16A 5ITWA 2FOIA 1UP4A 2Q99A 4WK6A 1ENOA 5HS6A 3WS7A 1NP3A 2NUAA 4MIOA 5G2OA 1LQTA 3VPSA 2J3IA 1ONPA 1DIBA 1KOLA 6LDHA 5FFFA 4MINA 1KS9A 3CXRA 3RBVA 3JYOA 4C7JA 4EEZA 1KEWA 3UN1A 1C0KA 1ZNQO 2VHVA 3LYLA 2WD8A 3M6IA 5ILOA 3OIFA 4R3WA 5BNFA 2IYOA 3QA9A 3RJ9A 3RU7A 4DBVO 2UVDA 2C2XA 2X0NA 1JQBA 1U5AA 2Q50A 1SEPA 3JD2A 4RCVA 4GLLA 3GLQA 1GCOA 1GAEO 3DBLA 4J16A 4W9NA 5L7TA 5DDIP 4DL9A 2ZJ1A 4Y6SA 1SZJG 5JYEA 1H93A 3BXXA 1UXIA 5H81A 2W98A 3PVZA 1VC2A 1ZSNA 2IZZA 3BTOA 3NUGA 5COBA 5JAMA 4L8VA 3RD5A 2GLXA 2YFHA 3FCOA 3CMCO 2NU9A 4W9NC 5T64A 1F8FA 1TI7A 1F8GA 1KYQA 1QP8A 2WSBA 3AY6A 3HDYA 1HE2A 2O3JA 1HE5A 3AI3A 4CQMA 1XEAA 1R0LA 1GQQA 2G5CA 2BH9A 2VN8A 4BO3A 8ADHA 3DB2A 3ZV5A 5I9LA 1AXEA 3G1TA 3KV3O 1P1RA 3QVWA 1SMKA 1P1JA 1MFPA 3JQAD 2P4HX 2CFCA 2RCYA 4NFYA 4ZQFA 3OH8A 4RPKA 4TQGA 4YT2A 1E1MA 4QX6A 2E49A 3UH1A 4AJ4A 4CL8A 4EI2A 1HYEA 4DGSA 3EVTA 4ZRMA 1P0CA 1E3WB 5HTOA 1IZ9A 4Y98A 2HDHA 1A7KA 2A4KA 2JD1A 4ND3A 2HSDA 1P33A 1QYXA 2NVWA 2YYYA 3FHLA 3VKUA 3VZSA 4DPKA 1BGVA 4NJMA 1PJQA 3CH6A 1EDOA 4LW8A 1VJ1A 2VZ8A 3BTUA 4RVDA 3WWZA 2VTEA 1O95A 3IS3A 1GADO 5A9SA 3TZKA 3P2YA 2YQ4A 1Y5RA 3EZYA 1ONNA 2BFOA 1ZK1A 4JCOA 1V8BA 4FOOA 3NDJA 1ZO8A 3HDQA 2IXAA 4AICA 4CV1A 1BXGA 1JU9A 5ITVA 1DLJA 3OQ1A 2B69A 1C14A 4HX5A 4J1TA 1GY8A 4B8WA 3C24A 2BLLA 1L7EA 3RFVA 4NJOA 3TZCA 1JWBB 2I67A 3E1KA 5L45A 3ENKA 5JSFA 4J4TA 3INRA 1P45A 1U8XX 5CDUA 1NTOA 2PH5A 3ANMA 4J2HA 5TX7A 2CVOA 3IIEA 3CUKA 1IZ0A 4Z0HO 4BNJA 4YR9A 1TT7A 2JCXA 4NFHA 3ZNOA 2VYNA 1ISHA 3VZPA 4YAGA 2V65A 3H3FA 4RQTA 3DAFA 5K0ZA 4IDDA 3JD4A 4R1NA 1LDNA 4FB5A 2Q45A 1JN0A 1PJ3A 4R9SA 2I65A 1HLPA 4TKLA 4S1VA 3GEDA 1JKFA 4EZBA 1EE9A 1NQOA 4HFJA 2JHFA 3QWAA 1LXCA 1SBYA 4ZVVA 2WD7A 5B1YA 3E48A 4LISA 1LRLA 2Y67A 5IZCA 4M49A 1E7RA 2DU8A 3E82A 2GO1A 4GVLA 4E4YA 1K6IA 3QWBA 3RUIA 3OEYA 4E5PA 1WDMA 2DLDA 4NI5A 3H9EO 4CLOA 5I7SA 3I6IA 2AE1A 5TGDA 3GNSA 3DZGA 2D5AA 4DREA 3X2EA 1ZIDA 2VT2A 3DONA 3IOYA 4E21A 1ISGA 2OHXA 4QUKA 3U09A 1QRRA 1YB1A 3I1JA 3E5RA 1K6JA 3WMXA 3ZWNA 5CP8A 3B70A 3I52A 3ENNA 3V1TC 2FZWA 2QIOA 3JQAB 5DULA 4RVGA 5CG1A 4ESOA 1BTOA 4O63O 4GH5A 1K89A 2FRDA 1O6ZA 5CEFA 1DIGA 2I3AA 2HQ1A 4EJ0A 1P77A 5U1PA 4XGNA 1LA2A 1PGNA 5L7YA 3ZWVA 4DVJA 5KCZA 3FNEA 1DXYA 3T4XA 5I9MA 3AOEC 4N54A 2C07A 3O8QA 4OQZA 1LLQA 1J5PA 1BXGB 1LDEA 1BDMA 1C0PA 1EK5A 1NFQA 3DBVO 2PZMA 3VDQA 2C7VA 1XLTA 1PS0A 2VHXA 4ZICA 1WP4A 3KEOA 9LDBA 2DFDA 3W6UA 5EJ2A 1ZK3A 2EIHA 5ADHA 1F06A 4OHUA 5C7LO 1KC3A 3GVIA 2C2YA 2EF1A 1K3TA 4YB8A 5DCUA 2CDAA 2OP1A 1E3EA 3ZHYA 1YBAA 3PWKA 5G0SA 4LK3A 4EUEA 4YT8A 1R37A 1KC1A 3BMCB 2W4QA 2FPPA 4YXFA 3ASVA 3WGZA 1F14A 3I9KA 3LU1A 2C29D 2ZYGA 4RF4A 5ENDA 3ONFA 1CJCA 2QW8A 1SC6A 2JFFA 4JROA 2YJZA 4CMHA 5L4NA 3LT1A 3D0OA 4GMGA 1FF9A 1GZ4A 1LEHA 4J1SA 3JQ9C 3OIDA 4X54A 3CKYA 3IC5A 4UVIA 1Q0QA 4XZ3A 3L9WA 5DNAA 1XG5A 4MIYA 5BQFA 4DXHA 4BB6A 3D4PA 4FSHA 4PFJA 4UAGA 1N2SA 4AJ2A 1BXZA 4IS3A 1X0XA 4J49A 2BFPA 4R5HA 3RUAA 4BKQA 3QLJA 1IYZA 2VCYA 3GH3A 2FPIA 5GMOA 3WXBA 1LU9A 3WBBA 1MV8A 3INGA 3WFIA 2ZJ0A 1B0AA 1B8PA 5JDCA 2D3TA 2YHIA 1E5LA 1BSVA 3QWHA 2DTEA 1FDWA 4BGVA 3UAGA 4NG5A 3U4DA 1KVTA 2VUSA 3DMTA 3GGOA 4MVJP 4D3SA 1M66A 1NQ5A 2GF2A 2Y1FA 2W90A 3MJ4A 3OIGA 3WICA 5KJEA 4MVJD 4Z9YA 3WOHA 1I10A 1GYQA 1PR9A 3F1LA 7MDHA 4D46A 1XSEA 4BV9A 1ZW1A 1B3RA 1JAYA 2AG5A 3L4SO 1QYDA 5DT9A 4CR7A 3U62A 4BNFA 1R4NA 1LC3A 1W6UA 5EESA 4S3MA 3AUAA 4LSMA 1EZ4A 3WSWA 4M8SA 3QHAA 4N7RA 5DP1A 3WBFA 2B83A 2X0IA 4BOYA 2O3TA 1ULSA 2VZ0A 3I9JA 2PY6A 4HXYA 3TZHA 4RVUA 4NBWA 3PDUA 4MKZA 2QX7A 2G82A 3BTVA 2NTVA 5TJ9A 3ZV6A 5CFZA 4IGFA 3UHAA 3GDGA 3S8MA 4CV0A 3RC7A 2B5VA 1E7MA 2CDCA 2DKNA 2X7HA 4TRJA 4AG3A 4BVAA 3ONDA 1X14A 2X6TA 4II3A 3EMKA 1U1IA 2FZEA 5JS6A 1DEHA 1G0OA 2JFHA 3ROMA 4DC0A 1YOVB 3BMNB 1ZJZA 1DSSG 4RPHA 4KMSA 1YO6A 2V6BA 7ADHA 4NR0A 5EPOA 4UVHA 1LSJA 4W82A 1GYPA 3F6YA 3IJRA 3PJGA 3GAZA 4I5DA 3ZWMA 1YB5A 1OC4A 5A9RA 1ZVMA 4FC6A 1NPDA 2H63A 3MOIA 2I3GA 5HM8A 3RFXA 2UDPA 5AXBA 2DPGA 4RVFA 1ML3A 1NQAO 3TQHA 4ZQBA 3HN7A 1ISIA 3ZW8A 2B35A 2ZCVA 3WDSA 3F4LA 1LC0A 4PLVA 1J4AA 1DJNA 1E5QA 5L4LA 2UV8A 1EQUA 4LSWA 4F3YA 1B8VA 4RLSA 1GUYA 4GKVA 3IAHA 5KJ6A 1HDCA 1E1LA 1SNYA 3MZ0A 1N7GA 1E7WA 2BF7A 5CEJA 5IG2A 1H6BA 3PJDA 1UXHA 3A14A 3LF2A 2FP4A 2JJYA 4IDCA 4JNKA 4CPDA 3OF2A 1VKOA 2W8ZA 3PHJA 2IEBA 4FFNA 3ZWPA 3VVBA 3H3JA 2IEDA 4MVJE 5BNTA 2IXBA 2BGMA 4K26A 4BO1A 2W2LD 3WMWA 3KUXA 3U5TA 4JN6B 5JW6A 3UXYA 3JQBC 5DZSA 2GZ1A 2D59A 2GCGA 4XQGA 3HWRA 4E2XA 1ZSYA 1DRVA 4M55A 1MP0A 3C1AA 3JQFC 5GZ6A 2O48X 3RCBA 1LDGA 1EUCA 1Z74A 3GVPA 2H1SA 4ZQGA 1C1DB 1GPJA 2EKPA 2B5WA 1YQXA 1EUZA 2WDZA 1I2ZA 1R4NB 4B79A 1VL0A 1NAIA 3GQVA 3AOEA 5IJZA 1VL6A 2BFAA 2Y1GA 5IXSA 3E9MA 3PFFA 2J8ZA 1LI4A 4AFNA 2Y0CA 4CM4B 2CDBA 2J5KA 1JLLA 1ZK4A 2OL4A 1Q0HA 4GPD1 4L76A 4D0SA 4Q9NA 2J3KA 1HWYA 4D3FA 4PLPA 2TMGA 3AUSA 4Y8VA 1NQTA 3JQ8B 4CV3A 2C54A 2O3SA 1W4ZA 1IPEA 2NTNA 2NSDA 2E37A 4NZ9A 2NU7A 4JXKA 4R01A 1O0SA 5L7WA 3JQGA 3SJUA 4R9RA 4OGWA 4BNXA 1T2EA 5IN4A 3GZNA 4O0LA 4LCEA 5CPBA 2Z1MA 3F4BA 3ZHXA 2X23A 1H0KA 3TRIA 2V7PA 1UUFA 5A1TA 1H9AA 4TRMA 5A9SB 2JCYA 1U3UA 4UUMA 3GMSA 4WOKA 3QJ5A 2OFPA 3JCZA 2O4UX 3SLKA 2NVUB 1IL0A 3VZQA 1CRWG 3F5SA 2ZB8A 4R41A 1FXSA 4U0JA 4TVOA 2FN7A 4QO7A 2NV6A 1T26A 4NIMA 3GHHA 4AVYA 1HRDA 2LDBA 2POQX 1E0DA 2G17A 2X9VA 1VSUA 3AUTA 3B1FA 4J2OA 3QY9A 4FPXA 3FRJA 1DIRA 1CETA 4R1UA 2ZK7A 3FR8A 4XYLA 5DN9A 4CLRA 3GG2A 3WLEA 3Q6IA 1E1NA 4J90A 4Z0TA 3O38A 3GRPA 1NNUA 4XGKA 2AHRA 2VHYA 3UCEA 3K31A 4GI2A 5AVOA 1I3KA 1NWHA 1VSVA 2QG4A 2CZCA 1X0VA 1D3AA 4XYMA 3S2GA 5AYVA 1YJQA 4DMLA 4QFDA 4CLEA 1XGKA 2QRJA 3FBTA 2VRBA 5LCXA 5I8WA 3W4KA 4RDIA 3BA1A 3DFZA 4TZTA 3V8BA 3SC4A 2P91A 3ROPA 1AE1A 1HDGO 1I3NA 3I4CA 5TRTA 3ZI0A 3DBHB 3S2FA 4W4TA 5CDTA 4O6VA 1Z7BA 1HZZA 2FPGA 2EP7A 5BR7A 5A5EA 1CDOA 4CLDA 3DZJA 4J0FA 3KETA 2J5QA 4AJ1A 1DLIA 2WYUA 2GGSA 4YT5A 4YRAA 3RKRA 4DRYA 3WQQA 2OGUA 4I08A 1MC5A 4GX1A 5B4UA 3PRJA 4BNUA 3C85A 5IAAA 5DBFA 3EVNA 1RYEA 3CMMA 3GUYA 2Y0EA 5JAIA 1NR7A 3JYNA 3U0BA 4CLOB 4UUNA 3PZRA 3AY7A 4FD3A 3TL3A 2VHWA 4FCCA 4KUEA 1J6UA 4YJFA 2PZKA 4R3NA 4DBZA 4E5NA 2BKAA 4UUOA 4BNNA 4MVJH 2WWRA 3LSYA 3PDJA 3KOUA 4ZQHA 5BSFA 1X1TA 1Y8RA 3JQ8A 4YYZA 2HRZA 5DOVA 5LC1A 1JVSA 1YE3A 3WYBA 1MG5A 3BHJA 2ZQYA 1PJ2A 3EC7A 4HP8A 1N1GA 1QLJA 4DMMA 2O23A 4BGIA 5ILGA 2V6MA 2I5PO 5TF4A 3DOJA 3NDIA 4L4RA 2BD0A 5C7IO 4WNCA 1DC5A 5TJHA 3CSDA 4IQGA 3LLVA 1LDMA 3O4RA
chains in the Genus database with same CATH superfamily
2P9CA 1NW4A 3RNLA 3ZTYA 1P1BA 1ZI6A 2V8BA 4X92A 2BFDA 4JKIA 1HEIA 1C7EA 2PZBA 3OOSA 3S2IA 4B3TB 4EF4A 3FHCB 2ECQA 3GAFA 4E2ZA 2MDTA 1NVDA 1T1RA 1VMIA 2XUJA 1XIVA 3GYGA 1G20A 4Y1FA 1UJCA 2OVFA 4Y2GA 4GWLA 4MR9A 3WGKA 2A5GA 1E3TA 1RXEA 2L17A 2ZYIA 3CT4A 1ZHOA 3AVXA 1GIAA 3SPXA 2JANA 3U39A 5CXUA 1NG9A 1SG9A 3GFVA 4PLTA 3R7DA 3ESYA 2HA3A 4BMOB 2CXQA 4EK9A 4BFLA 5BXQC 3EDOA 1K8XB 2ZE6A 3ANXA 3N7AA 1U8YA 2I4NA 1CY8A 4H4DA 3MWLA 3HJNA 2MSCB 4XWGA 2IV2X 3NV9A 4Y2HA 1NOJA 3C1TA 4KTTE 1BOFA 5AI5A 4HNHA 3RC1A 5LLTA 2BELA 5ALDA 1QP7A 2OKCA 5B3KA 4RLQA 2ZIZA 4NHEA 4BNGA 4AY2A 3R7BA 1HE8B 1TQHA 4G1VA 1LX6A 4EHBA 3GLFB 4K05A 3SZGA 3JTEA 1Z8NA 2FKNA 3EF0A 3RSFA 4ZYYA 1IU9A 4C5BA 3JQBA 3LX5A 2R1TB 3WGQA 1M7HA 3JWPA 5H3HA 5AUQA 2R4TA 3FWZA 1A97A 1TDJA 2YXDA 5JJLA 5E9WA 9ABPA 4OJTA 3Q9SA 4ZCTA 3RS7A 4XWOA 1MOQA 1U1DA 1GV1A 2V4MA 4H7KA 3ONVA 2CVFA 3QUSA 4G5HA 4BLWA 4C4YA 4IOJA 5KTKA 2YVUA 2C7GA 4XR4A 4ZYZA 1G8JA 2AG6A 2C97A 2VH5R 721PA 2EX1A 3AUUA 3KK0A 4LXTA 3UJ9A 5FBVB 2W83A 1WEKA 2ATEA 3AFMA 3Q15C 1MABA 2MMGA 4HCJA 1W7AA 4KDFA 1JFSA 1CR0A 2DF8A 3DHEA 5K3FA 5HK9A 4W5JA 4KGXA 8AT1A 4M1QA 1OX4A 5ER6A 1RRFA 3QXJA 4XX0A 1Z5NA 3FDZB 5LA6A 1IQUA 3TIFA 1MDBA 1Z68A 2MSLA 2WTXA 1F6WA 4QU9A 4RZ3A 4YJ3F 5ALRA 3VTZA 4YRSA 1OH8A 3TAXA 3T5DA 2YJGA 4BO8A 2CNDA 2NO1A 3CLTC 2YFYA 4R2LA 4RXTA 3L1VA 5IWCA 3H65A 4YJFB 1DCKA 1J1ZA 3IIKA 2XBMA 1CY4A 5ALFA 5KCMA 4D45A 1WUKS 4MIEA 4ZGBA 5KTYA 4QULA 3GEIA 1DCTA 2IZ1A 3BMQB 2ZU0C 4HR7A 3OQHA 3O3MB 1G291 2J4CA 5T6MA 2VS1A 2Z4TA 3EWNA 3EQZA 4CMEC 2II6A 3H04A 4NMWA 2R8PA 4HEHA 4KLNA 4E2YA 1SHUX 1WB6A 4EEXA 2H2HA 4WE3A 5I4IA 3CEHA 4KXYA 4AKSA 3ZCQA 2ECKA 2GHRA 5SY9A 3MWEA 1LVHA 2E85A 4CCYB 4ZKEA 3GJSA 3U4IA 1KSFX 4PIVA 2P4QA 3Q41A 3PR2B 4R1TA 1WKBA 3PNBA 5JCZA 3I0ZA 1XK7A 2QQGA 1NYRA 2C98A 2J3JA 2OB1A 2VDUE 3EZ6A 1RJ9B 1HURA 1Z34A 4S0XA 3IIIA 4EFLA 5FB3A 2WYVA 4ZHQF 4OYLA 2RB5A 3VZSA 5M34A 2JVJA 2NYRA 4DNXA 1ECCA 2F1RA 3EUEA 4KPGA 4B8ZA 2H9IA 1Y7LA 1QZTA 4MZXA 4YAJA 5EE5B 3ZY4A 4L02A 1VZ3A 4JL8A 4WESB 4HI0E 1DWPA 1AMUA 3MM4A 1E3MA 3O91A 4F4HA 1E4YA 2G1KA 2DUNA 4WK2B 5EHQA 3ROGA 1U7TA 4PG4A 1MTZA 4QDKA 1XYVA 1PDVA 2EW8A 2G71A 2JAQA 2W2VA 1UH5A 3RSOA 3LQQA 5TDHA 4F9TA 3AF0A 5L9AA 2HSJA 3ZN2A 4GXTA 1GLVA 2DULA 3JTMA 1T4BA 1QG0A 2Q21A 2WJ4A 2X15A 2XTJA 4NENA 4B6EA 4V1CA 2QG9A 3OU6A 4BLQA 3ZEIA 4O1HA 4RL6A 3R8XA 4HJRA 4C29A 4G8JA 1NP6A 1VL8A 1RMQA 3U9SA 1GTMA 3BQMB 4Y9UA 1YS2X 1HM5A 2GF0A 2WUGA 1C9MA 1X1SA 3ORYA 2BW0A 5LQJA 4RHEA 4F60A 3C5VA 4HFNA 4PCUA 5DW3A 1G17A 4BFUA 2VOEA 5SY6A 3HLYA 1PJLA 2Y0DA 1QONA 3HPRA 2EW2A 3ABRB 4WVLA 4X94A 3OFKA 1KI8A 1RU3A 1QZZA 4FFWA 1PAUA 4EW6A 1FP2A 3SI7A 4ND8B 5ESXA 1C30A 2FSPA 1SCQA 4D3ZA 1OFGA 3M4ZA 1XDWA 5AW7A 1W4AA 4PQGA 4I5GA 3JV7A 4QOHA 4U7JA 1HDXA 5GINE 5L51A 1BKDR 3GF4A 5LWQA 1XL0A 1FRQA 5E7MA 1J97A 2BEKA 1GP2A 1JZTA 4XB2A 3DA8A 5EKSA 5EP4A 3N8NA 3VJMA 2BI7A 4MWGA 4L15A 4RS3A 5JS1A 4UBOA 2CB0A 2HIGA 2Y1DA 3Q7IA 4TGLA 1QANA 4HZUB 5FR2A 1KDZA 2AIRA 4CN9A 5IX8A 4O5AA 1X15A 4G1EB 4N0EA 4M9QA 4D3XA 4A36A 3KHKA 5JCXA 3DE0X 1T2UA 3V3TA 4BB9A 4YUXA 4HVTA 2KJQA 3PQ6A 2Q6VA 1MXFA 4FINA 4LNUB 1ZXLA 1YBVA 3H4IA 3OIYA 2JIOA 1GFIA 3SP1A 1U65A 1XDGA 3WGTA 1X7XA 4JSTA 3E84A 2HCBA 1B26A 3F46A 3MTGA 4TWZA 4WQMA 5D3QA 5T57A 4D26A 3DFIA 2OPBA 4ALNA 3DZFA 3DQZA 4ZJUA 1I94B 3AKCA 3SX4A 2ZSHA 4CBVA 5BMOA 3OX2A 5AXCA 2F9MA 3EEBA 1QIIA 2AD5A 2Y6VA 1C0LA 1RRMA 4WI1A 2ZWIA 2HBZA 4CVNA 2YJNA 1N9ZA 2FR0A 3LC2O 3NBXX 2XQIA 4Y6QA 2OCXA 2IYXA 2A35A 3CUVA 2XQKA 3KR9A 2Z8ZA 3L8FA 5KZMB 1EHYA 2H5LA 4TUYA 5JRZA 1WAMA 2HJ9A 3AL0C 4HB3A 3QEBZ 3D1JA 2BF4A 3VPFA 5HRCA 3KXPA 3UM9A 2VVTA 2ET6A 4RFLA 1L5NA 3HU3A 1T29A 1CDDA 2VPTA 1H4VB 3WK8A 1RJEA 1TK9A 1JTFA 5MFZA 1ZVQA 1IRXA 4GPBA 3B53X 1V48A 2EF0A 4U7GA 1HL3A 5AJYA 3V2IA 3FBGA 4BQIA 3QELB 4JI8B 2WEKA 4R1PA 3ZWCA 1TC2A 3JQAA 4HDKA 4CGYA 1TCAA 2PH7A 4YMIA 3S1AB 2I22A 3ZHQA 4QJ3A 4CDRA 1ONBA 1U98A 1I3LA 3HU1A 4YRKA 4TXLA 1DHRA 1B14A 1JDPA 2XOXA 3LK7A 4YK7A 4MVJG 4RANA 3PXAA 1UK6A 3M6AA 3SNKA 2YXPX 4Y2TA 2I7VA 5AVWA 5BRJA 2ZRAA 1C7IA 4ROSA 4N6OA 1EUDA 3FMIA 4PR3A 2CHVA 4RGYA 3DFFA 3SFVA 3TKYA 4E5KA 5CVUA 5CBPB 2D0PB 5YASA 1FJXA 2QQ5A 2VLBA 4CGZA 1UJNA 1PZHA 3EEOA 3V4OA 1R15A 3C1OA 3K5PA 4PLWA 3VHQA 5KOJB 1ZA1A 2FWBA 1Y6GA 4G65A 2V7QD 3MOGA 4NPCA 3HBNA 1KQOA 4BNTA 1HV8A 1D4ZA 1UQTA 4WY2A 3TW6A 2FQYA 3KB2A 3JYLA 1M3SA 5BVGA 2DMRA 4WBNF 4XTCS 5C8VA 4W8OA 3TB6A 3M9WA 4H59A 3SQMA 5C4GB 4TV9B 1EA5A 3JZDA 3EASA 1L5YA 1DKNA 4KP7A 2ZUUA 4ZEWA 2Y1WA 3W7BA 4Y18A 4DKJA 2DBVO 2WAMA 3A26A 4BUCA 4X5OA 5JO9A 2FETA 4B3GA 2XT9A 1POXA 4D92A 3CNEA 2VRNA 1R9MA 1I13A 4F06A 4ZZ3A 3I5AA 5BW6B 1G5IA 4YJGB 4WLEA 2OCGA 4MUBA 3DS8A 4UKDA 2PUCA 1P7CA 2C5BA 2GZ3A 3O7MA 3HVIA 4YRLA 1C4OA 1QH9A 1CVIA 1JHZA 2FSIA 4J4BA 2ZJZA 2EU8A 5CYGA 1P0FA 4X6UA 4EF5A 1Q7RA 3QSGA 4FU0A 4X8MA 4F4IA 3AR6A 2YHSA 4QDZA 3HEAA 1SELA 2CNOA 4R8LA 1V4VA 4B09A 4PZPA 4UE3S 5D5PA 4K6HA 4ZEXA 1W1WA 3TF5A 1L8LA 2H3HA 3PGJA 3CW2A 5MFPA 2QLMA 1L5HB 1K8RA 1M8KA 1VA4A 4H9GA 4IHKA 5FI5A 1PFUA 3BK7A 1KE1A 4M9SA 3I8XA 3ENZA 1XMVA 1P1IA 3ZDAA 4K9OA 3FB1A 5IVIA 1UWCA 1BKYA 2ETXA 3RODA 1U9IA 1WCV1 1Y8QA 1FTQA 4U2KA 2LKCA 1DBVO 1X2BA 2VDJA 2VDNB 3PHIA 4CQLB 2HV8A 5A4DA 5EIWA 3VDRA 1XCBA 2DCUA 2JCVA 4CIAA 1PZNA 2O2IA 3C41J 3RWBA 2D0OB 2WT9A 1FDVA 1M34B 1OXUA 1T3SA 2HNBA 3JRXA 1NYTA 2FZGA 3KZXA 5AVUA 1SRRA 1U3WA 1Y3FE 1N8SA 5COAA 3RRXA 3TEJA 2Q5LA 1KJ9A 3HCNA 3CISA 3LQ2A 5BO5A 3SS8A 4D42A 1G4UR 1TXGA 5ICMA 3L07A 1KRXA 4PAOA 3FYDA 3QEAZ 3K6RA 3RROA 2QRQA 1GG8A 3K8ZA 3ZHBA 4EQ6B 2R751 3CLTD 3Q8WA 3HB9A 3HKCB 3E0QA 4JBHA 3QJGA 5IW8A 4M7PA 4FSXA 4LDQA 5CHEA 4KPYA 4FJ1A 3M2PA 3OQBA 4EA7A 2F67A 3HM9A 4KVZA 5K6AC 4QOEA 1NUTA 4E3WA 1TYBE 3U7HB 5EP2A 5FEUA 4Q3EA 4WJKB 4BL5A 2Y1OA 4R5MA 4FEEA 2QPTA 3UT5B 2P9TA 1RT9A 3LKDA 4QBHA 1A9YA 1JXOA 4KIUA 3F78A 5IBPA 5I01A 1K4YA 1NJ2A 1I1HA 2D62A 1D2EA 3K8YA 4X90A 5E1BA 1G8GA 1N1EA 4HBGA 1SHJA 1E2HA 1AM4D 1WHTB 1A5SB 2FWIA 3HDJA 1IH8A 3VYVA 1RLJA 2C31A 1U8UA 4KODA 5EP1A 2J6HA 1GWNA 2B1IA 3LZDA 1R4MA 1VIAA 4IIUA 1QPZA 3BMCA 3DEJA 3PUWA 1WUIS 1L0BA 4DCGA 2Q4EA 2JEYA 3BMNA 5ABPA 2P27A 1ZKDA 1DEOA 1FNNA 2D54A 2VYVD 3E2IA 4WZAB 5BT9A 3ZU4A 4DMCA 1MMFB 1U3GA 5CFNA 4X3CA 1B8OA 4KAJA 3TTTA 1UANA 1SFRA 1F12A 3BHNA 3H0EA 4BQSA 3T7CA 1J0AA 4RH1A 3MTEA 1QR2A 3V4FA 2YVLA 4KQKA 2X0EA 4EHJA 3FPEA 1I80A 1JKJA 2LCFA 1S6YA 1QLHA 1OXTA 1VXRA 3FTPA 4CT5A 3TR0A 1G64A 1II8B 1W49A 4CKEB 4IJUA 5KQMA 4UHKA 4NQZA 3H8SA 2ID8A 4B76A 4I50A 5JH7A 4Z4IA 5DI3A 3ROFA 3H2JA 2P2YA 1HE1C 1W9MA 5B4VA 2XR1A 2WHRA 3GGGA 4D4KA 2GARA 1JDJA 1IFXA 2IEYA 3ADPA 3SAJA 2QX6A 1TJYA 1WUJS 4HWKA 5J23A 1MAHA 3DBHA 3R7LA 1MAAA 4UOEA 3QVXA 3N2KA 1XRRA 2BUBA 4H60A 3SVLA 3BD8A 1UEIA 3VC1A 3H5AA 4ND5A 4DMGA 1WU7A 1NVFA 5SYMA 4AY6A 5DM0A 3QKSB 1QUFA 4AZ3B 3B2QA 4V1CI 2ZP1A 1Y81A 3OJXA 3L8HA 4L5BA 4I1OA 5CITA 5JALA 2WMYA 221PA 5DIZA 3U4MA 2XX3A 2ZKLA 1FFDA 3FYUB 1Z37A 4P7KA 3C48A 4X1KA 4I5IA 1UM8A 4YYEA 4Q4HA 2ZXUA 3BX1A 1Z45A 3ZH2A 3D8NA 1PF7E 1XD8A 1CUJA 1ZAKA 1NGSA 4L0DA 5DH9A 4MRAA 3SLGA 3MWGA 2WJIA 2P2NA 3RU3A 4F46A 2A57A 3DH0A 3I5XA 2ETVA 4Z2AA 3K6SA 4DARA 2WD7B 3EX7C 4KE6A 4ZO4A 1OPXA 1Y3DE 3FVQA 1A04A 1LBEA 3AEQA 4FDUA 1OH5A 1XMPA 1WVGA 1Y5LA 1Y33E 3ZH9B 3H97A 3KAKA 3UT0A 5D00A 1T8RA 2KE5A 3A6DA 3N59A 1WXIA 3OCXA 4HAUA 3NR2A 4L5YA 3H7IA 4Y6LA 3UW3A 4HVCA 4PYQA 3QOXA 3EGXA 1E6KA 4QHYA 2QSYA 4FNMA 5KNLA 4B6GA 4Q6BA 4GLOA 1B4DA 3DLIA 2V55B 2CXUA 4KXWA 1VTKA 1H2FA 1A95A 2YBEA 4KITB 4TXHA 3KYCA 1MPXA 3Q3CA 4OFWA 4XDYA 2XYPA 3LDGA 4CTNA 4LY6A 5JU6A 1S2DA 3C98A 1M6WA 1BDBA 2PGAA 3DE2X 4Z1MA 3B7PA 5F7XA 3C39A 4JASB 3CG0A 4QXRA 4KE8A 4JP3A 1YJCA 1WU8A 3K1ZA 3BKXA 2EJWA 2ZSKA 3M4YA 4NESA 5TC4A 2AJ8A 4JYPA 4WLVA 4ZRDA 4FGKA 2H59A 4UEJA 5JCOC 2WI8A 2Q3BA 2OK8A 1J23A 1QM5A 5KYYA 2HF7A 3SEZA 1XI2A 3WIUA 2OGZA 1YD7A 5EJ9A 3GD7A 3KWFA 3MT8A 4OEHA 5HFNA 3PFWO 2AUNA 1B8UA 1IONA 3WWCA 4AU1A 2VXCA 1EQ2A 2O7SA 2GX6A 1N0HA 1VHJA 3FZQA 3GUZA 3LT4A 3IR5A 3GWZA 2CFTA 3OJWA 4MLCA 3JR3A 1MO4A 3LFTA 4EI8A 1HEYA 1EVEA 3EXEA 5JQGB 1A4XA 2BI8A 1I4OA 2EHDA 3SMVA 4A8JA 1FSGA 2C2OA 3KT8A 1AUOA 2I1QA 2AWOA 1IY1A 3BIXA 5EHIA 1L5FA 3ND8A 2XQVA 4DWVA 5M04A 4N65A 2OZKA 1TKCA 3CUSA 2FMIA 1M10A 2ALJA 4XCXA 2ZRCA 2I2XB 1J90A 4CMJA 3O8OB 4C2BA 4C6HA 4W5TA 3VHXB 1HLDA 2R9VA 1WD7A 3LWNA 5ALMA 4M0UA 3I76A 2NV2B 4IUBS 3SHWA 4C08A 1EVKA 4A0GA 2HPZA 1K63A 1DFHA 3TBHA 3VUFA 1J25A 1X9HA 1D5CA 1G6Q1 2DVMA 3PFKA 4ES6A 2B4TO 2E0IA 5HHTA 4TYWA 1PR3A 1VE3A 1KPGA 4OFBA 3EA0A 4XRGA 3DCNA 1L4EA 3B3FA 5ITZB 3ZDQA 2J3LA 3ECAA 3WYCA 4TOIA 3G7UA 2GD6A 3QBVA 3ZV3A 4TT3A 3WDKA 5F1OA 3TCXB 4JKYA 4W63A 1QJ4A 3PIRA 2CFIA 5K3FB 3TLBA 4DA9A 3A3OA 3MWYW 3IGFA 4AJOA 4K0KB 1SEVA 2O5CA 1JMVA 4IW3B 5KTMA 1BRMA 1MX5A 3C7AA 5JAZA 1SKUA 2V7UA 4L4UA 5K4AA 4ATNA 1U2GC 4P4LA 3SSNA 4U02A 3EBLA 5HKOA 5TEWA 2OZPA 3BRWA 5EFOA 3WWOA 2GN4A 2P9QA 2Q0XA 4IMIB 1R0YA 1J39A 1UXGA 4DJTA 4PRLA 4LOJA 4OAQA 4IIJF 4ZV7A 3MAJA 3IUNA 3A2MA 2PT5A 4M4SA 3SXPA 2DEUA 4EG6A 2IH4A 4HLDA 2M1ZA 1LPAB 1FK8A 1FYVA 3BJEA 4N12A 1DC7A 1WPRA 2ZXEA 4HB4A 1I5RA 3FNRA 3T95A 3WYFA 2BFWA 3D6TB 1TA4A 5F1YA 3G7SA 2YJ3A 1F4PA 1YHYA 4X8OA 1JH9A 2VHEA 3MWEB 1VGQA 5EERA 3T5CA 1KVUA 4QRHA 1ZHHA 2PD6A 3G9XA 2IOHA 3COZA 2EV9A 2GTIA 4BNHA 4Z3DA 1RZVA 4UDOA 1ZUNB 1NVVQ 4QAQA 3LLCA 1Q2UA 3DQQA 4WLNA 1YONA 5LYJF 4FFRA 1V16A 2WJVA 1FPQA 1IN5A 3NRCA 3RIHA 3UB3A 2RK3A 1E2GA 1RHUA 2PL3A 4FFOA 2XGSA 2AQIA 3GY0A 4X1IA 5LOVB 1KWKA 5BURA 3STVA 2D00A 3CZ5A 2GKGA 4FQ8A 3OLXA 1DRKA 3OUUA 2I8AA 4OB8A 4N5LA 3OJ0A 5FWNA 2G5TA 4LC0A 3TDNA 1M73E 4PICA 2PYZA 1E9BA 1T4DA 3RLIA 2VG8A 5FFNA 4CU5A 4CKBA 4P7BA 2QNIA 5F77A 4YI5A 1MOPA 3UWOA 2FUNB 2BM0A 3RKUA 1JZQA 1W59A 3Q12A 3CCFA 1CR1A 1X8KA 4GZ5A 3HUDA 3SIWA 4MUFA 2UU9B 3LUBA 1X1RA 1L3CA 3LHSA 4E09A 2VAMA 2PWBA 2ZUSA 1QHSA 3F97A 4RESA 2KQUA 5GQSA 3GV0A 4BKMA 1Y7HA 5T3YA 1VJ5A 3QPUA 3WGIA 4JJEA 4DV2B 2BH2A 4YRRA 4FT2A 3BAFA 1U81A 5C3UA 3UBMA 1I3OA 4DG9A 4HTFA 1SQSA 1D9ZA 3NFYA 3TVDA 4CEHB 1CW2B 4F3KA 3CEPB 4YRDA 1BVYF 5BV7A 3CNLA 2AOTB 4J75A 5H1YA 1ZAYA 1E32A 3OE7D 1D0IA 5BW8A 1R5BA 1ATIA 1HYGA 2A84A 4PHCA 4Y6RA 4EHNA 4WKCA 1S2IA 3AFOA 3GDWA 2MWMA 3KQNA 3ACBA 3TW4A 3U37A 2WYHA 3WL6A 3COYA 1EFDN 2W37A 3NAMA 3HZZA 3VZBA 1N78A 1QR6A 2Q4DA 5K0FA 5HRUA 3DBRA 1CULC 1R5JA 3E53A 4TMFA 2WPDA 4ZKDA 2FY8A 1AKYA 1WXDA 2YY7A 1ICIA 3LUDA 3LY5A 2Q1WA 2HMYB 1HG0A 3MUEA 4NPHA 1RZRD 3VI4B 4QOJA 2QZPA 2VNSA 2Z6AA 1G5PA 3JSAA 3DYVA 4B4OA 2WJWA 3EW7A 1DFIA 3H5NA 2O8EB 1U0GA 4ZN6A 1GU1A 3CPSA 2AXEA 1RCFA 5CUQA 4NAUA 1RR6A 3ICPA 3S29A 5HZGA 2P9BA 3EXIB 1GT6A 3BBPA 4IGIA 4XIYA 2ZANA 3VSDA 1LNSA 1TCVA 1O94A 2XA1A 5T8KC 4KQ9A 1C3OB 3CX4A 5ELXA 2P2GA 1TTPB 1IHXA 5EHZA 2RHJA 1RABA 3WY9A 1SXGA 5E8RA 3F98A 1M34E 2J08A 1N2XA 2BEVB 1T9KA 2Q29A 2UUOA 3LK6A 3LT0A 3ZDYB 3BN3A 4DCMA 4WDRA 3EQ7A 4IWYA 5LZ7A 5E0KB 1EE1A 1EVIA 1LVGA 1LBHA 1N6OA 1EA7A 1CUBA 1N8TA 1KH3A 2GJ8A 3TGWA 1U6KA 1QB7A 1DX9A 1K6MA 1NWCA 3SIRA 5SZJA 4WKPA 1MF7A 4BB5A 1GNLA 5E1DA 4IJMA 4KKXB 3UZUA 3OLQA 1N2JA 5A0TA 3EXHC 1F48A 1M2HA 2WWGA 3NANA 4HXGA 3UY4A 2C59A 4CM3A 3IBYA 1XZLA 2EYQA 3OKAA 2FH5B 4JS0A 2K7ZA 1SC3A 3L8DA 2ZI9A 4D9CA 2E4UA 1RIFA 1V8PA 4NTZA 3GRFA 1RWOA 2DBYA 3T5BA 2WFAA 4RKQA 5B1HA 3WZMA 2ZQZA 1DOAA 5EE3A 4EUSA 4HWRA 5A5GA 3OC0A 2VTKA 4Q15A 4K9PA 3MTJA 3U3KA 4RORA 3K30A 4OI0A 3N8DA 3LZ6A 1JFRA 3M70A 2G4CA 4J07A 1BE0A 3FWYA 5G1PA 3QBTA 4QDUA 5EMHA 4YJ3A 4L5AA 1RWVA 5LU9A 1UM9A 1W75A 2IYPA 3FNIA 3HBJA 2MSEB 4Q3BA 4ZMSA 4F85A 3WTCA 4NONA 3EZGA 1RAGA 4NU6A 4RMJA 1QK3A 3QFRA 3S1AA 1SCUB 1MX3A 4B87A 5JTUA 3MAAC 3ZUPA 3DDSA 4HK4A 1GA4A 4NE7A 1A1VA 5I9TA 4IDUB 1KO4A 1Z73A 2FF7A 3R3JA 5L3RA 5JRDS 2XUAA 1G3MA 3FDIA 3HXMA 2UAGA 4IOKA 4TL7A 3SD7A 1KMHA 4ZCMA 1HC7A 1X3SA 5TNXA 3DVSX 4AM8A 3G17A 4RS4A 4H7PA 4J3NA 1A5AB 1DRUA 1H94A 1GKUB 2CNWA 2XQJA 3CWQA 3E8MA 3N2LA 3K1TA 3Q6MA 6CHYA 2WUFA 3B20A 1WDKA 1EM6A 1NZDA 3SDBA 1AQUA 4IRUB 3X1MA 3P0FA 1M74A 2MR5A 3ELUA 1RZUA 3DBOB 4QUDA 1T0PA 4RLHA 1JTEA 1KNXA 2WT4A 5DU2A 2V7TA 5BUCA 1Z07A 1UAYA 2PPLA 3PA6A 4YH1A 1J2YA 5F3RA 4YUWA 3ANLA 1OH7A 2FUKA 2F3PA 2PCLA 4YCDA 3FTEA 3PQDA 1NC3A 2OLEA 5CR9A 1GTG1 3F8TA 1DZ3A 3PNQA 2I4IA 4MYCA 1JZSA 3SKYA 2IEAA 1OI7A 3ZE7A 3EFBA 1KEPA 3DDZX 3K4HA 4YROA 3STXA 2OQRA 1J00A 2D1SA 2CWWA 3KQPA 4LBYA 3E70C 1W4BA 2NUTA 5C7YA 2D6FA 1Q1NA 4YR7A 1YBMA 1B0PA 1RWBA 5DYWA 3KOWA 3U17A 4I1YA 3KL2A 1CE8B 3LUCA 1CWUA 2OORA 4QYIA 1SVIA 5FL3A 2KBFA 2MMCA 1M2FA 4FN4A 8OHMA 1EP3B 1SOWA 5JC1A 3STYA 5FNVF 5DCYA 2Q9UA 2CHEA 3QU5A 3GWGA 1Z6PA 2ODEA 3K73O 4JIMA 4KPUB 4LJSA 3B36A 4RE5A 4XD2A 5E6UA 4C4ZA 4DA7A 2ZM5A 2UVPA 3Q0IA 4ZI3A 5IWAB 2GK6A 1HTBA 4UEKA 3K2EA 5B7NA 3HHEA 3EIOA 3NTQA 2BGUA 1AGRA 5KVSA 1BIFA 3N1UA 2P2ZA 4EMUA 3NKLA 1M2WA 2Q3LA 2C57A 3BTSA 3PFHA 4RY9A 4ZYVA 3RYCA 5LSAA 1ODKA 4J7UA 5JHHB 2NZ2A 2HU5A 3IJ5A 5LVAA 2LNDA 5IH3A 3ZOZA 1H2HA 3BC1A 3QVSA 4OQEA 4D4JA 4S04A 2ADFA 5LYJA 1P73A 3QK7A 1WUHS 2WLTA 3Q7EA 2PVSA 1NMQA 3I30X 2I33A 4OO3A 1FS6A 3OIVA 1QZXA 4LXGA 2XJ4A 4IIVA 2ROQA 1M34A 4M1EA 3TAHA 3CONA 4ID3A 3CG4A 3FCSB 5CYOA 1XJWA 2GVDC 2ZR0A 1ZJJA 4HEJA 1AKNA 4Z9XA 2IVZA 3ULKA 1V8FA 3NHUA 3QNUA 4HQNA 3FMFA 1TQ2A 1V2HE 3MQ4A 3OZWA 1FEZA 1FNCA 3ZGOA 1T0HB 3VMMA 2X40A 3UKDA 2D1QA 4ER5A 4JA2A 4EYSA 5KO2A 5AJVB 2PFGA 3SXUB 2ICAA 1P8JA 4W5NA 1P4JA 1QG4A 2A7XA 3W9SA 3BRQA 1Y4SA 4JLUA 4AZ0B 1NNLA 4RDCA 2JFVA 1I7PA 1ULHA 1J0XO 1ZMOA 4FZ5A 2I2CA 1X80B 3JY6A 4FS8A 4N5HX 1OXBB 1VOTA 3F2IA 1EGQA 3PNOA 2P1DA 1QYVA 3KKEA 2VBIA 4A8PA 1WSDA 2W6IA 4FJ2A 3E9QA 4Q4DA 1T9AA 4F3NA 1Z5GA 5AW3A 5IF9A 2PQ6A 3IXQA 1A9ZA 3IB3A 4M0CA 4P84A 4UM5A 5EEGA 4GPTA 3R4CA 3G2QA 5HZKA 1VJCA 3FJ1A 4HH4A 5JYBA 3MS7A 4PYJA 1YDWA 4H6VA 4W1QA 1M5TA 1O03A 3BS4A 5IVKA 1YQGA 1SCKA 3QF4B 2QN3A 2P6PA 2PR2A 3BFXA 1C2TA 5ECGC 1QLWA 4KUHA 5DXJA 4IDHA 4XRRA 3DXFA 5F2NA 5T4FA 1S7GA 4WN3A 1E62A 2P67A 1D9XA 4LWOA 2IP1A 3IEMA 1TRKA 2WU0A 4BN5A 4UVEA 3OT4A 3NTLA 4B82A 1II0A 4LAFA 5FYDA 1JW9B 3K4PA 2PXHA 2NUTB 5SV2A 2HO5A 5KX5B 1J8DA 3KCNA 1FXWF 4RZIA 2OEPA 2ZVJA 4XB1A 2GEUA 3OX1A 2O3RA 3JSXA 1IB6A 2AKEA 3ETCA 2HSGA 2LP4Y 2MIIA 1TAQA 1ODIA 2J0UA 3EYWA 4IVRA 4LZZA 1N77A 3RIGA 1XEWY 2EERA 5H70A 5KJFA 1DADA 1HLFA 5EN4A 1CJVC 3FNGA 3FYCA 3HV2A 4JJKA 4YACA 4QOFA 5JH7B 1KJZA 3DUFB 3GZ4A 3HYRA 2HK7A 3RGGA 5KEIA 3UV7A 5DNUA 1WW8A 3GP5A 3HZOA 2XSZA 3RIMA 1FIUA 5FBZA 5F7ZA 1XVTA 1Y6FA 2HRDA 4PSDA 1CPYA 4ASUA 3CXUA 1X7WA 3I92A 4RHCA 1JDTA 1UOEA 4CEIB 3PWSA 2ZUWA 4GPEA 4MV5A 2D1RA 5MGNA 1BVUA 2AN9A 1F0NA 5G41A 4RQUA 5KDLA 5JFGA 2OGSA 2P3QA 2BDUA 1V4BA 2Z2KA 4AXXA 4M0LA 2GM9A 4W99A 4J0CA 3HP4A 3EK2A 1O1YA 1OLSA 1Z12A 1E5XA 2OFWA 2WIBA 1F5NA 5LB2A 4F8JA 1NI3A 1PJBA 3VPAA 4JYBA 3OQVA 5AOAA 3CRW1 4YP1A 5BSRA 1M1YE 1NBME 3U48A 1T35A 4PSUA 3Q3GE 1PFKA 1C8LA 4XWTA 3RW9A 1LQUA 4XFDA 3ZV4A 1NNSA 3TX6A 1MO3A 4JBYA 2Q2OA 1LSOA 2VPYA 3LBIA 2FW0A 3RSLA 1OBHA 1W36B 4ZAWA 4J4HA 3W7VA 1N34B 4W7IA 3D7KA 2JGKA 1WZEA 1FOEB 2ZBVA 3LOPA 4G85A 2XGJA 3K0AB 1VXOA 1ZGJA 1X7ZB 5TT0A 3K0SA 1E7YA 1KIFA 2NZXA 4N03A 5F1PA 2D7DA 1CY1A 1Z15A 2GYWA 1L6RA 4ALJA 4DSOA 3G5UA 1XMXA 3FFWA 3H4VA 4A6XA 3EIEA 4GF5A 3ZY2A 1P9LA 3LI2A 3BL6A 3AJ8A 4FP9A 1N4DA 4RZUA 4W8HA 1P7PA 4QQ8A 2N9UA 3DOEA 3BBLA 3KYCB 1VPVA 3M6WA 1AHHA 5DGCA 4BE7B 4MKXA 4E32A 5AUPB 3VPBA 4HPWA 1RRGA 4INAA 3LVQE 5K3BA 2HLNA 1P44A 2YDXA 4AO8A 4YRCA 3PC8A 4WXMA 4MUKA 3AY0A 5TIIA 4EM6A 1BRTA 1SU6A 2Z6QA 1YS4A 1Z5ZA 3KKPA 2JFBA 1FLNA 4K9SA 4WJZA 3VTKA 3I2IA 1FZQA 1LX7A 3F47A 3RAJA 1F6BA 4HO1X 3HO6A 4C3UA 4J6EA 3VO1A 1Z0IA 4MUGA 3U13A 2PUEA 2PRZA 4HLCA 4GS5A 4HVAA 5HVNA 2OY0A 1V6CA 3JQ7B 3AERA 1UMDA 4X7PA 4D8YA 5MDHA 5ULLA 4RD0A 4NNOA 2R48A 2UYHA 3EZLA 2D06A 2BFCB 2ZROA 3OPMA 4N76A 1U2DA 2L42A 4BJHB 2DWCA 4C43A 3HH8A 4POAA 3KBBA 2B2CA 4IJSA 2PLNA 4YLYA 4MRRA 4H15A 3D5EA 1WWKA 1R16A 1VE7A 3V55A 1AK9A 4FOTA 4PN3A 3PDIB 1QIMA 1N2ZA 1QAMA 4LOIA 3V8PA 2B30A 4MXDA 1BO6A 2BCJQ 4DCTA 2I2AA 2YV2A 2VOJA 4IUCS 3E7DA 1RWQA 3KPWA 1DXQA 1II8A 2REQA 4G0MA 3PXBA 5JXHA 5LM3A 5LZ9A 1S2MA 2XKKA 3U61B 1BMQA 2QSUA 4HYTA 4MYDA 2BHTA 1P2FA 3MGKA 5CT4A 2WTAA 1L5HA 1INLA 1XTVA 4B4WA 2WM3A 4BKRA 3B51X 2YHBA 4RD4A 3TMAA 1E2PA 3R0JA 4DV1B 1TEZA 4CZ2A 3E3AA 3CO5A 2AD1A 3GU3A 4WA8A 3K09A 2ZR8A 4J0DA 3RBXA 4D8XA 4ERXA 4AS2A 5LXTB 2PSDA 4F2WA 1XC7A 2OZEA 1XU7A 2ZJAA 5LNK1 4CM1A 5AUOB 4PF1A 4X97A 4EI7A 1PEDA 4EI9A 1A82A 2D5CA 2X2OA 4PV7A 1GNRA 3T7TA 1HT0A 1C7JA 4L2IA 1CQJB 1W5SA 1DO0A 4GUAA 3LP6A 5D01A 4YUAA 13PKA 3WOVA 4BFYA 2VJLA 1W0CA 2O8VA 3PDWA 2BBOA 2JIBA 2ONZA 3F6RA 5IU6A 5JTTA 1ZBQA 3WQBA 2I54A 2BUAA 5GIPE 2C7OA 1G0NA 2EQBA 5JJBA 1TFRA 3HPQA 3CRQA 2QTMA 4D44A 1NJ1A 1MFZA 3DO5A 4YTEA 3TR6A 2YUIA 4P82A 4FGUA 1W1UA 4EFDA 5BOSA 5CYPA 1GZ7A 5U9CA 2J07A 2ZAOA 2ZYHA 2GWHA 3UT6A 1SUCA 3G68A 2UYYA 4MQLA 4ITUA 2CBZA 3IA7A 1QTRA 3JAKA 4CMIA 5HQTA 1CVRA 1D7OA 3WLFA 5CLIA 1VBMA 1I2CA 3AZQA 2AN5A 1VPWA 1YVPA 3KBOA 1VIVA 4IXWA 3L41A 3UIEA 4ENPA 1I0ZA 2N75A 3Q72A 4O02B 4R83A 3TTUA 3W3AD 3EIUA 1ZD9A 1G9XA 2NU8A 2AJTA 3KZMA 3NB0A 4M0DA 3ZCSA 2A9FA 3U81A 1U0BB 4NECA 3ZS9A 2G8NA 4CUJA 3ADCA 3RM3A 1NJ8A 4RADA 2ZITA 3VVMA 1R4MB 3W8RA 1U3DA 4DS3A 2J3DA 4EZIA 1G8FA 3MCAA 4MVJA 4BWGA 2Q3CA 4JJ4A 2FTKE 1CF2O 1EWTA 1V37A 2WICA 2FOXA 1XZ8A 1JLMA 2X0JA 1ZRNA 2ZR7A 1U90A 2ZRIA 3EGVA 1RVV1 3KB8A 3TW8A 4I6GA 4DPLA 2WUVA 3B5JA 1XK6A 5K9ZA 3KDAA 3P9ZA 2YWXA 2PDAA 1FBNA 1AB5A 4XGRA 2D8AA 1Z56C 1V1MB 3PIIA 1HYBA 5JE8A 4YT4A 5D3ZA 3ZS8A 1S3IA 2M32A 1Q12A 1NM5A 4XKJA 5L3SA 3K9QO 3RVLA 2CJWB 3PWTA 3RUCA 5JCJD 1BDIA 4D8VA 4YMUA 4ARAA 4DQKA 1JR4A 4RK6A 3IOEA 4GR9A 1XKLA 3U3MA 5CURA 3L6OO 1GPNA 1R0KA 3P9KA 3K35A 4IM7A 4UQOA 4W6ZA 1F1BA 4AZWA 3GA7A 1A76A 4YMLA 3HKBB 2O7NA 2QTFA 2WWWA 2ZOSA 1FDRA 3BE8A 3QVOA 3E3NA 3VA7A 4EJMA 4UTVA 2J67A 4YLGA 4NMHA 1H2BA 2HWXA 4JB2A 3SR4A 1JHYA 2WF7A 4PYIA 1GDTA 1E1CB 1TUEA 1K8YB 4FIZA 2QX8A 1KJJA 4I2VA 3MSCA 4G09A 2QK4A 3WLQA 2OCLA 2FMHA 3PYXA 4K1LA 4LJRA 4PLFA 4HADA 3CX6A 1Q14A 1VG1A 1YKGA 2J87A 4R1LA 2R0QC 4YCMA 1MW8X 2GRAA 2PFSA 4ENWA 2COKA 2PEZA 2FDXA 4ZZ0A 3G23A 2Y1EA 1CQJA 4TVSA 3R6LA 4PVCA 2R6ZA 4NAVA 1T1JA 3EVGA 2FEPA 2JGAA 4DDTA 3W5BA 2OV8A 5LJLA 3NEPX 3OI7A 1Z5WA 3KQWA 2OOKA 3AR4A 3P9QA 4IJKA 4LECA 4ZC8A 5BQ3A 4TKZA 4N9WA 1NYQA 5JY6A 3DL2A 1TMYA 5BV0A 3PSHA 3U60B 1PQWA 3DNFA 3ZZ1A 1C7ZA 3P19A 4RTRA 5CLJA 2VK2A 1J2EA 2ZVDA 1WW2A 3RRYA 1Q1ZA 5CNMA 1V41E 2FGJA 1Z6AA 1ESCA 1LPNA 1TA9A 2PLRA 4N9QA 4Q3AA 2QR2A 3O1JC 1FZTA 5KU1A 5C46F 4EJSB 2YYZA 3PXXA 5FPPA 1PBNA 2XZPA 4F8EA 3BULA 3CBQA 3KTDA 1WCXA 3I9OA 1WULS 1Z4NA 1JBQA 3DYBA 3GC6A 4MVXA 2NMVA 3KT3A 1JKIA 3SBDA 3V32A 4K5QA 4WCFA 3I04M 2PZJA 4DCOA 3GLIB 3BDIA 1E4VA 3IPLA 3BUSA 1NMYA 1J07A 3JD0A 3PDCA 1GKIA 2YQ5A 4MQFA 3RFFA 1RM5A 3NONA 4ALMA 4QPPA 3QTLA 1XP5A 2O8DB 2B4YA 5TQ0B 1FJHA 2BFMA 3D3KA 3K8QA 3O73A 5ETJA 3DV0B 3GMIA 3PGLA 4YUVA 1X3LA 2ZYTX 4LF7B 4MPDA 4PC3A 3THOA 4KTVE 1ENYA 5HBRA 4CMCA 4HX9A 5DM4A 4IINA 2XXBA 1H4QA 1WXGA 2LDXA 3VYUB 3F1KA 4OLAA 3MF4A 3V7FA 1JRLA 3K9FC 1CEEA 1RKVA 1IWBB 2G0TA 3QEMB 2BM1A 5EYPB 4CLRB 1F0KA 3WWPA 4PFKA 2WNSA 1FP6A 2VJKA 4BU0A 4WOCA 2Q5FA 3H6GA 5SICE 3WYAA 2Q6OA 2RG1A 1DV1A 3ZZMA 1WV1A 2NVBA 3F67A 3LCJA 3GJRA 1TZBA 3OOHA 3WB9A 2OKGA 5IZCA 1XEXA 3OY7A 1EUYA 3DLAA 4LRYA 1RLMA 1OAAA 2WUWE 2W58A 3FH0A 3GLFE 2I8LA 3VOSA 2BSAA 2OMKA 3HKBA 1YJBA 3P9IA 4KC0A 3AHIA 1YR6A 4PYLA 2OBYA 3GROA 3FTCA 4TSKA