4BQSA

Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with adp and a shikimic acid derivative.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mycobacterium tuberculosis shikimate kinase inhibitors: design and simulation studies of the catalytic turnover.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bqsA00
2GXUA 3PQCA 3PUXA 2VHCA 3BC1A 2IYTA 3U6KA 1E9EA 1XTJA 2ZSEA 3OF5A 1ZYUA 5DLQC 4DLYA 4M0LA 2I1QA 5DI9A 1GM5A 1RJ9B 2P2LA 3KKQA 1NNEA 4MDFA 1KMHA 1UPTA 3R7WA 4NZYA 2N42A 1FMLA 3UWOA 1WQ1R 1G3MA 3WMEA 3ZD7A 1EFCA 5EE1A 5HTKA 1UM8A 4KI0A 4EUNA 1JR3E 3DPUA 3QKUA 1G41A 2ZJOA 2RCNA 3PUVA 1JR6A 2JAQA 1NLYA 2VLIA 2C03A 1YZTA 5EE0A 2ZSDA 5J4VA 2OO7A 2ERXA 4URUR 1E2LA 4OHZA 4B2IA 5L3VA 4ESHA 1UF9A 4H1UA 2H7VA 2V3CC 2EYQA 1D9XA 2IYSA 1Q22A 3PUWA 4Q1DA 3H84A 5AJVB 1AS3A 1OW3B 3PFIA 5KYKA 2C2HA 1FNNA 1HE8B 2FSGA 4OYHA 1G21E 1GRNA 4YLGA 1TL7C 3DOEA 4FXPA 1SKYB 4ZIRB 1Z6GA 2ZRIA 5TXGA 4B3CA 2XXAB 1ZBDA 5CJPA 2ZUCA 3KKNA 5LB4A 5JJKA 5EUQB 1HA3A 2GZHA 2AXPA 2ZJ5A 2H16A 1H8EA 5AR1A 2X8AA 4LJ7A 3W6OA 4B32A 2NMVA 4URVR 2PMKA 4B44A 2BBSA 5SZKB 2GF0A 4C7OB 2BCGY 3KL4A 2VA8A 4PZZA 4ZDIA 2ZS9A 521PA 5DHFA 1KK3A 4PPQA 3K70B 3HPRA 2HLDA 1MV5A 1KSFX 2X77A 2ANCA 1ZIPA 3BFKA 2JA1A 2VP4A 4RFSA 2QMEA 3WBJA 2O8DB 4PX9A 5FFMA 4TQAA 3VNUA 4OBEA 1P61B 2AD1A 3SFVA 1UADA 1W4AA 1N6RA 4BE7B 4LCBA 4DDTA 1NRJB 3OIUA 1MABA 1R5BA 1KY2A 4XVQA 3GJ6A 2FFHA 2G6BA 1LF0A 2B8TA 5SZHB 3Q7QA 1S96A 1C1YA 1XFAA 4J0QA 2HYDA 3QKSB 2VSFA 1U98A 1NBMA 1NN1A 1XZQA 5E3HA 2A5GA 5FL3A 3IHWA 4MA4A 2ZYVX 1QHXA 2ZRJA 3Q3JB 5FPHA 2VTKA 4B3BA 1OXTA 4ZCLA 1SVSA 3IQWA 1T5LA 4KYUA 4RD6A 4KAXA 4V03A 1FP6A 4Z1MA 2G0TA 3A4NA 1P5ZB 5CLQA 4IKEA 2FEMA 4OQLA 3CF6R 1XD2B 1Z3IX 1ZD9A 4NYJR 1FW6A 1S3GA 1SVIA 4MGKR 3MWLA 3U3RA 4JLMA 2NO6A 3QXCA 3GJ8A 5HPYB 4BLPA 3EWSA 3AVOA 2QAGC 3NEJA 4TMVA 5DI3A 4TMXA 5JMTA 1IQPA 1WBDA 1N0VC 4DLRA 1ZRHA 5JJLA 1ZU5A 2FMXA 4OK5A 4BLSA 1HH4A 2ZRFA 3IPXA 3R9IA 4TLDA 3I32A 1XJCA 5JEEA 3L8ZA 3BOSA 2UZIR 4OQFA 3AKYA 1G8PA 2IYRA 3KB1A 2OAQ1 4WOPA 4MGZR 3SJZA 2G0NA 5H68A 3TW4A 3GLGA 4JLBA 3RRMA 1MABB 1I4LD 3OEEA 1JPJA 4CT4B 1Z5ZA 1RW4A 1KI2A 1ZUHA 1SVKA 3EG5A 5C18A 2OBNA 1YHNA 1OH5A 4EFNA 2ODBA 2DWOA 2YOHA 2GEUA 3R9XA 1WRBA 5FR1A 2ZUBA 5LPNA 1LV7A 1LY1A 1N3BA 2CCJA 2X2FA 5JSZA 4KSBA 5HZHA 1DARA 1HV8A 3NH6A 5KSYA 1VECA 1RC8A 1BKDR 4PSVA 2O8CB 3CF0A 5FTLA 4DLSA 2BMEA 4UXHA 2ZRKA 4JKYA 1EFRA 2VH5R 3IILA 4QJ5A 1OH8A 1A1VA 3AVPA 1G8HA 3B1WA 4CW7A 1XTRA 1KYIA 4LJ9A 2AKYA 4FN5A 1K8RA 1E2NA 2QRZA 4NKRA 4Q4JB 1OSNA 4IFEA 2P0EA 5DGXA 1U0HC 3OE7A 5BW8A 2O8BA 1C9KA 4LHYA 4LX0A 3B85A 4DWJA 4A8JB 1GITA 2KI5A 4X8OA 4ZV4A 3GLIE 4HEJA 2X19A 4NU0A 2MSDB 2QAGA 2RHMA 3W3AA 5FPYA 2XAUA 4B76A 3PUZA 4V0ME 1NVWQ 4TMZA 4BQSA 4O3MA 3RANA 1E9RA 1VG9B 2Z0MA 5A5GA 1XTKA 5E95A 5GJCA 1KKMA 3W34A 2WWIA 3OEHD 4TL9A 1XZPA 1VKJA 2RGEA 1E4YA 5FTJA 3UKDA 4TL8A 3RABA 4R71A 3ZD6A 4FD2A 2NO0A 1N0WA 1S3SA 3GJXC 4IEIA 2A5JA 5HKKA 4MKHA 1UDWA 2LKCA 2ZJAA 4QGAA 2R6AA 2QORA 1J7KA 3QEOA 1R10A 3T35A 1OH7A 3F0TA 1FP7A 2ZI3A 4M1YA 2J41A 4KO8A 1RKBA 4IHQA 2ZVQX 1GOTA 2CJWB 4EPTA 2XEXA 1YE8A 2LWIA 1W46A 3MAAC 1NN5A 3BRWD 4WAUA 1LS1A 1QHSA 4RJLA 3T06B 1QG2A 2QEQA 3BBPA 3S1AB 4CDGA 4CEHA 5GJWC 3WYAA 1M1YE 2QSZA 5FBLB 1P2TA 3CX8A 4LDJA 1DS6A 2D2EA 4ARZA 3ZGXA 2FZ4A 3ICEA 2IYUA 2RGCA 3TBKA 1HY3A 3LBHA 1BYIA 1E0SA 1G17A 1XEFA 1ZNYA 3K0AA 3JVVA 2YWGA 5D3MA 5DN6D 1B23P 2ODEA 1KO1A 2YWEA 3AF4A 3KZ1E 1U8YA 4OL0A 4TLCA 4WZAE 4M9SA 4KYIB 2W58A 3N70A 5FOSA 1H8HD 1KO4A 2D3WA 2YHSA 1SULA 3MFYA 2LKDA 1SKYE 2ZRGA 3OEHA 1IN5A 4LK2A 2IS1A 1JB1A 2GILA 4LYFA 4DJTA 3IUYA 2PH1A 1X1RA 1G18A 1U2RA 1W2GA 2IXEA 2JLUA 5IRCD 3F3YA 1UBGA 2V8OA 3RS7A 4AKEA 4FMCB 3RS5A 1ELOA 2A30A 1X6VA 2BIFA 1G64A 4RD4A 1EFTA 2OM2A 3W8RA 3C14C 3JZMA 4DCTA 4EJSB 1OT3A 3QEJA 4LJ5A 3QQ5A 3P4XA 1M2OB 3AP3A 4PC6A 5EXTA 5CIQA 3AH8A 4M1TA 3KTAA 4PO1A 4RZ2A 1N0UA 5K8TA 1E9DA 2GEDA 3SEAA 2J1LA 2DFNA 3ZQ6A 2I3BA 2RGAA 1X8JA 3PIRA 3A1VA 3K0EA 1Z0IA 1SKQA 3FB4A 5FBQB 4Q9HA 1KIMA 3U7HB 1KZ7B 4XD7A 4W7SA 2RGDA 2AWOA 1CKEA 1HEIA 3AKCA 3M0EA 4NDZA 4ZKEA 2VF8A 1NKTA 4JL6A 4ARZB 3AUYA 4L8GA 1GKIA 3WRYC 4LHXA 2GCPA 2RAPA 3N2EA 1KNQA 4Q1EA 3RWOA 2Q9BA 2ZU0C 4BEBA 1W4RA 4I1UA 3DDCA 4DCSA 3OEED 3QXXA 4BFYA 2GCOB 6Q21A 4LYJA 3NBZC 1XTQA 4XTCS 3VHLB 1TUIA 2DFTA 3KJEA 3LVRE 2KBFA 1OKKA 4GSYA 3PEUA 2FSIA 2JLZA 2ZRAA 3DO6A 5FOUA 2ZE6A 1U9IA 3R8CA 1FQKA 2ZS8A 4R7ZA 3RC3A 1ZC3A 3CNNA 3EZ2A 3H4MA 1ZD1A 3QUSA 3KQKA 3FOZA 2ZUDA 5EZ5A 3KQUA 1LS6A 1ZUIA 3VQTA 4P31A 1TQDA 1G20E 1K5GA 2CL0X 3KTAB 3TUJC 5C46F 4F7WA 1AKYA 3UWKA 3ND8A 3DHWC 3VNVA 4DDWA 4PC7A 4NMMA 3BK7A 3N5CA 1RPZA 4NYJQ 3U5ZB 2GBLA 2QY9A 4D4KA 2QPOA 1YVDA 1FUKA 4B73A 4CEJA 5F9HA 4E22A 2PL3A 1R5OA 4DHEA 3RNLA 5KPJA 3SDZA 3KJGA 3CKLA 1LB1B 3Q5EA 1CU1A 3QKSA 1KJYA 1IBRA 1KNXA 2IYVA 3X2SA 4EQ6A 2Q3FA 2PZEA 3D6TB 1ZW6A 5KUTA 3DOFA 4M1OA 5L3QB 2V6JA 3MMPA 3LO5A 4FMCF 4L4UA 3U7EB 1I4TD 2XB4A 1MRNA 1M6NA 4CGZA 1GG2A 2OUKA 1BYUA 3IO3A 5KSPA 3WNCA 1KI6A 2ZJBA 3IEVA 5DNYB 2ZETA 4JZKA 5IDVA 5BN3A 2GAOA 3RSLA 2Q9AA 1JAIA 4LUCA 3ASZA 3QBVA 1Q1ZA 2F9LA 4DB2A 1E2PA 4K46A 1AQYA 2P5SA 1G3QA 2AN9A 4DSNA 4OHWA 4NONA 4GOJA 4CF7A 2JLWA 1T4GA 3MG9A 1XMSA 3EC1A 2JLYA 2NO9A 2RGBA 1KK2A 1DAIA 3QVUA 4IOMA 4RKFA 3KXKA 5DI3B 2R62A 4HI0E 1II8A 1SZPA 2GJKA 2J0UB 1OXVA 3EXAA 3P26A 5FOWA 2FU5C 2GTPA 2XJ4A 2P3SA 2PX3A 1JECA 5EUMA 1Q1QA 1H8ED 2J45A 4PQFA 3OIYA 2YYZA 2AL7A 2VP2A 5EE3A 1TAGA 2FFQA 1W0JD 2F1HA 3GEIA 3HR8A 2R6CA 3L0OA 2XOKD 2GXAA 2BHRA 3BH7A 2I4IA 2PEZA 4OI2A 4GZMA 3W90A 4JYCA 4UNRA 4DB4A 2R2AA 4EJSA 4AKHA 4I4LA 5TB5A 1W4CA 1KDTA 2R65A 2YC2C 2Z43A 1N6LA 2ZITA 4QXAA 1QHYA 1XDBA 1P7CA 3U44B 2WWXA 4TYNA 3K8YA 5K8LA 1CIPA 2WPDD 3BH0A 4O2LA 4D6PA 4M21A 4Z51A 1ESNA 4QJ4A 3I1FA 2HCBA 4KVAA 4G5RA 1EG7A 5J4LA 1PLKA 1RRPA 4B3FX 3U60B 3THWA 2YWFA 1SQ5A 3RSOA 2HEIA 5EE5B 1FX0A 1UBCA 2PT7A 3LA6A 1SVWA 4NYIQ 4U00A 4C30A 5JFGA 4A15A 2WICA 4B48A 2JJ2A 5L8VA 1ZNWA 2OFWA 4KBFA 1E1QA 4ERNA 4OQXA 1W49A 2XTNA 4JLAA 2F1IA 4P0TA 2FFBA 5G41A 2BC9A 2CL7X 421PA 1JJVA 1NF3A 4DEXA 1WDTA 2OEPA 1DAGA 2QZ4A 3X1YA 5CLLA 1P75A 1U0JA 4BGDA 2JJ1A 2Z6VA 2FV8A 2QMUA 2DFKB 2BMFA 2BVNA 1E2MA 2ZVPX 4E07A 4A9AA 2FSFA 1K6MA 5IF9A 4C2UA 4F91B 4YC7A 1Z6TA 4XWOA 5HCIA 1NVXQ 1DG3A 2DCUA 4PXAA 3U3OA 3PUYA 1Q3TA 2D06A 1YZKA 1SXJA 3DEFA 1Y63A 3OHMA 5E4FA 4DIDA 4JLPA 2WJIA 2CBZA 3PEWA 3RS3A 4MGIR 3TUZC 3AV0B 4LYAA 2C78A 3NXSA 4TQ9A 3UK6A 2C5LA 4CIDA 2YNMA 5LDDC 1MRSA 1P6XA 2WJJA 4PAMA 5AUQA 4DCUA 1RYHA 2ORWA 3AVUA 4TLEA 3BFXA 4GFDA 1IN7A 2KE5A 2ODWA 4RY2A 2XZLA 3B9PA 1JI0A 1GWNA 3C5HA 3S1AA 1D8TA 4L9SA 4QBHA 1NLFA 3GLIA 4CEHB 5JI3E 4M9XA 1M74A 2ZREA 4A0HA 5JRZA 2EW1A 4BRWA 1OXXK 3QI2A 1CJUC 2EFDB 3FFBA 4YXWA 3FMFA 4XOIA 2FA9A 5J4YA 3QG5A 2DR3A 3BFVA 3C15C 1OIVA 4ZCIA 3UG6A 2H8KA 4KCGA 1G8FA 3CX7A 3VX4A 3CONA 4TLBA 1QHIA 5JI2E 1E9SA 2YKGA 2ZAOA 4GP6A 1XBTA 2KSQA 5FUYA 5GVSA 3T1QA 3F5FA 1A2BA 3OE7D 5BN4A 1XP8A 2QROA 3K9LA 1U99A 1IXRC 2QRNA 5EXSA 4RSGA 2ZS7A 3CLVA 5FH9A 1NKSA 1VMAA 1KDPA 3K70D 2WBLC 1EXMA 1ZM3A 3JZAA 3KKMA 3V4RA 1NY5A 1NLZA 1RVDA 5D3QA 1VCMA 4TTPA 5E7IA 3VR3A 5FOVA 1Z07A 5JCPA 2J7KA 4S35A 2QM8A 3RYTC 3QPVA 5AUOB 1VYTA 3IKJA 1DO2A 3U4QB 1S1CA 3Q85A 5EP1A 1VG1A 2F3TA 3MRSA 4HAXA 1G5PA 2F7SA 4URZR 4M9ZA 3GLIB 4JLJA 2P65A 4Q4HB 3HWSA 2WJYA 5KDLA 4V02A 2BJVA 5FBWB 5BYKA 4P32A 5JWOA 4PAQA 1GL9B 1L2TA 3CPHA 1U8AA 1TU3A 3LX5A 1EFHA 2B7BA 2YZ2A 1DADA 2ZAMA 1Z6AA 2V6IA 3HR7A 2QAJA 1JAHA 3IPYA 3TUIC 4D0LB 3AGPA 1XX6A 4QFMA 1S9HA 4AKGA 4PSAA 1YQTA 1OYWA 2IEYA 2EVWX 4XVRA 4URWR 3WP1B 3E2IA 1JJ7A 1VIYA 2VHTA 4TTRA 1T5IA 1NJFA 2HCJB 4F4IA 1PUIA 3KX2A 2XJ9A 2Q3MA 4YMUA 2YOFA 2XSZD 2ZYUX 1KJWA 5EP3A 3TGPA 1NIPA 1UBFA 2L0XA 4B6EA 1WP9A 3SU8A 1XD2A 3T12A 2W6JD 4IXMA 1V43A 4NYMQ 4PANA 1R0YA 1PZNA 4BWYA 3FYHA 4QG7A 3E1SA 1CS4C 1XJ0A 1YZNA 1W48A 3DKVA 1G7SA 4LBVA 3NH9A 4US2R 1CXZA 4PPGA 2CMKA 1A82A 2VRWA 1RFLA 3KXLA 3TR0A 2IWRA 1Z8FA 1M7GA 4HLCA 1W5TA 5EJEA 3EZ9A 1E94E 1VHLA 5CJ2A 1UAAA 4EAQA 4DLTA 2FPLA 2NTYC 2VO1A 1XPRA 4UJ3A 3LNCA 3IIKA 3RS2A 3BAFA 3BB1A 5E7MA 2IS6A 1Z0KA 1BMFD 4KFRA 3WMGA 1TQ2A 3SE0A 2ZI5A 1G4AE 4NHOA 1W36D 2WWWA 4A8JC 5JEDA 2OSBA 1XCPA 4G01B 2ORVA 2ZRLA 3Q8XB 1L4UA 4TMWA 2O8BB 4MUAA 5A0FA 5F9FA 5AJWA 2O8CA 4PQYA 2IA5A 1SXJD 2B92A 5LB2A 4DLXA 1P60A 1EX6A 5KPDA 5JECA 1XU4A 5CB6A 2OZEA 3KDSE 4EPWA 5TVKA 5BWMA 3EW9A 3L0PA 2ANBA 3RWMB 5ELXA 2CXXA 3B2EA 4P33A 2P6UA 4LZZA 3H0KA 4I1SA 4MUBA 5BQ5A 2IS4A 3CZPA 3I72A 221PA 3SJAA 2MSCB 4V0MA 4BFVA 3GPLA 2J59A 4JSTA 1T8UA 4BZXA 3W8NA 3B8HA 3FHTA 2PMDA 4B74A 2OCAA 2CCGA 1AKEA 3T61A 2CNWD 4YXWD 3I3SR 5J47A 4B3XA 1AM4D 3LW7A 1E2KA 2XITA 4HLUA 3ZVNA 2G1JA 3EARA 2XZPA 3U6BA 1AIPA 4XSGA 3AM1A 3U3KA 3TSWA 3PCRB 3EIEA 2A7QA 1Z63A 3A1SA 4Q02A 1T91A 1NMYA 2GWHA 3P1JA 3UIEA 1N5IA 1GTVA 3M4YA 1QRAA 2QMHA 2ZE7A 3ONWA 1DOAA 3QXJA 2NPFA 3SYLA 1XD8A 3LH5A 3GEHA 4FMBB 1R0ZA 1FQJA 4KLZA 3CUEF 4GT1A 5KNBA 4JS0A 3B1YA 1CJVC 4H9GA 1OYYA 2JIZA 3IDQA 3TQCA 1Z0DA 3WRXC 4TTQA 1N6KA 4WBSA 1IONA 2QBYB 4X8MA 2ZI7A 2IS2A 4B35A 4GNKA 3EASA 4FWIB 5F98A 2QP3A 1Q44A 2QN6A 4D0NA 1KMQA 3CM0A 3K0AB 5D3MB 5BXQC 1BO6A 1QHNA 4ILEA 1YZQA 4PO8A 4X8HA 1IY0A 3DVLA 1G4UR 2D74A 3H2YA 2HV8A 1VDZA 3QY0A 5JWHA 3I73A 3QPWA 4JVNA 4KITB 4BASA 3GJ4A 3UPUA 1E1RD 3SS8A 2ZANA 5F2EA 4QOSA 1HQCA 1KGDA 2ZRNA 4Q18A 4Q00A 1NN0A 3P20A 2X2EA 3AF1A 2OFOA 4L16A 4GOXA 2AWNA 1KDRA 2F9MA 3TR5A 5AWFC 4LHVA 4GMDA 1GKUB 3U7FB 5UKDA 4D4LA 4QM6A 4M1SA 3EC2A 4OJKA 2ZR9A 1TTTA 2ZSAA 5FTKA 4W9MC 2ZJZA 3ZJYA 2C9OA 2IXGA 3BWDD 1R7RA 2PCLA 4V0NA 1QZXA 2BCJQ 4B71A 1FOEB 2WV9A 4FIDA 1SHKA 2QTHA 2Z4RA 1FTSA 3D3QA 3EIHA 3SHWA 3K70C 2J0SA 3A58B 2W83A 3LXRA 4KODA 5JHHB 4CEIA 4NBSA 2WSMA 1CR0A 1X3SA 2GHIA 2QL6A 1E9BA 2YOGA 1VYVA 4WW0A 4Q1BA 2VF7A 2ZR0A 3NBYC 3SJCA 2WKPA 3O8BA 1UEJA 2G77B 3W5IA 4URYR 3LX8A 2FE4A 4QHYA 1IAQA 3IQXA 4C9BA 2XNSA 4QRHA 2TMKA 1F2UB 1MT0A 2D4HA 2ZE5A 3BORA 2FDCA 2AK2A 2C95A 1VCNA 3L0SA 4EQ6B 3ADKA 2REOA 4LHZA 2O52A 3VMFA 2WAYA 2W0MA 2QENA 5IHPA 3KJIA 3GFOA 5A4JA 5AK0A 3IBGA 4AKIA 2JIZD 4X8LA 4ZDKA 2V1XA 5BYJA 5B64A 4NE2A 1KO5A 1M34E 1II9A 2WJGA 5B2ZA 2O8EA 3E70C 2GZDA 3U2QA 3THYA 1PJRA 4LJ6A 3LLMA 1A4RA 3C4JA 4HATA 1G8GA 3IIMA 2JLSA 1CEEA 4A2QA 5AJZA 2QU8A 2IEZA 1QF9A 2XNDD 2C98A 4LV6A 3I4LA 2F3RA 1GUAA 4IOLA 3ICQB 4HSEA 4AWXA 5K8IA 1Z28A 2F43B 2BJWA 1XEXB 2BKUA 1R0WA 4W5JA 1NY6A 3RDPA 4HDCA 1YRBA 1NMZA 1II8B 2IBMA 2J0UA 3ADBA 3LBNA 2C9CA 2FFAA 1P9WA 4O2RA 1JQLB 5CM8B 1E2IA 2N46A 3VR2A 2G88A 2JEOA 2JLRA 2VQSA 3GLFA 3EAQA 3KQHA 1E9FA 1LW7A 3CB4A 2C9YA 4OI1A 3D8BA 2IHBA 1NJGA 2VEDA 2RGGA 3NDPA 4KXFB 3X1XA 5LD2C 4L15A 1D2MA 1G6HA 1OXSC 1OJLA 3DM9B 4QNMA 4OK6A 2VBCA 3VTKA 5JHGB 4LBYA 2CHQA 2ZRHA 1W4BA 2CHGA 2IXFA 3FWYA 3VR6A 1E0JA 2W2TA 3Q7PA 2IYQA 1OF1A 2HDNB 1Z22A 1YR9A 4HB3A 3VR1A 4BLTA 2QT0A 4JL8A 2ATXA 2Z83A 3MSXA 4UXIA 3ZZUA 3THWB 1OB2A 1NG1A 3BH6A 3EZ6A 3NKVA 5DYIA 3UMSA 3GFPA 3THXB 2AKAB 3LDAA 4G5GA 4C0BA 4TSFD 2EWVA 2R44A 3AEZA 3VFDA 4CRWB 4Q1CA 1B0UA 1M7BA 3CX6A 1U0LA 1N6IA 1VG8A 1VCOA 3X1ZA 3LAWA 2KBEA 2QMOA 4NH0A 4A36A 1SVOA 4DDVA 4RD0A 3SFZA 1KY3A 1UEIA 4PC3A 1UDXA 4L9WA 3X1DA 2VSOA 2R9VA 4C3ZA 4LJAA 5HR5A 5EXXA 2C96A 3CRQA 3LQRA 2HYIC 2NO1A 4A8JA 2BV3A 3IGFA 1L7VC 4MKIA 1ETUA 2NGRA 4TMTA 2B8WA 2ZRCA 2WWGA 3L8YA 3MUFA 2WTUA 3SHFA 4IVPA 1MR3F 2OXCA 3LD9A 5CDFE 1CJTC 1F6BA 3LRPA 1Q57A 5DIFA 1D5CA 5JS7A 4GOKA 4CEJB 1ZAKA 1DAKA 3AF3A 2VP0A 3HPQA 4MKFA 2CLDX 3QKRA 1CULC 4Q4HA 1KI8A 3KUDA 5DYGA 1G6OA 2REBA 1DG1G 2OESA 3CNLA 5GVRA 2JJ2D 1W2HA 5GJVC 2CL6X 2Q9CA 5KDDA 4GPTA 4LC1A 1R2QA 1GVNB 2C99A 4BFTA 1AGRA 2R6FA 4ZPXA 2QG6A 4P3YA 4I1VA 2OAP1 4Q7JB 4IOKA 4BUJA 4MRVA 5FPSA 4MKGA 1MO5A 4B3DA 3CPEA 3HU1A 1WE2A 2O8FA 1JEDA 2FX3A 3KKOA 4JYBA 4UNPA 2FJUA 2IW3A 2VL7A 2OBLA 2CE2X 2GJAA 2UZ3A 4ACAA 4GMXA 4FMDB 4PHFA 1UFQA 1BS1A 1P3JA 4JLKA 5G3ZA 4M1KA 2DHRA 4Q7KA 1WA5A 3UMRA 3ZIAD 2IF2A 1T0HB 2EQBA 4DC9A 4TL6A 4AG5A 2O8EB 2J5XA 1R6BX 3OFNA 2W00A 2UKDA 2DY1A 4MRRA 4TSFA 2QAGB 3OAAD 4QBFA 1ZM2A 3CPJB 5DE3A 3SC3A 1UKZA 4TN1A 4U7DA 2ONKA 3KFVA 5L3RA 3H86A 2D7DA 1O87A 4FCWA 2RMKA 2PT5A 4DUGD 2DPXA 5CB8A 2W6IA 3BERA 2PLFA 5FPTA 1TUEA 2ZIAA 5CYOA 2WVJA 3NEYA 2WSSA 3W6NA 2V54A 4D4JA 1RRCA 3AKEA 3C7KA 3RRNA 4GP7A 1G5TA 2F55A 1J99A 2GJSA 3CW2A 4NCNA 4AURA 3A37A 4BFXA 1PV4A 1LTQA 3B60A 2GAAA 4CEIB 1US8B 3HU2A 4HAUA 4I1OA 4UKDA 4OQMA 2JJ8A 1IY1A 3BGWA 4RD1A 5TARA 1ESMA 2BEJA 2VYFA 5FL7A 2CE7A 1EX7A 4D80A 4MITA 4HYYA 4C2TA 3DZ8A 4QKQA 1U94A 3TH5A 5AUPB 4JJKA 2EFGA 5FUVA 3TVDA 2WAXA 2HF8A 3DM5A 2AFHE 4HB0A 3F8TA 3PXGA 4A0FA 3EPLA 2J46A 2JATA 4G5SA 1NVUQ 4DCNA 5J40A 2NIPA 1D6JA 4FINA 3PENA 1X8LA 4ITRC 2CNWA 1CLUA 1KO7A 4LBZA 1GRRA 3D7MA 3OAAA 4QL3A 3THXA 2QUZA 1M8PA 2EWWA 4JLDA 4KSCA 1X1SA 2GJ9A 4IVQA 4LV5B 1Z6XA 3QVVA 1XPOA 2YV5A 4FI3C 1XTIA 1ZJ6A 5J4KA 1XWIA 1RYFA 2W6ID 2Z5FA 1Z08A 4Y0AA 2JDID 2XXAA 1Z2CA 2GK6A 1ZVQA 3PEVA 4RVCA 4LSGA 5FI1B 3CWQA 1DPFA 4XJXA 4UNNA 1AK2A 1KI7A 4PZYA 2J7PA 3QKTA 5CK4A 2H18A 3NIBA 4V0LA 1EFUA 2D62A 4IOJA 4CYMA 1F2TB 4NCJA 3B82A 3DMNA 3VKWA 5AJYA 2KWIA 4F38A 2XB2A 2FSHA 1BOFA 1GAJA 1E0KA 2GCNA 3BJIC 3QXHA 2J3EA 3ZH9B 1D9ZA 2W6JA 1I4DD 4IW3B 5H8WA 4PQRA 1UBEA 1TPZA 2ZROA 1S1MA 2HUPA 2CDNA 1KMHB 4C0KA 2F1JA 2OCPA 2KJQA 3PITA 4EFLA 4US1R 3LV8A 1QHHA 3HYRA 4IXNA 1OKKD 1G291 1C4OA 4G3XA 5FR2A 2AR7A 1WF3A 4F4JA 2EFHB 2RH5A 1KOFA 4WXPA 5J4HA 4MYTA 1CRPA 1VYUA 2QM7A 3WBKA 4BLRA 1PVOA 2JLVA 1G1MA 2VHQA 2ORIA 1IJFA 3BB3A 3IEUA 4KJZA 5FTMA 3B1XA 2SHKA 4MRSA 2VPPA 3QENA 4JSYA 4JKIA 4B33A 1W1WA 2BOVA 3CH5A 4P4SA 2P67A 1G7CA 2H57A 2FGJA 2R8RA 721PA 2CCKA 3QF4B 2ZM5A 3SJBA 4LRWA 3WXMA 1XJQA 1TMKA 1L4YA 4I81A 1NVVR 2ZQ5A 1GL6A 4NYIR 4Q1AA 4ESVA 4NL4H 5H70A 1YZUA 1XMVA 4EPXA 2H17A 2H1LA 3EA0A 1CRQA 1E6CA 4S2EA 1MO4A 3WHKA 3EZFA 3C5CA 5DHAA 2QP4A 1XEXA 2OT3B 4HDOB 4V0KA 4BZPA 4LV8B 3LQQA 5CIWA 2ZR7A 2GBLC 1OIXA 3N2IA 5KTYA 4LJ4A 2QE7A 2VHJA 2GESA 3K09A 4Q9IA 4Q9LA 5EE9A 1JR3D 1EGAA 1E2FA 2JDIA 3FFAA 1RZ3A 3K0FB 4N0EA 4RZ3A 2IX3A 3GLFB 3GP8A 2PZFA 1DAEA 1E2QA 1FMJA 2FWRA 5KO2A 3CRW1 4RFSB 1UKVY 4Q7LA 2XTZA 4PTLA 1GL7A 1UKEA 3WNBA 4TYYA 4GL2A 1UKYA 1KAGA 3M1IA 1ZMXA 3MWKA 1YR8A 3RAPR 3U3MA 1OFIA 3PG5A 3K9HA 2DBYA 1DAMA 3VR5A 3U44A 3W5JA 1ZU4A 3FMPB 3CZQA 4DDUA 4MYCA 1ZUNB 2A78A 2EYUA 1G5RA 3FMOB 2K5UA 4MRNA 3RS0A 2HXSA 2C8VA 4JJZA 5L3QA 1S2MA 4LWZA 2DFLA 2G3YA 2HLDD 1J90A 1BH2A 2ERYA 2WSSD 2FOLA 1DE0A 2A5YB 4M53A 3THYB 3AVXA 2WJHA 4UJ5A 3K0CA 3SQWA 3C41J 2ODNA 2XSZA 1WMSA 1ZNXA 3KKPA 1W44A 4ZIRA 1W36C 5L3SB 1YRAA 1XF9A 4TT3A 5CK5A 4QGFA 1QVAA 4O0MA 4EDHA 2AX4A 4EKDA 3SQXA 4ZDJA 8OHMA 3LVQE 3OIWA 4M2LA 3ZDQA 4D4MA 1XMJA 2DB3A 2AD5A 3ADDA 4O25A 1GSIA 2F1RA 4TL7A 4FMDF 4LY6A 3Q9LA 4CT5A 3LXXA 1N5LA 3H1TA 3NBFA 4R9UC 1XCMA 4JVLA 5EZ6B 5KHOC 1Q1BA 4Q4AA 3GCGA 2MMCA 3ZS8A 3SBDA 3ZVLA 3GD7A 3L82B 4G0NA 3BD9A 1Z29A 1E69A 2V9PA 1W47A 3QJYA 4OHVA 1KK1A 4BECA 1XEWX 1AA9A 4EPRA 1G7RA 2BBOA 2GVDC 4DLZA 5HZKA 2WZQA 1ZINA 4PC2A 2OHFA 4PPFA 1LNZA 1MO6A 3NHBA 4A0GA 1J2JA 2CLCX 2VIIA 1MO3A 2RB4A 4JBXA 3A1UA 4N1AA 2WPDA 4A2PA 2V1UA 1U90A 4UXJA 1T9HA 2WOOA 3CF2A 4M1WA 2DYKA 4D2IA 1T3LA 2ZI4A 1GNQA 2B7CA 3OESA 4HAZA 1DAFA 2NOAA 3THOA 5E7JA 5IK2D 2ASEA 2PZGA 2CVHA 1KJZA 4C4PA 2EFCB 2FPKA 1OIWA 2KB0A 4XTRA 5M04A 2W2VA 1PUJA 4PHGA 4HLQB 4W5HA 1GP2A 2PLRA 3CWZA 1S0UA 3U7GA 4TZ0A 4DSTA 4WA7A 2E87A 1CTQA 1FX0B 2GJ8A 1JQJC 2IUTA 4Q4LA 4OK3A 1Z47A 2IYWA 3PEYA 3MCAA 3GEEA 4U5XA 1OPXA 4II7A 2QQEA 4OI0A 2BBWA 4QJ3A 3WNDA 1EESA 4E5UA 1MH1A 5JRJA 2OXRA 1R4AA 3TKLA 1G19A 1ZNZA 3GQBA 3B5JA 3EWAA 4DLVA 2GK7A 4BLOA 1P4SA 1KZGB 4HLUC 4KVGA 3EPHA 1E2HA 4YQFA 1Z06A 4HUQA 3K0SA 1SVLA 2BM0A 3A1WA 2V4ZA 3ZVRA 1X8KA 1AZTA 1X86B 5TDHA 5BN5A 3DMDA 3SN6A 3T1VA 1KSGA 5DN6A 5EP4A 1W0JA 3RHFA 3A8TA 2QA5A 1W5SA 1T3HA 2FGKA 1YJ5A 1HYQA 3DZDA 1SXJE 5FUWA 1ZD8A 1EFRD 1GNRA 2IK8A 2W0SA 4M8NE 3NDBB 2AHOA 4HDQB 5IT5A 3T5DA 2EFEB 1ZCBA 1N6OA 2FG5A 1E79A 1GRQA 3B6EA 1S4QA 4IEEA 1DAHA 1T6NA 121PA 4JT4A 1A7JA 1QBKC 1XTSA 4YDHB 4Q7MB 2BMJA 2ZRPA 3CRRA 2GVZC 4DVGA 5GADl 2OCBA 1DO0A 1NSTA 2AK3A 5JSZB 1W7AA 3UXMA 2ZSFA 3G5UA 4QBGB 4JIMA 3O8RA 2JCSA 3HDTA 5DSZA 2JLQA 3A1TA 2O8FB 5KSZA 4JBYA 3O8DA 1GDDA 2NZ8A 5CYPA 2D2FA 3NG1A 3EPJA 4HUTA 1A5TA 2GETA 2O0HA 2YWHA 5EQTA 5SZJA 2IYXA 3UANA 5F3WB 3FDIA 4DSOA 2ATVA 3VX3A 2XNDA 1JBKA 4AK9A 1Q12A 3I62A 2GKSA 1TEXA 3BE4A 3P32A 4JBWA 1F48A 2IC5A 3MWYW 4LYHA 4Q4JA 5G40A 3UMFA 3FKSA 1FPMA 2CHVA 2MMGA 5TY0A 4R2HA 3VU9A 3FHCB 3REFA 4P4UA 1FL9A 1ZIOA 3GLGE 3K1JA 1ZM7A 1W0KA 1QHGA 2ZYTX 1OHHD 4IDPA 4N3NA 2J0VA 1E1QD 4Q9JA 3B13B 1ANKA 1J70A 5L3SA 1IN4A 3EIQA 3KFXA 1NSFA 3HU3A 3QXSA 2D7CA 3W6PA 3E5HA 4KV9A 2ZXUA 2FPMA 3V00A 2CK3A 1NP6A 1XNJA 4RD2A 2GXSA 2OLJA 1DVRA 3MJRA 2Y8EA 2ZRMA 2IF0A 3RC8A 2VSXA 3I5XA 4DUGA 3NBXX 3QBTA 1D2NA 2JLXA 4US0R 4AYWA 3GLFE 4B6FA 1NVVQ 1AJEA 4ZKDA 1II0A 2WOJA 4AC9A 1H8HA 2OFXA 2XTMA 4LGMA 3AQ4A 5SZIA 1XB2A 4D26A 1XD9A 4IRUB 1E79D 4NCIA 3QIAA 3A36A 1SGWA 4ASUD 4YMWA 3QKRB 3REGA 4DBLC 2HT1A 4IDQA 4WIAA 4Z8XA 5DO9A 3J81k 2QBYA 4XVUA 1E98A 3CRMA 2QI9C 4K81B 3PJRA 1Q3HA 3PVSA 1SVMA 4OI4A 4AYTA 1KO8A 1ZCAA 1HURA 3TJZA 4F4CA 4PPNA 1HUQA 2QE7D 2ZJ8A 4LC0A 4NPHA 3ADCA 1FUUA 3MLEA 1Q0UA 1COWD 1JR3A 4EPVA 3SYKA 2Q21A 4H1VA 2UVQA 1KSJA 1V5WA 2EU8A 1P62B 4JLOA 5J5CA 4ABYA 821PA 3LLUA 4OJQA 2J7PD 4A4DA 3BS4A 4UQOA 2ZU6A 4B75A 4K8OA 2GZAA 5JS8A 3AVTA 4HZUA 4A82A 2IYYA 1OV4A 2NG1A 4PHTA 4Z1MD 3VR4A 3K53A 1GNPA 5C4GB 4B2LA 1N2CE 3AP2A 2GF9A 4CZ2A 2BM1A 3W9YA 3I8XA 4DEYA 5GJBA 1AGPA 1CF4A 4QGHA 3GJ5A 1Z83A 1T8TA 2OLKA 5HCNA 5CITA 2QT1A 3LW8A 1U9IC 4Q4AB 3MJHA 5C2JB 4N0DA 1GILA 3GLHE 1Z2AA 4PHHA 1TX4B 1LVGA 3GLHB 2GNOA 4Q47A 2C04A 1N6PA 2WM9B 1FTNA 4HAVA 4PC1A 1RJ9A 4WZ6A 2FN4A 3FTQA 2ZRDA 2VP6A 4OHXA 3HJNA 4WVFA 4BEJA 4Q01A 4M4SA 1XMIA 3I92A 1G7TA 1Z0FA 2J9RA 2QGNA 5H1YA 3L43A 1KI9A 3B78A 2H5EA 4A6XA 2RGNC 1GIAA 5KOYA 3RS4A 4KBGA 1GFIA 3TVTA 3MWJA 1FFHA 1T0JB 3FHOA 3EZ7A 3LWNA 1COWA 4DKXA 1IXZA 4D81A 1WBBA 2GA8A 1S8FA 1NMXA 2O0KA 4GZLA 2CJWA 1TF7A 2WHXA 3NTUA 3QOFA 4QNRA 4I99A 3ZZTA 4C0JA 2VHUA 4B43A 5C4MA 3U61B 3RRZA 4B3GA 3SI7A 3TRFA 4QGGA 5CDFA 3VKGA 4P4TA 2E1RA 1E32A 1IY2A 4OQNA 4E03A 1R0XA 2V7QA 4AY2A 3MD0A 1I2DA 4TWZA 4ON9A 3QF7A 4LI0A 1BIFA 3DL0A 1JXMA 4XD7D 4YONB 1D2EA 4QM7A 4R98A 2R6GA 3ND9A 1CJMA 3EPKA 4BPBA 2ZPTX 5B58C 2BKEA 2Q0HA 4HAWA 1DEKA 1LFDB 3B1ZA 1PLLA 5FOXA 2GRJA 1VG0B 4LPKA 3KB2A 3GLHA 4F93B 2FF7A 4C0QC 1QG4A 4TQUS 5FOTA 4MH0R 3AF0A 1G16A 3C8UA 3SZRA 1TQ6A 3KQNA 2JJ1D 2IUUA 3P27A 3AB3A 3CO5A 2QPTA 5JCZA 4FW9A 4EJSC 3MGCA 2QNRA 1VIAA 4PFSA 5KNDA 3A6PC 5FBRB 1NG9A 1N5KA 2AFIE 4TYPA 3GLGB 1FNMA 2HJGA 2JASA 5KDOA 1E2JA 1RE0A 2O0JA 4NCHA 3WYGA 1ONBA 4HZIA 4JVSB 3TNFA 1US8A 2MSEB 2ZJ2A 1L8QA 2IYLD 4IDNA 4A2WA 3NC0C 2A2ZA 3I8SA 5FBVB 5KSOA 5EXPA 4ZCMA 3TK1A 2V55B 4C0HA 3C16C 4G5QA 2OCYC 5FUXA 2OV2A 5K8UA 1Z6YA 4OKSA 4RCYA 1Z0AA 4QHSA 1E2EA 3K9NA 4B47A 4QC2A 2NO7A 2REXB 2WJVA 2G9NA 4Z54A 4DIEA 2CEAA 4M22A 4TLAA 2XZOA 1NN3A 2PJRA 4A1FA 3AVYA 3ZVMA 4YMSA 4C0AC 1DTSA 5HE8A 2GEVA 4G5OA 1E1RA 1HE1C 1UJ2A 4WXRA 3QSYA 3VHXA 4HB4A 4ASUA 4P4SB 3GJ7A 5JBQA 3BB4A 4TYQA 3GMTA 4YMTA 3KQLA 3GJ0A 3A4LA 3NVAA 4DLWA 3R8FA 4DT1A 5C1BA 1KI4A 1Q21A 2O5VA 2BBTA 1KK0A 2ZJYA 1TF2A 1XXHB 4PO9A 1FZQA 4MDEA 2FZLA 5AUNB 3VKHA 3Q5DA 3T34A 1P72A 1YR7A 2F43A 2ZRBA 5TV2A 4URXR 1KI1A 4A6PA 3O47A 4JVMA 4CVNA 4FCTA 3T15A 3WYFA 1U81A 4M9QA 2PCJA 2YVUA 3WY9A 2G83A 5DISB 3TLXA 1GKYA 2WIBA 1IJEA 1W0KD 3TSZA 4BZQA 1YKSA 1OHHA 1SXJC 3OIVA 4AIIA 4ZO4A 3PV0A 4PZLA 1KAOA 1SHZA 2A9KA 3SNHA 1DBSA 3SBEA 3TE6A 3TSOA 1F2UA 4PSKA 2QTFA 1HTWA 1P9RA 2ZI6A 4A0RA 3AVWA 1P9NA 3Q72A 5FTNA 4LJYA 1N5JA 4D25A 4RD3A 5JJIA 4Q66C 4KFUA 5FPKA 4GI7A 4TZ6A 4B2PA 1G3IA 2A5FA 4AD8A 4DXAA 1NI3A 3T1OA 4QHTA 4Q9KA 1E0AA 1IXSB 3CBQA 4XWKA 1DELA 2P6NA 1CR2A 3VAAA 4XH9B 1AZSC 3RRYA 4ACBA 1TF5A 1Q1EA 4E09A 4U02A 1JXOA 5FL7D 1JPNA 3AP1A 4Q5IA 1G9XA 1E9AA 4Z8YA 1J8MF 1GZSA 3QF4A 4IJMA 2RGXA 3A4MA 3NWJA 2VP9A 3GFTA 4XIGS 1N25A 2ZSBA 4TYWA 3FGNA 4UNQA 1EWRA 2ZE8A 1KI3A 1E3MA 2HXYA 5TMPA 2YC4C 4G1UC 4GRAA 5DH9A 4RKEA 1NBME 4BLQA 5LD2B 3ZS9A 4TMKA 1SXJB 1EWQA 5KNCA 4MRPA 2AXNA 3BIFA 1NL3A 1H65A 1E9CA 1OLOA 1TEVA 2CLSA 4POAA 4LHWA 4ZI3A 4RZUA 1BMFA 1IM2A 3QPUA 5LBIA 1YZGA 1WCV1 2GDJA 3PR1A 4V0OA 2QPAA 4Q19A 1IN6A 1G8YA 1R8QA 3IO5A 3RLFA 621PA 3ZZ0A 2IYZA 5AJXA 2G1KA 2R6DA 4XSHA 1A2KC 3U4QA 2WKQA 2Q3HA 3R20A 2ZYWX 2B21A 5FI0B 3T5GA 3AVQA 2LCFA 3CH4B 2B6HA 3FKSD 4IDOA 4EIWA 2WWHA 1PLJA 3CR8A 4EFMA 3NHAA 1TU4A 2DWQA 2W2XA 2XGJA 4BFWA 1OFTA 1S9DA 4BFSA 1IOZA 1CBUA 4RCZA 3EX7C 3G82C 2WKRA 4PAOA 3CR7A 1I2MA 4HB2A 2IT1A 4LOAA 2Z4SA 4DCVA 1O3YA 4BFUA 1R8SA 4KU4A 2GCOA 2WIAA 2CK3D 4W5WA 4FCVA 5ANRB 4MYUA 1CJKC 4KFSA 2FEOA 3LFUA 5B57C 1TADA 2BWJA 4LBWA 4RFVA 2IWHA 1AS2A 3K09C 4UNSA 2X1VA 4FWTA 3AKDA 3DKPA 3JVUA 1E2DA 1F3OA 2NPIA 3TQFA 1KTVA 1IN8A 2YINC 2BEKA 3B1VA 4Y0VA 3AF2A 1OE0A 4Q21A 3NC1C 3SYNA 3KUCA 3P4YA 1ODFA 1YZLA 2QTVB 1HQYE 3FKQA 3ZQJA 4C0SA 4F92B 1P2SA 4YDSA 3V4FA 2PX0A 3UATA 1AS0A 1WXQA 4LPSA 1P2UA 1XXHA 3B7GA 3EA5A 4A92A 2NZJA 2O8DA 3HYTA 2A3RA 4JLVA 3CRVA 3IIJA 3OZXA 3R7WB 3ECCA 1QHHB 1G3RA 1N6HA 3TW8B 4DSUA 2PBRA 2N1BA 4M1MA 4ZDWA 4IVRA 3ZIAA 1KDOA 4GDFA 2WMNB 1HT1E 4BRUA 5B30A 2A5DA 3IBYA 2IUSA 2QQ0A 3R9WA 1F5NA 5HKKD 3ZLJA 2HF9A 1XEWY 2HT6A 4NTZA 1VPLA 2IL1A 3LY5A 2P5TB 2PJZA 5G3YA 1ZM9A 2J87A 4NP6A 1ZM4A 2CVFA 1VTKA 3AUXA 4MYHA 1YU9A 4TT3D 1JALA 4AYXA 3TAHA 4HUQB 1JEEA 2FNAA 1T3SA 2H92A 3OFND 4EPYA 5JZVA 3ETLA 2RHDA 4C0LA 1MKYA 1WB9A 1EK0A 2ZI9A 1P2VA 2QP9X 1CP2A 2WWFA 3BXZA 2I1VB 3SOPA 4YMVA 4RZXA 2Q6TA 3I61A 1RRGA 4HLDA 2OE2A 1YR6A 4QBIA 3K9GA 1NIJA 1XXHE 4OHYA 2XX3A 3K0FA 4JL5A 1NBMD 3QNUA 4KLNA 3AGQA 2ZTSA 4DZZA 2OG2A 1RIFA 5JWRA 1QDEA 3TIFA 1TNDA 1JNYA 2IHYA 3B9QA 1J8YF 3U3JA 3ZYCA 4BFZA 2VP5A 4D82A 3IHLA 1E99A 2C77A 2HJVA 3QG1A 1Y3AA 1P73A 3LBIA 2YJTD 2OBMA 4HAYA 4DRZA 2BMDA 4KHZA 1OFHA 3K0CC 1KHTA 4MQBA 1VHTA 4IFBA 3G0HA 4IDHA 2JGNA 3UG7A 1E2GA 2WMOB 3FMIA 5IK2A 3FPAA 3CNOA 1E4VA 1VCIA 2F6RA 3V9PA 5P21A 3WP0A 1R5NA 2WWYA 2V7QD 4PR0A 3RVBA 4JMPA 5KU1A 3TAUA 4AI6A 2NQ2C 1U8ZA 3O8CA 1XPUA 3HP1A 2ONJA 1F60A 3ASYA 2RGNA 4DLUA 1KI6B 1MOZA 2BDTA 3QE0A 4Q03A 4R2IA 3TMKA 4JT2A 1RRFA 3KXIA 1G3UA 4ZI2A 1XRJA 4D0GA 2DWPA 1OFUX 5JLJA 3X1WA 3I5YA 2P6RA 2QSYA 5EP2A 1Z0JA 4NYMR 1ZP6A 3FE2A 4WZBE 1W36B 2E9SA 4XWAA 3M6AA 4GBMA 1QVRA 2ECKA 3CIOA 3L0IB 3WHLA 1AN0A 1IHUA 1M7HA 2ZEJA 4NCKA 5CM9C 1ZC4A 4DT1B 1TQ4A 1XCGB 4Q48A 3VU9B 1Q20A 2QGZA 4B34A 2J0QA 3W3ZB 3WMFA 1HT2E 1K5DA 2XOKA 4HZUB 1AQUA 3L2OB 1CR4A 2RKOA 3FVQA 1KSHA 1LF5A 3AVVA 4LJ8A 1OXUA 2FH5B 3D31A 5HE9A 4MGYR 4KFTA 1KKLA 1OB5A 2PEYA 1OH6A 4L5BA 4AG6A 1CR1A 1N6NA 3T1TA 2GXQA 3KJHA 1F2TA 4Q1FA 1E96A 5G53C 3SR0A 4C7OA 3GJ3A 2OILA 4JLNA
chains in the Genus database with same CATH superfamily
2GXUA 1KJ8A 1XALA 3A04A 4ZGGA 2EHJA 2ZSEA 4M0FA 1NFFA 5DLQC 4LGVA 5TPWA 3ZY3A 3P8ZA 2Q46A 1QNLA 5DI9A 1X7WB 2XCIA 1DAPA 2XE7A 1GM5A 5A6SB 2POCA 1NNEA 4HOYA 1Q6YA 1P0MA 3D6VA 4C4TA 1N7GA 3VH2A 2CVPA 4DFDA 4WN3A 2IHNA 1WQ1R 1G3MA 2O3JA 4DG5A 1AURA 1IVYA 4KUHA 4WCFB 1FDIA 3JQQA 5BQ3A 4RA9B 3A32A 5EE1A 3DGEC 3BAZA 1WHSB 2IYFA 1M2WA 4RJJA 2NPOA 4KR9A 2GAJA 4U7JA 2P3QA 3F47A 1JR6A 3USES 1NLYA 1XZBA 3VDXA 2WA2A 2AZTA 2ZSDA 4AIRA 2OO7A 2FSVC 4URUR 5JQGF 1FLAA 3B6KA 1IM5A 1ZOPA 1FNDA 2G08A 3KKEA 2JJMA 3EFBA 4PY2A 3FCUB 4H1UA 3RVSA 2EYQA 4F8EA 2IYSA 3EEIA 4OHOA 1K9SA 2WWVD 2Z3WA 2IP4A 1BDBA 2ZBRA 1E8NA 1Z3CA 4XPZA 1EE9A 1ZXLA 3G2IA 4OYHA 1GRNA 1HTBA 1T24A 1N4AA 1B6RA 7REQB 1CY0A 3SKVA 3U31A 5B5SA 4LZPA 1N32B 1Z6GA 5TXGA 5IKPA 2JRLA 2JG3A 1ZBDA 3KZXA 2VXBA 3KKNA 2I6FA 4YMIA 2BF7A 3PXAA 1GL3A 4MMYB 1W30A 2QD4A 1RWBA 4M9CA 4WBNB 2GZHA 1GPWB 5AOAA 1CQIA 1FDVA 4AECA 4G09A 4PZAA 2VTEA 3R6DA 4P2BA 4UTNA 2NMVA 2CBXA 1H42A 1V2GA 2DWUA 3GDGA 4B6JA 2BBSA 5CEFA 5JVDB 1QR6A 2PKQP 4C7OB 4IUCS 3KL4A 3LQFA 5EZYF 2CXHA 4E14A 4PPQA 1D0SA 1HDCA 2AT1A 3DLCA 3HPRA 5JAIA 4TTJA 3K70B 1IN1A 2Y1OA 5BRJA 2ANCA 3STYA 1XYGA 4XB1A 2DT5A 3T4UA 1SELA 3BFKA 1ND6A 3MLBA 1RE1A 1ODIA 2B1GA 4RFSA 1R15A 2HF7A 4BC1A 4TQAA 2J9FA 3MYYA 3PC8C 4OBEA 1WJGA 5E1OA 5E9WA 3TNLA 3VNUA 1P61B 3R1IA 4TT8A 4DLAA 1WCIA 2QTBA 5L7YA 1EFDN 3OEYA 5DYWA 1WPXA 3WK6A 1Z2EA 1T5HX 2G6TA 2H5JA 1EJ2A 3D4OA 3NOVA 1R5BA 3OQVA 3OQ6A 4M88A 4OHKA 3GQVA 4OJNA 1ENPA 1LF0A 2CD7A 2POQX 5C5CA 2B8TA 1Y7PA 4HDRA 4G1FA 1XFAA 1GGHA 3AEUA 3AUAA 3MINA 4H6WA 3JS5A 2RH4A 3OTIA 3QKSB 4J0QA 4IXWA 5JRJA 2GKOA 3FUWA 1U98A 2HX1A 2MOKA 4AFNA 4D4IA 2DEUA 1JA1A 3S81A 1XZQA 5BT8A 2YL2A 3M83A 3Q6MA 1L5KA 3RUDA 4AZVA 2ZRJA 4OKNA 3Q3JB 1THZA 2VQDA 3IDSA 3W4JA 4Z1OA 3ZOKA 3OCYA 1OXTA 3R40A 5B3JC 4TTAA 5BWOA 2HPHA 4ZCLA 3N7AA 4J7AA 4F60A 4MS3A 3A6ZA 4KYUA 5CM2Z 1K7XB 4OV6B 5HDBB 3OPMA 3PWTA 5K99A 4V03A 1RQGA 1FP6A 4R2MA 4Z1MA 4BVFA 2YJ5A 3W4KA 4K6CA 1J24A 4IKEA 1B74A 2WUDA 1TO1E 1UBTS 4X63A 3CF6R 3V3TA 4NYJR 4RDCA 4L5AA 4CLOB 1S3GA 4C87A 4LNAA 2B5WA 3BL8A 4PCVA 3VM6A 2NO6A 1Z45A 3FYTA 2VKTA 3GJ8A 2I29A 3PXEA 3QXCA 1FU7A 2ZJ4A 1CNEA 3NEJA 4HN9A 4MCJA 4TMXA 3O8OA 1NQ5A 1IQPA 2RDMA 3E81A 4WY5A 1KE1A 3UT0A 2NAFA 2Z9BA 4MP6A 2PAFA 1ZRHA 4DLRA 2B83A 4D9EA 1ZU5A 3AK4A 3A0RB 3IP5A 3NIDB 3D6JA 2CB9A 5JEEA 3CGGA 3L8ZA 4FWBA 1TEZA 1U7TA 1GPH1 2UZIR 4KQ9A 4WHMA 2RGUA 2Q7DA 4LE1A 3WQSB 1REQA 2ZUVA 3AB7A 1MPTA 3SJZA 1EP3B 2PNFA 3KC2A 3QUCA 3RIEA 4PNPA 4DGQA 3RRMA 4EJ2A 2EATA 1I4LD 3TG8A 2I91A 3FJOA 4DM7A 1NVDA 3ZU5A 4MP8A 3SF0A 1KI2A 1MW8X 3EQ2A 3MVEA 4EMSA 3U4AA 3AEUB 1F0YA 4L95C 4DQ0A 4HG2A 2ODBA 4UE3S 3AMVA 2DWOA 4GF5A 4ZT4A 2YXEA 3MNFA 4KIWA 3R9XA 4BJ6A 5FR1A 1QF6A 4ZCPA 4JWTA 1P17A 5LPNA 3LHFA 2X2FA 4OQZA 3KLPX 5JSZA 2HCFA 2XRFA 4KSBA 2VR1A 4C6HA 5JUWA 1RLIA 1DARA 3RTBA 4Y2HA 2VUSA 1XDWA 3ZWOA 4L76A 2BMEA 3LA8A 4X91A 4K6MA 1EFRA 2VH5R 1FMTA 1WL8A 4B80A 3FIUA 4BXOA 3RARA 2OGZA 3AVPA 4J0FA 3WLFA 1E3DA 3GYBA 1C80A 1XTRA 2HY7A 2AKYA 4FN5A 4LJ9A 1K8RA 3R0JA 4KQJA 2PA0A 3KWJA 1ADJA 4Q4JB 5DGXA 1Q1GA 3TQTA 4YMHA 1U0HC 1FK8A 2YV1A 3K32A 2W8BB 5DNWA 5THXA 5BW8A 2HADA 4F9GA 2O8BA 1KAQA 1JTEA 1ZWKA 4LHYA 3RIGA 2A9VA 1R8JA 2QJFA 2TS1A 5FXMA 4XFKA 2X19A 5D7BA 1XAHA 2ZULA 5FPYA 2I7TA 3UZUA 1MFZA 3H65A 3MTEA 2XE6A 1HDGO 2DTXA 2GZ3A 4TMZA 4O3MA 1PJAA 3IDOA 1QV6A 1TC1A 2FDRA 3E84A 4UC0A 2GEJA 2HA0A 3HDYA 4C3UA 4E3ZA 2QIPA 1QLHA 1N2ZA 1XTKA 2XUFA 4FEEA 1HG1A 4KXNA 1KWGA 1SXGA 4ZYLA 3HVHA 4CM7A 4M49A 5DCLA 2QD2A 1RU3A 3KPYA 4OBBA 2RGEA 3U0BA 4KWCA 1L5LA 4MRMA 5FTJA 1UWCA 1EFVB 4LKOA 4FD2A 2NO0A 1N0WA 1ONNA 3GJXC 4X1YB 1FYVA 2A5JA 1N2JA 1ODSA 3BL5A 4TKVB 5BO5A 1TI7A 2LKCA 3D4NA 3R23A 4GX2A 1L8AA 3F74A 4TKVA 4IPTA 3GLSA 1J7KA 1RI2A 5C80A 2I4RA 2V7EA 1AMNA 1HE4A 1UMKA 3LQYA 4G25A 2HXGA 2ZI3A 4M1YA 3ROKA 4OHFA 4KO8A 4QVIA 1D6SA 1VL5A 4LA4A 2JD0A 5IXYA 2QYHA 1YE8A 3BMNB 4CG1A 3BRWD 3QPAA 5KNLA 2P2GA 2QEQA 3BBPA 4N4AA 4CDGA 5BSVA 5GJWC 4GKAA 3WYAA 3ND7A 5CB4F 5I3ZA 2VT7A 5JDCA 4JNKA 1HT3A 4RWZA 4LOIA 3FI0A 3CW8X 4M6WB 4LYGA 1LZKA 1UZUA 3ZGXA 4H7DA 1TUBA 1PDVA 2IYUA 2R8BA 3JAMA 4YPOA 3VGPA 3KSRA 1W4LA 1X39A 1PZXA 3DOJA 1K0UA 3KD2A 1XHLA 1IZZA 2C2YA 1PWZA 3NRBA 3SOZA 3OC6A 3K3PA 2XODA 3JVVA 2YWGA 1SXIA 4ZHSA 1FIUA 4M8IA 1UJMA 2I4TA 1KO1A 2YWEA 4M76B 4B79A 4FHFA 5IDXA 1SHUX 2WYHA 3KZ1E 5IBQA 3IMEA 3T3MB 2GM4A 4I3FA 4OM8A 4K0KB 3Q7IA 1MAHA 5C1DA 1QX3A 5K9ZA 3PVCA 1VA5A 2LUOA 4LDNA 3OT1B 1KO4A 4MUKA 3HGMA 3L6UA 4TZTA 5C8XA 1WB5A 3WK9A 2PIDA 2F8LA 4MEBA 4PS0A 2FW9A 4GPZA 3C4QA 2HSDA 4LXQA 4KRXA 2Y0DA 3VPFA 1JKIA 3IUYA 3JALB 1X1RA 2PH1A 3NHMA 1W2GA 1Z5VA 2LW7A 3QJ5A 3RK4A 3LDFA 3FBTA 1MIOB 5J2UA 2Z8ZA 4FMCB 1XQ1A 2WNIA 3R5HA 2F1OA 4R69A 2A30A 1X6VA 5IC4A 3EXEB 1ZKMA 1QAQA 1G64A 3BCSA 4ZFNA 2OM2A 1EFVA 4DCTA 2QTCA 1CE8B 3FPGA 1OT3A 1M2OA 3QEJA 4LJ5A 2R7NA 3U13A 1AH2A 3P4XA 1DMSA 4PC6A 5KJ1A 5CIQA 5F2KA 1NMEA 3PPXA 1RJWA 2BAGA 3EXIA 2CLKB 2ZKIA 2V7UA 2DFNA 3K05A 3KLMX 2HTEA 1D6NA 2RGAA 3LPLA 1X8JA 3PIRA 4Z4GA 3PGJA 3K0EA 1Z0IA 1SKQA 2IPLA 3WL5A 4RVHA 1J9EA 2Y68A 2A1UB 2XEDA 4XD7A 1IATA 2EKBA 3JTMA 2HF2A 1C7IA 3LT0A 1CKEA 3R3XA 4LHSA 3AKCA 2W6ZA 4I50A 4Q05A 1I7DA 1ZMTA 3QGMA 4ZKEA 5AVYA 3NC4A 2Y3IA 3MTQA 4NV0A 5FYDA 4ARZB 1B41A 1X38A 3DLTA 4QGBA 4C4OA 3LQ4A 3ZDZB 4ZV7A 1GKIA 3BZUA 3H3XA 2BLNA 3N2EA 2D59A 3DZCA 4LHXA 4NMLA 3WHPA 3LYAA 4Q1EA 4CLHA 4E1AA 3EGVA 3VVCA 2Q9BA 3GAFA 3DAHA 3BRWA 3EDMA 4L8LA 4GBGA 1W4RA 5CJJA 5TMBA 4A10A 4GLFA 4CG2A 4ER3A 2Q2WA 3OEED 4MJLA 5H82A 4IDEA 4QYMA 4C20A 3VHLB 1S2NA 4WK2B 1OKKA 3L01A 4GSYA 4QOJA 1QGUB 3LL7A 1ESDA 3VPXA 5LMZA 2JLZA 2VBFA 3UHOA 3OFKA 1JA9A 2VATA 7MHTA 1Y8RA 2FLWA 5IM4A 2Q4RA 3MGKA 1FQKA 5D3ZA 4YGXB 2JKZA 1NUAA 3EIWA 1ZC3A 4MVCA 4MI6A 4BMDA 2A86A 4R0VA 5E9AA 4D92A 2WG2A 1V41E 1HSOA 1MEOA 3EZ2A 4GE0A 3H4MA 3VYVA 1QCYA 3CZ5A 3QUSA 4BCDA 3FOZA 4G89A 4FUQA 4G2TA 1KZHA 3KQUA 4QJIA 1N2XA 3OCWA 3CO0S 2G07A 1Z5UA 2H4HA 1I2AA 4BEWA 3ND8A 3VNVA 1EK2A 4KDRA 3VPDA 4PC7A 4BGIA 2QTGA 1NTRA 3N5CA 2AFIB 1E1LA 4Q82A 5FYQA 1RPZA 2G7MC 2FUG6 2Y1WA 2PIAA 1C3EA 1D04A 2FQQA 2QUBA 2GASA 4OMFG 4XWYA 4JN6B 1CUXA 2RHJA 3JWHA 2DBZA 1ORTA 4C0WA 2ZWIA 3WV4A 2DTEA 3GUYA 4IMIB 2HQ1A 3UO8B 1GDTA 1YQGA 1D7AA 3B3JA 3MCVA 3CLUD 3FH0A 4M99A 1XWFA 3KPWA 5ILOA 3CLRC 1ZJ4A 1Y1PA 3K6RA 3O83A 1UQTA 3X2SA 4EQ6A 4DA4A 1H4VB 3WGLA 1ZJWA 4UHFA 3IAAA 3FUUA 5TRTA 2MCFA 3C3JA 3HYCA 2C3OA 2GZ1A 3N7TA 1LKZA 2G71A 4Y3UA 3HCWA 4EG1A 4M1OA 2GZRA 2V6JA 4JUAA 3PR3A 4WADA 3U7EB 3WLLA 4YHHB 1DQSA 1ECBA 4QWMA 3JD2A 2FRDC 1QMPA 2IKSA 2WG1A 3E9DA 2ZETA 5IDVA 2HHHB 3DOCA 3SQLA 3PEEA 4MPRA 1UFVA 1YT5A 1NNI1 4LUCA 1O95D 3FCXA 3HKEA 3KSMA 5EMNA 5IM4F 1OASA 3ASZA 3H5OA 1Q1ZA 2F9LA 4FZJA 1E2PA 4ZD6A 1AQYA 1FUIA 3VR5D 4KIFA 4RE6A 1V1MA 4QICA 3VZDA 2JZCA 4OHWA 4MLPA 4NONA 1QNFA 3FJYA 3AI3A 4FZRA 2W43A 3EOBI 1T4GA 4ZC1A 3FW1A 1SD5A 4XIYA 2I34A 2W11A 2O8BB 1KK2A 3DF9A 4DEVA 4RKFA 3KXKA 4E4RA 4A5OA 1WWKA 3BQ9A 2GI4A 2J0UB 3TO5A 5TEVA 1OXVA 1UBKS 2FU5C 3SKYA 3VR4H 2PX3A 1JECA 4TXMA 3U17A 1CUHA 5LQNA 2X4LA 3QYPA 1J0EA 2V7VA 3BGOS 1JJIA 4EP1A 3L4BA 5A3QA 8ATCA 4IWYA 1EUCB 3EFOB 3SZUA 4GQBA 4C5BA 4G56A 3W1EA 2F8SA 3RD5A 1W0JD 2GXAA 1ECPA 3FTFA 2HOQA 2PEZA 3N9IA 4OI2A 4DNQA 4UNRA 3PQ7A 4XPIA 1QTIA 3CZCA 1O6FA 4I4LA 1I01A 2Q99A 1I6KA 1KDTA 1HBJA 1RFGE 1SXHA 4KX5A 2GPYA 2VAMA 4YACA 2C57A 3FBGA 5IJ0A 3X0DA 3GVXA 1VE5A 4BNWA 3K8YA 2B2NA 3PJDA 5DKFA 4RTKA 4UCWA 1Q5PA 3BH0A 3NASA 2B4QA 4M21A 3LQ1A 2FCRA 4I08A 3WGZA 1ZAYA 4FONA 8AT1A 2VXYA 4FFVA 4K9RA 1RRPA 3OQ1A 2HQBA 3UJNA 1P5JA 2A9JA 3DR3A 3VJLA 5BW4A 2L18A 1E7WA 4QARA 5CVCA 2QTNA 2WKWA 4RH3A 2Z2JA 5FF9A 2PT7A 3H1EA 4WKCA 3VOAA 4JD5A 4DKJA 1SVWA 4HDKA 3FYUA 4NYIQ 1A7KA 2IJGX 1RXEA 1R9MA 4U00A 1ZGGA 4C30A 2WICA 4WTOA 3FOAA 4GVLA 4AROA 1PYGA 2WFMA 3AESA 1EHCA 1EM6A 4GYWA 4HNAA 2AYYA 4LY0A 5CX1A 3RIYA 4AO6A 3OU6A 3G7NA 3LKVA 3ANLA 1JSCA 5AMXA 4AY5A 2F67A 4AP6A 1MJGA 5C3UA 1T26A 3B1KA 2QX6A 2G4LA 4KRGA 4QLOA 1JJVA 1Z35A 421PA 1L0BA 3K0BA 4ME6A 3TRHA 1SCUA 4CR6A 4DEXA 4HC4A 2OEPA 4ZEXA 4AF6A 5CXUA 2E4UA 3PQ2A 1SG6A 2QLBA 4GECA 1FTQA 1CNFA 5JLAA 5KVAA 1LBHA 1HFJA 1S01A 2FV8A 2Z30A 4FEAA 4JU9A 2DFKB 3CZ9A 4QLAA 5E4YA 5HRUA 1FSZA 2ZVPX 1Q3KA 3CVXA 4LF4B 1V4NA 4E07A 4H7FA 2GM9A 2JI7A 1SVUA 1J9ZA 2BKXA 2WP8J 4AX8A 1EDOA 1MB3A 3I58A 4TM7A 4CODB 3JQAB 2PSDA 2F4NA 3K16A 1T9CA 3LPMA 4I55B 4IUDS 4RF5A 5JYCA 4JENA 5LKAA 1JRLA 1WXEA 2EZTA 4TRRA 4IQGA 5EVJA 1YZKA 4YYZA 3SCZA 5G4LA 3OHMA 5EJGA 4ZZ1A 4DMGA 1JT9A 4AJHA 3KYIB 3O7MA 1MQAA 2YX1A 4X7PA 4BKMA 2FY8A 3C45A 3RC7A 4CKEA 3HNRA 4LYAA 4TQ9A 4BNHA 5LDDC 3TZBA 1HKHA 1X7GA 3K7EA 3OOHA 5EKXA 4ZMRA 2ZOSA 2ORWA 2V3VA 4GFDA 1IN7A 1XK7A 5KNDD 3B9PA 4UATA 2XZLA 1GWNA 2G25A 4RA9A 3S1AA 4CEHB 2ORED 2GVNA 1RZRA 1F14A 3QHQA 4M9XA 1WEHA 4M38A 1L5ZA 1NQUA 1M74A 2G72A 4KDCA 3ZW9A 2QNIA 3BICA 4MWOA 3C3PA 4A0HA 3D3WA 3OIFA 5JRZA 3HCDA 2ZVJA 4BRWA 3FLMA 3DF7A 3V7YA 1OXXK 3QI2A 4BO9A 1CJUC 1FTWA 1CSEE 1T8WA 4K3VA 4EI7A 2YYAA 2MSLA 2QSJA 4D6XA 5LYJA 1WD5A 2DR3A 3I5AA 3BFVA 3P2MA 3Q0EA 1PP4A 5AOCA 4ZVOA 2EP7A 3C8MA 3DC2A 1OIVA 5JD3A 3UV3A 3VPCA 3E4CA 4PICA 3I1JA 5AXCA 4Q15A 4ARCA 2OV4A 3DZKA 4CLXA 3D6FA 1LSSA 3JASB 2EV9A 4J3FA 4BIMA 1KH3A 5JI2E 1EDBA 2FFRA 4HRXA 3MOIA 2KSQA 2ZYAA 2O06A 1DRWA 3MWEB 3W2IA 5KQPA 2Q0QA 1ZIYA 1T9GR 2H1HA 1KRHA 2RHCA 3WK7A 3CUTA 4ANFA 4E31A 7REQA 2O1SA 1YI8A 2P1RA 5K0TA 3IQEA 1WXGA 3K9LA 2IZ6A 1P4HA 1BFUA 1IXRC 2AMFA 3ZR4B 4PGHA 1PIWA 4RSGA 1JDJA 3D4BA 3NWPA 4JC4A 2ZDGA 3SF8B 1X14A 3JQ8A 2WBLC 3JZAA 3V4RA 4UFPA 3KKMA 4G84A 4YFYA 1P1IA 4OXIA 1OWMA 1VCMA 3C87A 3D8SA 3M6MD 4HFNA 5E7IA 3NHZA 4ZVLA 4X1IB 1Y6JA 1KP9A 3CCCA 1DJMA 3DEIA 3RTGA 1O96B 2J7KA 2G1AA 5FLKA 5JANA 2GEBA 3OZDA 3RYTC 4PZUA 5BMVB 4L5YA 4HN4B 2E89A 4AUMA 3DFFA 3G2KA 2VCHA 1VYTA 2VBIA 1XQ9A 5CA1B 1ICIA 1DO2A 1S1CA 2P4QA 1Q14A 1ZN8A 4L8WB 3ZKWB 1ECCA 2X9NA 3HJHA 2NV2B 3IA7A 4M9ZA 1RACA 1SN7A 1P39A 2P65A 1KZ9A 3C97A 1GUDA 3DDSA 5D00A 1C50A 4P08A 1D07A 4P32A 3QMPA 2NXCA 3KELA 4U7FA 3HVRA 4YS6A 2YJGA 3EDOA 3IPYA 1Z6AA 3HR7A 3TUIC 4EGCB 1JAHA 2C20A 2OZLA 1Q50A 4DYDA 2ABWA 1NXSA 1S9HA 3OBIA 2FMUA 3TI9A 5MGNA 2OHXA 1PU2A 2NVBA 4GL4A 3U7QA 4D7AA 1QQ7A 1YRWA 2EVWX 1ODLA 3A6JA 5CLHA 3JWEA 3HXPA 3WYBA 1A5SB 1KJIA 4ZRMA 1T5DX 3L06A 4TTRA 5GIPE 1T5IA 5BW5A 1NJFA 2HCJB 1GCAA 4F4IA 3OX3A 3QY9A 3ESBA 2ZUWA 1ODCA 3MAGA 1CQJB 3DEZA 4YMUA 2QWXA 5H81A 2ZYUX 5H02A 4B3HA 4F3CA 1WU7A 5EP3A 5KYXB 5LJLA 1N4DA 4N5NA 3Q3EA 4BFCA 1IY8A 2OZKA 1OQAA 1RBYA 3A1NA 1XD2A 3KQWA 2NUAB 1J0AA 3SYRA 2W4MA 1W8DA 5KTSA 4IDFA 5BSWA 2FOIA 1J97A 4G8DA 5IAJA 4LJSA 1PZNA 1EGQA 4X92A 2HV9A 2JGJA 2PBLA 2X23A 3IE2A 5AFSA 3K94A 1WXDA 3UWMA 4EMTA 3G59A 3KOOA 2NVOA 3W9UA 3EQ8A 1LPPA 3OM8A 3HLKA 2I6QA 3LMKA 3MJDA 1CXZA 4LZAA 2BE9A 3B48A 1RFLA 3R3SA 4YXFA 4GPEA 1NXXA 1SIWA 4HLCA 1N5DA 1QMGA 2ZJ3A 3BGIA 1G42A 4OQPA 3L5KA 4NFYA 1UAAA 4EAQA 1NW6A 2VO1A 1UFKA 3UGJA 1XPRA 1PS9A 4UJ3A 3I6IA 1UAGA 3E22B 3IIKA 3BCUA 4HEHA 4IEFB 3ZJ5A 1ZN7A 1RVV1 1YULA 2LV8A 5E7MA 4L8YA 3W2EA 2DR2A 1A9XB 4MQ6A 1QWSA 1FX1A 2I8AA 1BMFD 3NT2A 4OLJA 4X60A 1ZEMA 1D1SA 3RSGA 3SSOA 4KPEC 1L7NA 1G4AE 2BI8A 5ITZA 4A8JC 5BWBA 4QYIA 3R3VA 1VJTA 3EZNA 4G01B 1V39A 2BMVA 2ORVA 4YRJA 1ONPA 1FQWA 1U8FO 4TMWA 3T0IA 5F9FA 3ON5A 3I9NA 3H6HA 3ABQB 4MW6A 1IH8A 2ATIA 1JVNA 5AOVA 3F67A 4OUDB 1QK5A 2CVOA 4TGLA 5JECA 3FWPA 2AN4A 5EZYB 1YB2A 3T3OA 1CQJA 2AW3A 4YDQA 3LK7A 5TJ9A 4C2AA 5BWMA 3EW9A 4XIJA 3L0PA 4R41A 2ANBA 3R0IA 3RWMB 1SQSA 1M6EX 3L4KA 4IIUA 2PYIA 4OF4A 3H42B 4MUBA 4NR0A 3R41A 2VPTA 5T5QA 2I3ZA 5CEJA 3CZPA 1L7RA 4JP8A 2QXUA 3ZVKA 2W22A 3E82A 4BFVA 1R00A 2ZYRA 4PTYA 5FHRA 4C6TA 2QTVA 2P9FA 1DKNA 5JDIC 1NXVA 1C3VA 1I2CA 3PWSA 2EGGA 2W7TA 2OCAA 1L5RA 3HZZA 3P4UA 3VZSA 4J76A 2GN9A 4KUEA 4ZVNA 3A7EA 3WYCA 2V6MA 4XFJA 2GBPA 1WUKS 4AJPA 1E2KA 1VSTA 1PQ4A 4DMRA 4HLUA 3ZVNA 1KY5A 3MJEA 3DVRX 2V5UA 2RK6A 3NP9A 4XSGA 5LZ4A 3AM1A 5EKTA 3TSWA 4INAA 4NOMA 4EJFA 4LG1A 1GNLA 1ZVMA 2G9UA 3EIEA 4XWWA 1ZI8A 4Q39A 1D2HA 5FV4A 4YCNA 1JEYA 1Z2DA 3M4YA 1QRAA 2Y4OA 2QMHA 5ALZA 1YA6A 3TIXB 4DUPA 4FMBB 3UUFA 5IDWA 3T3IA 3QE3A 4J3JA 4KLZA 4GT1A 5KNBA 4BVKA 3VNRA 3S2GA 2Q4BA 5E0KB 3VC3A 3BWYA 3IDQA 1DBPA 3WFJA 5KHLB 1UR5A 1X3LA 3BX1A 4TTQA 3G7UA 4ZQBA 1IONA 3P94A 3VNQA 4MIYA 1P0FA 4Z4CA 4TTIA 4B35A 1NI5A 4GNKA 4BJ3A 3PUKA 4NXNB 2YJZA 5FO0A 1Q44A 1GXSB 3EK2A 1KMNA 4D0NA 3K0AB 5BXQC 1BO6A 2Q07A 3WWYA 4X8HA 4K6OA 4PO8A 1IY0A 1SBTA 1VDZA 3FA2A 4I9FA 5HDQA 3WSVA 3FPBA 3A25A 2ZUSA 3I73A 3AONB 3KT8A 1LQUA 4MR7B 4QSHA 3T7EA 4BASA 2O0LA 3CU5A 3WKAA 3UPUA 2H48A 3UGQA 1PR0A 5F2EA 4LRXA 3EG9B 3S2SA 1Q83A 2Z8XA 3IPLA 1NN0A 3EPPA 2X2EA 3P20A 5TS2A 4B87A 4EVQA 3NP7A 1NFRA 4YO8A 3T4PA 4FLFA 1KDRA 4G0PA 3W6UA 4F45A 1EK1A 1D5WA 5UKDA 4BMNA 4M1SA 3ZUGA 3BRCA 4R2WA 3BIXA 1C5KA 3KCNA 2ZSAA 3PA6A 5FTKA 1TTTA 1OXKB 1HNXB 3ZJYA 3HY4A 1JI3A 2C9OA 2IXGA 3HCPA 4FPXA 5ERXA 1YONA 4CKCA 2PK3A 4EEZA 4V0NA 3CZAA 4KQMA 3B3QA 1QZXA 2BCJQ 4B71A 3L6BA 5COQA 2A0KA 2VWGA 1P7WA 1YNOA 1NZFA 2QTHA 1FTSA 3D3QA 3TN7A 3SHWA 4YIHA 2P2CA 3UHFA 3KK0A 4KXWA 2W83A 4N82A 2WJ4A 3GUCA 5AK5A 1S2IA 1AQ6A 1W19A 4KN9S 4NBSA 1X3SA 2GHIA 3O93A 1NF9A 1RI5A 1VYVA 3A9UA 2VH1A 4RK1A 4Q1BA 2ZR0A 1T2EA 1FLVA 2R66A 4WW0A 3O8BA 1QJCA 1P81A 3UHPA 3KKKA 4E2FA 2YV3A 5IXJA 1YTUA 3U19A 4LDPA 2PN1A 1K4YA 3IQXA 5JZOA 1CZKA 5AM0A 3MJFA 3U5TA 1ISJA 1T2UA 4IX9A 4O4HF 1FCJA 4QTYA 5BMVA 1X7DA 3RUHA 1A50B 2ZE5A 2FDCA 5KOHA 1NW8A 1SKAA 1NM5C 2Q4TA 4DW8A 3QSYA 3BKWA 1YACA 3P9CA 4EQ6B 2Z8YM 2C2BA 2O52A 4C43A 4Z7QB 2WAYA 5C8YB 4CFSA 1X7ZB 4HYTA 1EVIA 1X1TA 2XWBF 3ILVA 3P9IA 3T7AA 4JEHA 3DL2A 4XDHA 1DRVA 3AIKA 5CNKA 4E21A 2VWQA 3KOXA 4NE2A 5B64A 2XGMA 3KAQA 3E70C 2GZDA 4UMEA 1Q2UA 3K1YA 3THYA 3UW1A 3PRKE 1MNQA 1QP0A 2Q3EA 4LJ6A 2II6A 4A6EA 3C4JA 4DV7B 1G8GA 3Q1LA 3NDJA 3V1MA 4F11A 1IHOA 1DQYA 3F7MA 4MS4A 3JR7A 4C4XA 3ETNA 1BDMA 5GOZA 5FJIA 4NBUA 2QU8A 4UMVA 3VZCA 3EEQA 4LV6A 2C98A 1O0BA 3AUKA 3FNBA 1BFDA 5EMJA 4DMMA 2PZMA 1HNNA 3AR6A 4IOLA 4CF4A 1FRNA 2B1RA 3I1YA 2V0CA 4AWXA 2F43B 3E2MA 5DHTA 2VN8A 3GELA 3RDPA 4HDCA 3GA7A 3OC0A 1NMZA 2QUHA 1J8DA 5TC4A 5I6DA 3GRFA 1G8MA 2FFAA 2QZZA 1P9WA 3MBOA 4MVJP 1JDPA 2XCUA 1TTQB 4NEQA 1YGPA 5CTAA 4O4IA 3OTWA 3HDJA 3UEOA 4YMLA 4EG3A 1GAQA 1VLMA 2JLRA 1XTZA 2AFIA 4C7XA 1PFVA 3EAQA 1YK1A 5SYAA 4I2VA 2HBRA 4O1IA 4CU5A 5BV2P 2RGGA 3V1LA 2FEPA 1AGNA 4ODIA 5LD2C 3AJ9A 3G0BA 3GEBA 1AKNA 1OJLA 5DDIP 1DUVG 2AOTA 3I2HA 4CHTA 1A71A 2NSHA 4FGJA 4MUJA 1W4BA 3I2KA 3ZI7A 1G60A 1SUPA 2W2TA 1XKXA 1WU8A 3N59A 4MQFA 4AN0A 2HDNB 5A5DA 2VZLA 3L9XA 3FOBA 1GSOA 5CH8A 2GN6A 3VR1A 4YT8A 1UH5A 1ZD2P 2QT0A 4C08A 4JL8A 3WLQA 4B3IA 2O7NA 2W2LD 2YNMC 4UM8B 1Z26A 3GWZA 3GDWA 4HGNA 2ATXA 2XUPA 3O8NA 4GRDA 4L02A 4NZPA 1SQGA 3EZ6A 5DYIA 2XLBA 3THXB 1DU4A 4I9NA 3HFSA 3LDAA 1XDSA 4G5GA 2MYPA 2Q2QA 2HRRA 1F17A 2FMIA 4HEA6 2EWVA 4TSFD 2R44A 2QJTA 1U1EA 1RBQA 1A9OA 4PRLA 1U7ZA 4CRWB 2D2VA 5HXAA 4DF3A 3I6YA 1JDBC 4EO9A 3X1ZA 3I37X 3LAWA 2QMOA 2YVLA 5BN4B 2RE8A 4YI3A 1Z2PX 2O3QA 3R2JA 1K27A 1KY3A 1UEIA 1EM8A 4AJ4A 1Y80A 4PC3A 3WGUA 1UDXA 1KYYA 3R6WA 3CBGA 1CUFA 1ZBQA 4C3ZA 4LJAA 5I45A 5AI5A 2PLAA 5LP6F 1P7ZA 1P0PA 2P77A 3LQRA 3P2JA 4FR0A 1Z6ZA 4A8JA 4MCAA 3EXEA 3DTVD 3LFTA 4OPMA 3BGVA 4QFDA 1T1GA 4TMTA 2Z5VA 4O8ZA 2JAXA 4Y2SA 1PNTA 3B70A 1CUZA 3MUFA 1GY8A 3OTGA 4IVPA 4PRZA 2Q4EA 3LD9A 5JZ9A 3M33A 3UPDA 3THSA 1F6BA 4TXHA 4BN4A 1KEKA 3L77A 1LBIA 2IH5A 3HFGA 4LFAB 1RMQA 3L79A 4AP9A 2VA9A 2JJQA 2JFQA 2YJNA 4G0ZA 1ISGA 5F4BA 4Q3AA 2OPHA 3RJMA 1QRSA 2AH5A 2VP0A 4LXXA 3UOAB 4AMGA 4MKFA 1NHGA 2CLDX 3URKA 4CIAA 5MHTA 1LDEA 1YMQA 1KI8A 4Q4HA 1C7EA 4QPPA 5DYGA 4ZZ2A 4UAVA 3NGLA 1B8VA 4HADA 4PTZA 3D7NA 4PAGA 1QKIA 2QRVB 3AY7A 3PK0A 4LTMA 4LTDA 3SM9A 2JCGA 5KDDA 3TB4A 2G5TA 4GPTA 5BV0A 5E38A 2AF4C 3K1AB 4LXHA 3MMSA 1AGRA 2R6FA 4XQ9A 1GAEO 2P78A 4H0CA 2OAP1 4MNTA 1QRUA 1LRJA 1M72A 3TRDA 1G20A 3EBPA 4MKGA 3PX7A 1GG9A 1NVFA 4CDNA 5AHKA 2XCRB 3OUUA 4BGUA 3KKOA 4OLBA 4UNPA 4YRZA 5BSRA 3I6ZA 1XSEA 5TQ2A 1YL6A 4CF3A 3ZKAA 2CYBA 2GJAA 2Q2NA 3SE7A 1KPIA 2OC9A 1Y7TA 2PUHA 4YRBA 2O2SA 1XVUA 2XMRA 3KQSA 1OLSA 4DLNA 4IKOA 1R6AA 1U3DA 4FMDB 1UKCA 2P5YA 4I4TB 4NS4A 4R1UA 4CETA 5G3ZA 4JLKA 1NYLA 5LA6A 1GARA 2VJMA 5DX8A 4EUSA 2EQBA 3VC1A 3PGLA 4IJVA 5A1JA 1JHAA 5TMDA 2DY1A 3AL2A 4TSFA 4C6SA 1IUNA 4DCCA 2ZSHA 2Z95A 3MUNA 1DV2A 2NU6B 1I6WA 2OENG 3TFWA 1LX6A 3QYFA 4UM5A 3ZH2A 2P2NA 1U3WA 5B3AA 5L3RA 1CDZA 1ZHHA 4D41A 1BXGB 1UZNA 3H86A 3BA1A 3DHYA 1HX7A 1O87A 2CNKA 4GSKA 2Z9DA 3D2AA 3NONA 4FCWA 2PT5A 4ZCSA 2B9EA 2H85A 3C98A 2HU8A 3BERA 4ZYTA 1TUEA 1KFKB 4EEXA 1FFCA 1TZKA 2WSSA 2OECA 1M1NB 2GYWA 1F7VA 4D4JA 3TL2A 2WSLA 3AKEA 3RRNA 4B1FA 3LOPA 2FPGB 4ECEA 1A1SA 2AYZA 3FZGA 1P91A 5KX5F 3P9RA 4ABTA 1MVLA 4AURA 2R751 4UVGA 2G9VA 1YCFA 3H2GA 1YRQA 3UN1A 2PKXA 3VVLA 3CNHA 3H8WA 3B60A 3K8OE 2GAAA 1EYZA 4KLAA 4R8MA 4BPRA 4I1OA 2HMYB 2G7ZA 1CQPA 1E1DA 2JJ8A 4AF8A 3NFRA 4RD1A 1ESMA 5TARA 5DGTA 1EX7A 1QHEA 4OSOA 4D80A 4Z0TA 4EI9A 2H00A 3WTCA 1CUAA 4OU4A 5IDYA 4P0QB 2I2FA 2VJLA 1BVUA 1N5RA 1O94C 3TH5A 3ISVA 4TKZA 5AUPB 2EFGA 4Z4HA 3MERA 1N7HA 2W4IA 1WY7A 2JAHA 4V1CA 2F62A 1FFSA 5HS4A 2QE6A 3SVZA 3WRVA 5DEIA 4DCNA 4MR8A 1FPQA 3HNOA 5E6SA 2AI1A 4JA2A 1I3OA 1KO7A 4XIFA 3D7MA 4ZO7A 3BKXA 1M8PA 1Y3BE 4JLDA 3THXA 4G85A 2BHTA 2GJ9A 4IVQA 2QXYA 3HADA 1Z6XA 1C2YA 1A2OA 1SBCA 1ZDMA 2H1VA 3N39C 2W90A 2ZBGA 4J6EA 3RSZA 1T0BA 1XWIA 3L49A 1LBSA 1TJ4A 1KFCB 2W6ID 2ZCJA 1PNRA 1Z08A 4UXHA 2AZXA 4NI5A 5JBIA 1Z2CA 2GK6A 2A5LA 3PEVA 5C9ZA 4LSGA 2XXAA 5EMKA 1NQTA 4LDAA 3PGKA 4GPIB 5LQJA 3ZCXA 4PF1A 5HJ7A 2QJWA 5CK4A 3PGA1 3SVTA 4KRYA 4O2BA 3ELBA 4C1BA 2H1FA 1LI4A 4IOJA 1F2TB 3DUWA 5H7XA 2HFKA 4Q7QA 3R0VA 3B82A 2HRBA 2H65A 3DMNA 5E2BA 1BOFA 1SCDA 1GAJA 1E0KA 4YMGA 2XGSA 3IJEB 3TDKA 3BTVA 1XAGA 3CLRD 1IB0A 2Q8QA 1L5FA 4LI3X 4U39A 5HF9A 3TRKA 9LDBA 2ZROA 1IEVA 3HRKA 4HX2A 2E82A 1KMHB 3OA0A 3UFXB 4POOA 3BULA