4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
4CF7A 5ER5A 1SKYE 4PCWA 2CNWA 3ZNIA 1YE8A 2GCOA 3T1VA 4BFZA 4E22A 1M39A 1BT6A 1US8B 1SVKA 2VEDA 2RGBA 3EASA 2B92A 5DN6A 1O3YA 3FDIA 4W9MC 2WPDD 1E69A 1XMSA 4MH0R 1DJXA 1K94A 3UMSA 5KUTA 5EXXA 2HETA 1GQMA 2BE4A 1RTP1 2NCOA 1SCMC 3OHMA 1E9SA 4NU0A 4W5JA 3BD9A 3BH6A 2LMTA 2GZHA 2CLCX 3WYAA 4O2RA 5BW8A 1TMKA 2ZRBA 2PJRA 5FPYA 4TLDA 4AQIA 1EGAA 2BOVA 4EFNA 4GZMA 2ZETA 1UP5A 1KSJA 1FL9A 1TIZA 2DOQA 1XCPA 2BKUA 1PUIA 2ZR7A 4B43A 2QTHA 4EJSB 2O8DB 1SRAA 5LBIA 3JTDC 1XK4A 1AM4D 1LW7A 4JVNA 4DLYA 3NDBB 2WJVA 5DKNA 3DPUA 2W2TA 3GK4X 3L0OA 5H70A 2VRGA 3PR1A 2LMUA 2W58A 4KSBA 5JWRA 1SNLA 1VYUA 1KKMA 2AHOA 2QQEA 1F4OA 3Q7PA 4X8MA 2K2FA 3O6BA 3MWJA 4DLRA 2JLVA 3WHKA 4MKFA 2JTTA 1A03A 2FG5A 4I5JA 4MA4A 4FCVA 4P33A 1Z83A 2KB0A 2QAGB 4MUAA 3LX5A 4M2OA 2X1VA 4IOJA 3A4LA 3EK7A 2IYWA 3FPAA 4GBMA 4LJ9A 4D82A 4LZZA 4TQ9A 1OV4A 1DTSA 2WJJA 3V4RA 1FQJA 5KSOA 2KBEA 3D0YA 4KI0A 1XRJA 3BB4A 3R20A 1F70A 3X1YA 2HEIA 1JAHA 1PK0D 3D31A 4IDPA 2B8TA 5M04A 1A75A 2RAPA 4LGMA 1W44A 5FTJA 5LB2A 3CNOA 3GJ6A 1E0SA 2BE6A 1RWYA 1G3UA 3BK7A 3U44A 3D0YB 5BWMA 4DZZA 3B6EA 2KGBC 2I18A 2XSZA 4YONB 1AKEA 3CR7A 1YVLA 2O8FB 1II9A 3PUWA 4PZZA 4BFVA 4DSUA 5F98A 3THXB 4LCBA 1KI7A 4QJ4A 4RKEA 3RWMB 2JLYA 3X1ZA 1PVBA 2CHVA 3RS5A 3U7FB 1S5GZ 3O8CA 2I94A 4Q4JA 3GFTA 3U60B 3DZDA 1E32A 3FHCB 3TR5A 4YQFA 4CGZA 2PMKA 2BJVA 1R7RA 2KAVA 2G83A 2RGIA 1OXSC 1T5LA 1TF5A 4BPBA 1B1GA 2FDCA 2IW3A 5DYIA 4QM6A 2Y1NA 1K8RA 2C2HA 2ERYA 1S2MA 4LV5B 1Z07A 4QXAA 4CYMA 1HUQA 1DGVA 3AVTA 4DCTA 3V4FA 1ESMA 3KB2A 5L3VA 5CIQA 4H1UA 3IO5A 4PO1A 1SQ5A 1D2NA 1XMIA 1KI3A 2MSCB 3A4MA 1OZSA 1W4RA 2H17A 3Q7QA 3PEVA 1X6VA 4Z1MD 4JLKA 3HWSA 1VCNA 4CEJB 5KOYA 5HYDA 2KNEA 2IXFA 1G5RA 4FCTA 1NG1A 4LBYA 5TARA 3SEAA 2KBFA 1Z5ZA 4KV9A 2R8RA 1K5DA 4QNRA 1SL8A 3PALA 5FOXA 4URWR 3U3RA 2JQ6A 2ZI6A 4HLQB 5CB8A 2OESA 1SK6D 1G6HA 1MABB 4P5OE 2VP9A 1UKZA 4D0LB 3ASYA 3TMKA 4WOPA 2GF9A 1KK0A 1OXXK 3BORA 4NHOA 1VDZA 3B82A 2IHYA 1N5JA 4M21A 2PVBA 2EFDB 3CH4B 1NVVR 1R0XA 2N1BA 4IDQA 3REGA 3SN6A 2FNAA 2Q3FA 5FI1B 4TNCA 3TNFA 1YRTB 4Z8XA 2ZRHA 2ZROA 3IHWA 2V8OA 4A9AA 3GFOA 3QKTA 2CL6X 1WLMA 2EQBA 2JA1A 1AGPA 2QL6A 1XEXA 4B44A 1U81A 3VMFA 4XH9B 2K2AA 5HE9A 1CJUC 3EXAA 1KSGA 3SDZA 2Y1MA 1C1YA 4ASUA 4XWOA 3I5IB 5H1YA 1P60A 4P31A 5JEEA 3S1AB 3X1WA 3L2OB 4C0QC 1R0WA 3CF0A 3RC3A 1SMGA 2RGXA 5EP1A 1Z0AA 1YURA 2ZJOA 4LJYA 4RFSA 2WMNB 4LV8B 4PC2A 4IEEA 4JL8A 1D9ZA 2FGJA 3TAUA 3K0SA 1DF0A 2F7SA 5BYKA 4U02A 2QU8A 1ZMZA 1NSFA 4OHWA 3CF6R 3VRQA 4H9GA 3SFVA 3RNLA 3TSOA 1UF9A 4XJKB 1H8HD 2IC5A 2ZNDA 1H8ED 3EPLA 1ZYUA 1IY0A 3QVUA 2GXQA 4OK3A 1DT7B 4I5NB 1D5CA 3DOEA 3UMRA 2ONJA 1XTRA 2A7QA 2O8CB 3SG3A 1SXJA 1FF1A 1EFHA 1TN4A 1XPOA 1G8HA 1W5SA 5UKDA 3FGNA 5BN3A 5DISB 2WOSA 2ZJBA 4AC9A 1BG1A 1HT9A 2J7KA 1ZM7A 1OH6A 4LYFA 2IF2A 2PZEA 4RKFA 4UXIA 2W6ID 4IFBA 5JSZB 2KWIA 1KQMB 4DS7A 1BF5A 4HDOB 1OE0A 3HU3A 1VCMA 2Z4RA 3PG5A 3W6PA 2ZI7A 3J81k 1WDCB 1MOZA 3SBEA 1R10A 3SFZA 2IUTA 2QAJA 4OK6A 4ERNA 4ACBA 2NO7A 2QNRA 3AVVA 1DPFA 1JQLB 1G64A 1KFXS 1R2QA 1J1EA 3IQOA 2PLRA 3KUCA 4NH0A 5DHFA 2P5SA 1Q21A 4JVMA 4C0HA 5AUOB 4AYXA 1CM1A 3HPQA 3CRVA 3OP0A 1YKSA 3AGPA 2RH5A 2GJ8A 2KI4C 3BWDD 4DSTA 3SG4A 1CDMA 3OIYA 1T0HB 4PQFA 1CP2A 2C9CA 3GCGA 1TQDA 4RSGA 5EQTA 1W7AA 4DSNA 4L8GA 2VP5A 3SHWA 1DJIA 1FPWA 1L2TA 5J47A 2LCFA 1XCGB 5KYKA 4JVSB 2DHRA 3RS2A 1KI1A 2AWNA 1JR3E 4ZCMA 1UWOA 4YGBB 3W6OA 2CK3D 4OYHA 5LDDC 4NYMQ 3IBGA 2JXLA 5DN6D 2OG2A 1QX2A 4NBSA 1O87A 3U44B 2PALA 1Z8FA 3KKQA 4BLTA 3MCAA 3AVWA 4B35A 3E70C 3OEHA 1V1GA 1XD9A 2W83A 4ZCIA 3C5CA 4IOLA 1N0WA 2J7PD 3MGCA 1G19A 4QBFA 4B3CA 1E2HA 1KI9A 2VYFA 2QI9C 2VF8A 1ZW6A 5FR2A 1N6IA 3KF9A 4L9SA 3NDPA 4QJ5A 5BXQC 1S6CA 4KBGA 3W9YA 4QBGB 1DAHA 1XU4A 2ZSDA 4FTGA 1OXTA 5AJYA 4FMDF 4PSAA 4PE0A 2XTZA 3BXZA 4L9WA 5I2LA 1PLLA 1L7VC 4LX0A 1AA9A 2WWIA 1H8BA 5KDLA 3WRYC 4Y0AA 5EXSA 2YWEA 3K09C 1M74A 2IX3A 3FE2A 4JSYA 5JJLA 4GDFA 3HU2A 1V1FA 4ESHA 2NXQA 1WQ1R 5G3YA 4G5SA 3TGPA 3ZLJA 4F93B 4XJXA 4Q00A 2CT9A 4WVFA 1SZPA 4ON9A 3TQCA 1PLJA 1S9HA 4B3GA 4F92B 4G01B 5GVRA 1KI6A 5EZ5A 1QHXA 2YVUA 5DKQA 3W6NA 1KK8C 4DCSA 4EQ6A 4HZIA 5B2ZA 2BCBA 4KLNA 4GBAA 1F54A 2OCPA 2F8PA 3PUVA 5E7JA 1QV1A 2V54A 3N2EA 1IQPA 4F4IA 3CZTX 3KJHA 3Q5DA 4IXMA 2ONKA 4TZ0A 1HE1C 1QIWA 2J0VA 4LRWA 2L98A 1C9KA 4OI1A 3CPHA 3LBHA 3LWNA 1E79D 3I32A 3HU1A 1QG4A 1RYHA 1QVIY 4PE7A 3MMPA 4DLXA 3NC0C 1WXQA 4EJSA 4ZI3A 4Q48A 4Q03A 1OIVA 4RD6A 1XP8A 1SYMA 3PV0A 2WSSD 3GLIB 2IS9A 1IQ3A 2NIPA 2IL1A 2IWHA 5FL7D 4M9SA 4S2EA 3RRNA 1SR6C 3GLGE 4MRXA 4QHYA 1U8YA 1NY6A 2ODWA 3BUWB 3AUYA 3SOPA 1J7KA 2OAQ1 3QXHA 4TTQA 4U00A 3KQHA 3A1SA 4WW0A 2ZS8A 1XBTA 1I2DA 2CXJA 1RJVA 3VRPA 2F55A 4X8OA 1N0VC 4NQGA 4JLAA 4ARZB 5HKZA 4NYIQ 3DM5A 1NX0A 1CR2A 1F2UB 2PT7A 3CWGA 4CW7A 2YKGA 3SJCA 3M0WA 1U94A 2GF0A 1EFUA 2FSGA 3QQ5A 3K70C 3D3QA 2HXSA 4JLVA 5B64A 5B58C 1G5PA 5FUXA 2ZAOA 2CCJA 3VRRA 1M6NA 1XJQA 3KDSE 4FW9A 1E9FA 4HLUA 2I1QA 5KSYA 2P5TB 4Q66C 1XTKA 3CNLA 4Q01A 2KAYA 4N5XA 1Q1ZA 3V00A 1WDTA 2I1VB 2BVNA 4HB4A 1YUUA 1YZQA 3QXCA 4IRUB 3FYHA 4Q4JB 1CJKC 5AANA 1QF9A 2XZLA 2FEMA 3THWB 4AURA 1DJZA 3C1VA 1E0KA 2OILA 4IDNA 5HR5A 2LLUA 2OLJA 1J7QA 2FA9A 1QBKC 1CR0A 2CE2X 3U61B 2B7CA 5TY0A 4D80A 2EHBA 1N3BA 4N3NA 2DWOA 3EZ6A 5JJGA 3CPEA 4NYJR 4Q7LA 1M34E 1Q1BA 2Q4UA 1QTXA 2K7DA 1AJEA 5AUQA 2M3WA 4WQ3A 1KFUS 4PX9A 2WSMA 1S96A 3HPRA 4P4SA 421PA 1SVOA 2WCEA 5JJIA 3GLFE 1DAFA 1EX7A 3IILA 2ISDA 2REXB 1OE9B 1Z0JA 4RJLA 2WTUA 2PX0A 1M7GA 1LXFC 4YI8A 2AUCA 1GUAA 1ZIPA 2ODNA 3MAAC 4DHEA 1SL7A 4CEHA 1GRNA 1Q3TA 2P3SA 4QJ3B 1XTSA 1K9UA 1BU3A 2NO1A 4TLBA 1NBME 4P4SB 2JT3A 4HYYA 3IEUA 2G1KA 5HKKA 1SR6B 3AF0A 1P75A 2FZ4A 1W5TA 5FUYA 1OH8A 1NRJB 4Q18A 1P3JA 1N5LA 2CLSA 4PHJA 3AF3A 1B8RA 4PHNA 1JSAA 1PJRA 2IA5A 1G8GA 2Q3HA 3P4XA 4DLSA 3SJBA 2PMYA 1S6IA 2RHDA 3QKSA 5JS8A 2B6HA 3I5XA 1QXPA 2J0UA 4GOJA 2ZKMX 1L8QA 1KWOC 1FNNA 4G0NA 3GLGA 3PEWA 1CLUA 3N2IA 4D1EA 3QBTA 1NN0A 3AM1A 4QGHA 5EE9A 2A5DA 3W3ZB 2FCEA 3FWYA 3SJAA 1IJEA 2QN6A 4R1EA 4MDEA 4CLNA 2K7CA 1NLFA 2OFOA 3M4YA 3KKMA 3NWJA 5EXPA 3VNVA 1E3MA 4Q1AA 1BO6A 2REBA 4NCNA 4JLPA 4GRAA 4NYMR 3RANA 1JR6A 2IBMA 1NUBA 4L16A 2AR7A 3I3SR 2CK3A 4TT3D 2ZI3A 1AJ5A 2ORVA 4QGAA 3IQWA 2LHIA 1X02A 5E95A 3TUYB 2IYYA 4LHWA 3NIBA 4DIDA 1NF3A 1W49A 4IDOA 2JULA 4NDZA 5CK4A 2F3TA 1GKYA 1E1RD 1XDBA 4FMBB 1LB1B 2NPFA 1QRAA 3R7WB 5IT5A 1DMOA 2FFBA 3K9GA 1XD8A 2QROA 1LF5A 3BH7A 1KQVA 3OEHD 1TTXA 4YMTA 5FBRB 4HAXA 4GGFA 1ZUZA 4Q9IA 3TVDA 4JJKA 5GJVC 1DBSA 4IFEA 4JLNA 4OKHA 3ADKA 4XSGA 4QM7A 4NCJA 1COWA 1Z6XA 2IYXA 2WBLC 3R7WA 1OXVA 2JNXA 3PLFB 4OI2A 4GUKA 5G3ZA 5FPKA 2ZRKA 4LBZA 3LAWA 1XK4C 4FWTA 2ZSBA 1OLOA 1GRQA 1EXRA 3MRSA 2RGEA 5GJWC 3NEJA 2RGNA 1AGRA 4G5GA 3I62A 3BFVA 1FP6A 2ZJ2A 2FOTA 1SCVA 4TSFA 1IN7A 3CWQA 3EX7C 5HKYA 2Q9AA 1OF1A 4HB2A 4IEIA 2IEZA 3AF2A 1TNQA 4QKQA 2WMOB 1MKYA 4I1VA 2QMEA 2QPTA 2JJ2D 3GLIE 4AQJA 1F60A 2JIZA 1XFYO 3HR7A 3NH6A 3PUXA 4D4JA 1ZNWA 2P65A 1NVXQ 1HE8B 3E2IA 1DVRA 3L0SA 4LDJA 3O78A 1G5TA 4DDUA 2PASA 3SHFA 1OYWA 2WWWA 1A4PA 1ZUIA 2JJ2A 1OIWA 1TUEA 2ZE5A 3P27A 1VCIA 3A1WA 3NSKA 2NGRA 3TIFA 1HA3A 1B23P 4QBHA 1IWQA 3ZVMA 1ODBA 3BRWD 3EZFA 2OV2A 4LYAA 1UADA 5J4KA 1JR3A 5EP4A 5TXGA 2G9NA 1T8UA 2QM7A 1U5IA 4PZYA 1BIFA 1N6LA 4ZO4A 4UXJA 2IHBA 2GVZC 1OZOA 1Z3IX 4DIEA 1XWIA 1UUSA 3AP2A 5CDFA 4PHKA 2RMKA 1ZJ6A 3EZ7A 3SG5A 2ZQ5A 1KY2A 4LHVA 3PATA 1U5IB 3DZ8A 4RZ3A 1AK2A 3RDPA 4QJ5B 2FX3A 1YZNA 4MZJA 2PZGA 4ILEA 3EPJA 2HXYA 4RZXA 1QLSA 2DWPA 4HREE 3C14C 4OHXA 4TT3A 5LD2B 2GJSA 4DCKA 3K9NA 2HT1A 1VYVA 4UNRA 4Q4AA 4R98A 3F0TA 2W6JD 4DUGA 1KSFX 4D0NA 3M1IA 1AK8A 1W7JB 1HTWA 3P20A 2QE7A 3LK0A 3OZXA 2H61A 2JLXA 2OO7A 2XZOA 1DELA 2QT1A 2JZIA 4B48A 1ZU4A 4LHXA 2LHLA 1S6JA 1YR5A 1QZXA 1P61B 1YX8A 1T91A 1COWD 5SZKB 1LV7A 1NN3A 4CEIA 1GZSA 1CJVC 1XFZO 2F1RA 2BECA 4QJ3A 4MKGA 1OB2A 3JVTB 3QPWA 3UATA 1N6RA 1RK9A 2AL7A 3QXXA 4TLEA 4IDHA 3A8RA 1R8SA 5G40A 2LVKA 4DRWA 3GEIA 1E2DA 1YZLA 2XJ4A 3DF0A 3IHLA 1G20E 2ZIAA 4QRHA 1NL3A 1VECA 2K5UA 3G5UA 4O25A 5EUQB 3QVVA 1GDDA 2H1LA 3AVXA 4OBEA 3VRNA 2NPIA 3A1UA 4IOKA 4XWKA 5CSFA 2PCLA 2OPOA 3KJIA 1G3IA 1ZCAA 4DLWA 2GAOA 2W2VA 3BJIC 2LLTA 2O0KA 3I5FC 3IPXA 1RRGA 2WIAA 2GV5A 2ECKA 4P3YA 4XVUA 4BLSA 3LH5A 3TBKA 2KJQA 5HKKD 4OQNA 1P9WA 1AIPA 5A0FA 2QENA 3U2QA 2P6NA 4M4SA 4DC9A 2EVWX 3TUIC 3A4UB 3U7HB 4A82A 2JT0A 3K9HA 2FFHA 3IIJA 3KXIA 1DAKA 1DTLA 1E0AA 1W48A 1ESNA 4KHZA 3VKHA 4MRNA 3X1DA 2MRDA 2ZRIA 2ZRMA 5CIWA 3BUOB 2M29A 4EPTA 3LCPC 4HZUA 4PZLA 3AV0B 2L4IA 1KNXA 3MJHA 4FWIB 3BS4A 1HQVA 4WXRA 2C9OA 2HT6A 3SJSA 4DT1B 1N6HA 2EC6B 2N46A 3QJYA 3T35A 3KQNA 2BDTA 3K0FA 5CLLA 2VSFA 4R9UC 4HZUB 3AP1A 4OQMA 4AWXA 1M31A 1XFVO 4EQ6B 3T1QA 1RJ9B 3TDUA 1TQ4A 4PTLA 2WWYA 1AUIB 2ZE6A 1ZACA 2GBLA 1LS6A 3U6KA 1IAQA 1PALA 2FFQA 4JIMA 1XFAA 2BMDA 1NYAA 4IVQA 1GTVA 4A92A 5FYXA 3MFYA 4XVRA 3R9XA 2VHJA 5AUNB 1OMRA 1VMAA 4M22A 3GFPA 3BYAA 2NO6A 3OF5A 4ZKEA 4LBWA 2O0HA 2O60A 1GKUB 2CHQA 3FMIA 1E9RA 1IH0A 3D8BA 3GQBA 4JSTA 4LJ4A 4TMKA 4Q9HA 3KZ1E 4JLJA 3SYNA 3TW8B 1R8QA 4XWAA 3FOZA 3ZGXA 1DVIA 1WF3A 2DBYA 2ORWA 2VH5R 1R0YA 2WWHA 4DRZA 1Q0UA 1CDPA 3FKSA 2M49B 1OPXA 4JWQA 3QENA 4NKRA 4O0MA 4F0ZB 3MSXA 1H65A 5J40A 1QHYA 3SBDA 3PENA 2EWVA 4A6XA 1FX0B 2GCPA 4JPZB 3KPXA 2Y8EA 1UHJA 2BHRA 5HTKA 4CEIB 3X1XA 3W3AA 2ZR9A 1NKSA 1D1OA 1QHGA 4XTRA 3REFA 2IS1A 2WIBA 2F2PA 2VP6A 4GMXA 2DYKA 2ZYTX 3I8SA 4Q02A 1V5WA 2IXGA 1ZD1A 1S1EA 5AUPB 1LFDB 1ZIOA 1TF7A 3CX7A 3WP0A 1G18A 5E7MA 2KI4B 4RCZA 4AY2A 1CKKA 1MRNA 4A0GA 1AS0A 1E2EA 1MRSA 4ZCLA 3BXKA 3QE0A 1JNYA 4MGIR 5LD2C 3K1JA 4PSVA 4Q4LA 5CITA 2MLFC 3O2PA 2OE2A 2ZI9A 3TZ1A 3ND9A 1JUOA 4BECA 2QBYA 2GBLC 3BOWB 5JBQA 5KDOA 1CFDA 3CZQA 1SCMB 5FI0B 1LY1A 1B7TY 1KQMC 1FNMA 3LY5A 1MR8A 3FIAA 2ZUBA 1CB1A 3FMPB 3G0HA 3ICQB 5JSZA 3EZ9A 1IN5A 1XA5A 1DJWA 2C5LA 1U0LA 2J1LA 1E4VA 1M2OB 1BODA 3ONWA 3HX4A 3AF1A 3PIRA 2JNFA 1UHKA 1DJHA 1JXOA 3KHEA 2BV3A 3GLHA 1MUXA 2RGAA 2NO0A 3MWKA 4LPSA 2ZRPA 3FFAA 3KJGA 1II0A 2HV8A 2F43B 5AEQA 3H0KA 2WCBA 4HLDA 3W8RA 2ZRTA 2ZJ8A 3LO5A 3LVQE 1JAIA 2BL0B 2COLB 5JHHB 4ETOA 1CJTC 4CFRA 1XD2A 2WKRA 1RIFA 1PSRA 4GI7A 2BCXA 1U0JA 4MITA 4UKDA 1P2UA 2FEOA 2IYSA 2OFXA 5FOWA 2AWOA 2OT3B 4ABYA 4M2PA 4W7SA 5EE0A 1D8TA 3JZAA 1GIAA 4JT2A 3WNBA 2W6JA 3ZWHA 4W5HA 1QASA 4KVAA 2BJWA 4MGZR 4US1R 5C1BA 4CEJA 5CYPA 1NBMA 1PVAA 1RJ9A 2L0XA 3CZPA 4PFSA 4RVCA 3F3YA 2JLQA 4RD4A 1NLYA 3ZVRA 5IRCD 4DDWA 4HUQB 1WB9A 5BN4A 2FPKA 1YX7A 1SKYB 4PO8A 3TLXA 4Q4HA 4C0LA 1UDXA 2O8EA 1HQCA 2A78A 3IKJA 2HQWA 1I4TD 1IXRC 1FTSA 3RLZA 1ZP6A 2Q6TA 2XITA 4HEJA 4TYPA 5CJ2A 4A36A 2XXAB 1TOPA 2M1KB 2BCAA 2LANA 1AN0A 3SIBA 2AFHE 3ZD7A 4TTPA 5HCNA 4MLWA 4P4TA 1HURA 3I72A 2PEZA 4LJAA 5F3WB 2XTMA 1OH5A 4KFRA 5D7FA 3TS5B 1OMVA 2D8NA 3QG1A 4QHTA 3DKPA 4B71A 2VL7A 1VHTA 2QG6A 1Y1AA 3TUZC 2XNSA 1P72A 3NTUA 3BFKA 2ZYUX 3WXAA 4GL2A 5DI9A 4GGFC 2H7VA 2ZRSA 1J99A 4GPTA 1EFRA 4BLPA 4A8JC 4M1WA 1TQ2A 2A5FA 1KI4A 2RGGA 2VSXA 2ZI4A 5I2OA 4A4BA 1Z6YA 2X8AA 1MT0A 2GGMA 5C18A 2OSBA 3DL0A 2ZVPX 3C16C 4OI4A 4HB0A 4JT4A 4WAUA 5FFMA 2BBNA 2GZAA 3WNCA 1B0UA 4N1GA 4BASA 1SVWA 4A15A 1NN1A 1JJVA 1U0HC 1FTNA 1DAEA 5L3QB 1QATA 2MBXA 5SZHB 2P6RA 2HYDA 2QBYB 4BWYA 3P1JA 2CCGA 3BE4A 1D2MA 4Q4AB 1A2XA 5GVSA 1P73A 2M9GA 1F71A 1AQYA 3KKPA 2D7CA 2Q9BA 4DLUA 3DDCA 5ELXA 1T5IA 2XGJA 2PEYA 2GEDA 4DCUA 1RE0A 4HDQB 2RGCA 3H2YA 2F1JA 2W2XA 4A0FA 3ZVNA 3SQXA 1NCZA 1YVDA 2LVVA 3RVBA 4L4UA 2G3YA 5DSZA 2LV7A 4DUQA 1UKYA 2JXCA 1GITA 3ZIAA 1NSTA 3E3RA 4AK9A 4PE4A 1GGZA 1KAOA 1GL7A 2QRZA 4GP7A 4CDGA 1R5OA 1E1QD 1F8HA 2QMHA 1YRUB 3VGOA 4ORBB 2LUCA 1UBCA 1FP7A 2BBWA 4A2QA 3LXRA 1S4QA 1FMLA 3VTKA 3OX5A 4BFYA 3QG5A 5TB5A 3VFDA 2NG1A 1CTQA 3PEUA 2JC2A 3WNXB 3PVSA 1DG3A 4KO8A 3I4LA 2MJWB 2NOAA 2PZFA 1KSOA 1B4CA 4YGCB 2GDJA 5GQQC 4TWZA 1G1MA 1W47A 1J7OA 5HZKA 4DIRA 5JZVA 2IEYA 1A75B 1JECA 3IIMA 1U90A 3ZQJA 5FTLA 3Q85A 1DGUA 2KSPA 2QQ0A 1KDOA 3EVUA 1Z6TA 3VR6A 1I2MA 3RSLA 3R9IA 1RROA 1UKVY 3LVRE 2VP4A 4EPYA 2KFHA 1EG3A 2FSFA 3NHBA 1S5GY 2V53A 1JF0A 4XJKA 1VG1A 2ZRDA 3LW7A 3SNHA 2ZEJA 2QTVB 3U4QA 3HJNA 4EJSC 3BBPA 1CLMA 3H4SE 1TNWA 2FH5B 1HY3A 4Q5IA 3BUXB 4QHSA 4ZDKA 5JI2E 1IJ6A 4DXAA 4CVNA 2JAQA 4NDCA 1GNPA 2CEAA 1EH2A 2CBZA 3O47A 4BZPA 1LKJA 1E9CA 1N5KA 2WSSA 1JJ7A 2R6CA 1EX6A 2ZU6A 4LV6A 4AKIA 5CJPA 5L3RA 3TW4A 4PPFA 1R6BX 3I73A 2D06A 3GMTA 4AD8A 4E5UA 1IN6A 3KEVA 3QF4A 2CDNA 4DJTA 2KYFA 4YBHB 1G8PA 1SL9A 2HPSA 2LKDA 2JJ1A 5JMTA 2MSEB 2XZPA 3AUXA 1DAIA 3I5HC 4NDDA 2KAXA 1C4OA 2XNDD 2GVDC 2WHXA 2QAGA 3CRW1 1M7BA 4K46A 4PAOA 1T3HA 1JI0A 2NZJA 1DO0A 3UG7A 2OCBA 2BM0A 4NMMA 3TDZA 2BKIB 1IXSB 1WE2A 3BB1A 5HLOA 3L0IB 3LLMA 1I4DD 3L43A 1FZQA 2G6BA 5TDHA 4DEYA 2DPXA 5CYOA 2ANBA 2LMVA 3VX3A 2MLEC 1QHSA 2ZRAA 5FL3A 4RFSB 2K7BA 4EIWA 1RZ3A 1EK0A 2RGDA 5KPJA 4AI6A 1DOAA 3B1WA 4MRYA 3WNDA 4BY4A 1M7HA 2FSHA 1B8CA 3EK4A 1NMZA 1YUSA 1NJFA 1NMXA 1SULA 1M1YE 3CH5A 4CZ2A 4DBLC 4GOKA 2G1JA 1W4AA 4LY6A 5F9FA 1P2VA 2BIFA 2KFFA 4ZIRB 3I1FA 5EZ6B 3UXMA 5JRZA 3EVRA 1PSBA 5BQ5A 3TDIA 1HT2E 3RWOA 5A4JA 1S1MA 1RW4A 2AK3A 3U3KA 1E96A 4BEBA 2ZYVX 3IF7A 2VHQA 3CWZA 3A4NA 3DVJA 2CVFA 1XJCA 4M1TA 1P5ZB 1OSAA 2I4IA 2AAOA 4TYQA 2DFNA 2CCMA 2O0JA 4AIIA 4DLVA 4KYUA 2WKPA 4B2PA 2QPAA 3BGWA 1JPJA 1W4BA 2JU0A 1OH7A 4ZI2A 1WMSA 2QSZA 3O4YA 1CDLA 1XZQA 1LINA 4GAOA 3M6AA 3FWBA 3DKVA 3WHUB 4K8OA 5FR1A 3O8DA 5HPYB 5SZIA 3GK2A 4M2QA 1U9IA 2G88A 1N6NA 2GK7A 4DLZA 2BWJA 3AKYA 1A1VA 4YGEB 221PA 4WBSA 1EFRD 2ZE7A 4H1VA 4F4JA 3MWYW 4MYCA 4I99A 2R6AA 3EPKA 1BKDR 1U2RA 3ZZUA 2FGKA 1YTZC 2B1UA 3AAJA 3CONA 5KSPA 4JMPA 2J7PA 3GJ5A 3KB1A 3ZQ6A 2VP0A 1YU9A 2W6IA 1QHNA 3JTDB 1N0YA 3BUNB 1IXZA 1QV0A 2O5GA 1DE0A 2ZUDA 1ZMXA 3IGFA 3FHTA 3PCRB 2YHSA 2CJWA 4C0AC 5J4HA 2IS6A 3BERA 2Q21A 2LLSA 1IN4A 2OS8B 4NL4H 4AYTA 3ICEA 1NCXA 1RPZA 3ECCA 1CRPA 3VR5A 4CT5A 4BY5A 2J59A 1U8ZA 2SASA 3C7KA 4HB3A 2F2OA 4NPHA 2M8UA 3GK1A 4GZLA 1KO5A 4XIGS 2HLDD 5CLQA 2JTZA 1Z29A 2F9MA 4AG6A 4BFSA 1S3SA 4L9MA 3W8NA 2GEVA 5F2EA 4F91B 3PN7C 1XZPA 5EXTA 3RAPR 3W5JA 4YLGA 3AVOA 1G7SA 4MRVA 2A9KA 3G82C 1CS4C 1J7RA 1A2KC 3IQXA 4I81A 4TTRA 3THOA 4DCVA 4URXR 2H18A 2DWQA 4QOSA 4OL0A 4HI0E 4OV2A 2HDNB 1S0UA 2CNPA 5JHGB 4D4LA 3V9PA 1KI2A 2QSYA 1T3SA 1W46A 3KKOA 3WY9A 4D25A 2ZUCA 1UEIA 2YWFA 1P62B 2NLNA 1Z06A 2V1XA 4ZV4A 2R6FA 4NDBA 1ETUA 2FWRA 4HSEA 1IOZA 1VKJA 1MO5A 3CRQA 4JZKA 1SVSA 3UWOA 2YINC 1U99A 1TNPA 5CPVA 1Z6AA 3EZ2A 4ITRC 4LYJA 3X2SA 1Q1EA 1CFFA 2WJGA 1NX1A 1G7CA 2K8MB 3AGQA 3R8FA 2KOTA 1X8LA 1WY9A 3VU9A 1FX0A 3N70A 3OEEA 3VKGA 1IKUA 1VPLA 4W5WA 5H8WA 4GGNA 4PHHA 1E0JA 2W00A 3QXJA 2MSDB 2O8DA 4XOIA 4MGYR 2IT1A 1K2HA 1UURA 1E99A 1XEXB 2WV9A 4LC1A 3K21A 3Q8XB 2EC6C 1BMFA 1N5IA 2C9YA 1G3QA 3GEEA 5EE3A 2ZYWX 3U7GA 1B8LA 2GNOA 4PHGA 5DO9A 1KZGB 1Z2CA 5IK2A 1TL7C 4HAZA 2H2KA 1ZM9A 5J4LA 3NSLA 2BEJA 4M1OA 4TQUS 1KHTA 2FCDA 3AKCA 5D3QA 3SR0A 2BBMA 2A2ZA 4LJ5A 4YMSA 3EK8A 4U5XA 1YJ5A 4GOXA 2BL0C 2CXXA 2LP3A 2HF9A 2QM8A 4C7OB 2BCJQ 3I5HB 2B8WA 1XFUO 2V6JA 3I92A 2VA8A 2WJHA 1XCMA 4WQ2A 1GNQA 2OAP1 3GD7A 5JCPA 5HE8A 1OFHA 1TUIA 3I5FB 3NSOA 1DG1G 3P26A 1Y0VH 2JLSA 3F5FA 4IVRA 3ZIAD 1NI3A 4M1MA 5AJVB 1DAGA 2LUXA 4EPVA 5JECA 1XNJA 4AKGA 2FZLA 1WRKA 3U3OA 3DO6A 1J2JA 2J3EA 3CX8A 3UMFA 3HYRA 1S26D 1S1CA 3T06B 2GK6A 3SIAA 1AS2A 5FUVA 2L2EA 3QKRB 1OHHA 1E4YA 3FWCA 1DJGA 3W90A 4Z51A 5KTYA 4IL1A 721PA 1TNDA 2ZJZA 3K0CA 2JPTA 1S36A 2BBTA 5LB4A 2WJYA 1II8A 1TAGA 1KKLA 2O5VA 4BFXA 3QPUA 4GSYA 1NP8A 2A5YB 4Q9LA 3BUMB 1G7TA 3B7GA 1X1RA 3QNUA 4LHYA 2PH1A 1B9AA 2I3BA 5E4FA 2A3RA 3CB4A 4GP6A 3WXMA 1K8UA 4B3DA 5KNBA 2V9PA 3KQKA 2E87A 2QEQA 4Q9KA 2FFAA 3RM1A 4MSPA 1S3GA 4HDCA 1OYYA 3SZRA 3BB3A 5DE3A 1KMQA 3C41J 3LW8A 1RC8A 3JVVA 1KMHB 3SG6A 2C96A 4JL6A 2BCGY 4QG7A 4UQOA 3VR3A 3DVKA 3SI7A 4PHTA 1J7PA 3FMFA 2C8VA 2ZTSA 4FI3C 4M53A 4X8HA 2LWIA 1SY9A 5G08A 4C0KA 3OIWA 4GFDA 2AKAB 3RRYA 5AJXA 2ZNEA 4I1SA 4TL8A 3PQCA 5FOVA 5C2JB 1NKTA 2MHHA 2OFWA 3Q3JB 5FTKA 1KDRA 4TL7A 1FOEB 4K81B 4OQLA 2CCKA 2EU8A 4LUCA 1Q57A 5KU1A 2DFLA 2ERXA 1AP4A 2E1RA 4DDVA 2FF7A 2LVIA 4AOMA 4KAXA 5KHOC 1EFCA 3GJ7A 5IK2D 2ZJYA 2WPDA 3B5JA 2IF0A 2ASEA 1WP9A 3MG9A 4V0LA 3U3MA 2KFGA 2J5XA 1L4YA 1XPRA 1OOJA 1E9AA 1ALWA 4KU4A 4OHVA 2KSQA 2QGZA 4JLDA 4O3MA 4PC1A 4PHFA 3EAQA 2J0UB 1KO7A 1K95A 3CO5A 3OE7D 3P4YA 1G3MA 2EW1A 2AN9A 2R62A 2AD5A 3PFIA 1OXUA 5JWOA 1NX3A 1KI6B 1FQKA 4BZQA 4PC7A 2QGNA 2VBCA 3GOFA 1P6XA 4V03A 4DB2A 2AFIE 4GNKA 2JLRA 4D4MA 4UPGA 1ONBA 4QFMA 3OHMB 2QP4A 4V0OA 4C7OA 4CRWB 1QX7A 4DUGD 2F1IA 4Q7JB 5SZJA 4Q47A 1Q22A 4BLRA 3QIAA 1E1QA 1E94E 2EFHB 2GWHA 4JKYA 1KI8A 2NO9A 4OJQA 4LWZA 3A1TA 4AKEA 5J5CA 3VQTA 1B47A 3CGAA 1IY1A 4OR9B 3LD9A 2JRFA 1MO4A 3Q9LA 3ZS8A 1LA0A 2JLUA 4EUNA 1GWNA 1T4GA 3GJXC 3C5HA 4CFQA 3O8RA 3FMOB 2DFKB 3QBVA 1N2CE 3B2EA 5JS7A 1OJLA 1GVNB 5JEDA 3Q5EA 3CR4X 4JJZA 4BLQA 1JFJA 1GP2A 3CNNA 2C03A 4TMTA 2G2BA 4MZLA 1JR3D 2GAAA 5P21A 1YQTA 1KIMA 2QORA 1KJWA 5BYJA 3T61A 3EA5A 4Q1BA 3OX6A 2BC9A 2XAUA 4A4DA 2ZM5A 2VHUA 1UAAA 2XXAA 3K9LA 2TMKA 5KDDA 2XX3A 1CFPA 3JVTC 2JASA 3GJ0A 4JYBA 1CF4A 2HLDA 3LV8A 1E2LA 1KAGA 5B57C 5EJEA 1QVIZ 3RC8A 1W2GA 5GJBA 1PRWA 1P9RA 3RABA 1UFQA 3OB1B 1N0UA 3LLUA 3QUSA 1PV4A 1W0JA 1NIWA 1IN8A 1ZRHA 1G291 1EG7A 3FFBA 3QF7A 1OIXA 4KXFB 1KMHA 1QDEA 3AH8A 3MSEB 1CU1A 1E2IA 3U4QB 3O8BA 1R5BA 2P6BB 4URUR 3EIEA 3EA0A 2Z6VA 1CTRA 1EJ3A 1OKKD 2AMIA 1X8KA 2CNWD 2VF7A 4G1UC 2L5XB 4RD2A 2HJGA 2ZRJA 3R8CA 3EG5A 2K7OA 4OVNF 3QEOA 2QPOA 2Z5FA 2D7DA 1E98A 4KFUA 1KSMA 5ER4X 1CKEA 4JVLA 2VSOA 4X8LA 4GPLB 4B3BA 1GOTA 2ZS7A 2LVJA 1K90D 2JDIA 2UVQA 2I7AA 1NNEA 2BM1A 2R2AA 1NJGA 4JLMA 3B8HA 5CB6A 3L8ZA 5FH9A 4C0BA 1GL9B 1QJTA 2HCBA 3AQ4A 1MHOA 2J45A 2V7QD 2W0SA 2A4JA 5DI3B 1LVCD 4CIDA 1OQPA 3EWSA 3ZDQA 4KITB 2HF8A 1NCYA 5FPHA 3QF4B 3VKWA 1G6OA 4YMWA 2K61A 3ADCA 3K0EA 5TVKA 4CEHB 3LBIA 4MKHA 1U8AA 2ZSFA 4N0DA 1M63B 3EKJA 3VROA 1F2TB 5FBQB 5AR1A 1R0ZA 3VU9B 2Z43A 4RD0A 1W0KA 2M7LA 1Z2AA 4YXWD 3B1VA 2OXCA 2F3YA 2G0TA 1D6JA 1BMOA 3VHLB 4TMWA 2KI6D 5CM8B 3ZYCA 5KNDA 4L5BA 1NVWQ 1ZFSA 1J8YF 3OAAA 2G77B 3LBNA 4BGDA 2BEKA 2ZITA 5L3QA 1YRAA 5KSZA 4NCKA 1FMJA 4LI0A 4DKXA 3EPHA 4TZ6A 1XFWO 2ZI5A 5JWHA 1LVGA 1T3LA 2VTKA 5DNYB 4KBFA 1WBBA 4RD1A 2OLKA 4BQSA 1UBGA 3IDQA 3K8YA 4ZPXA 4Z1MA 4B2IA 3ADDA 2KYCA 1MWNA 1F5NA 3UANA 1M45A 1E9DA 1SVIA 5JCZA 4XD7D 2MMCA 5JJKA 1XTJA 4JBXA 2L0PA 2L50A 1JWDA 1G16A 6Q21A 4A2PA 1F2UA 3CS1A 2C98A 4I1OA 4DLTA 1KDTA 2B21A 3CW2A 3DVLA 1DAMA 1XD2B 4B6FA 3LX8A 3K0AA 3PEYA 1DS6A 3I61A 1VYTA 4FMCF 1ZOTB 2M97A 3T5DA 4DWJA 2JCSA 1BYIA 4FN5A 3WP1B 2AK2A 4NYJQ 4C9BA 1R6PA 2WOOA 4KODA 4TLAA 1Y1XA 4WXPA 2ZR0A 4ACAA 4Z54A 2WWXA 1J70A 3K0AB 2IUSA 1ZNZA 4UJ3A 2PL3A 3WMGA 1KK2A 4OHZA 1H4BA 4YC7A 2WOJA 2LE9B 3UIEA 1VCOA 3WHLA 4R2HA 3CX6A 3EARA 3CR2A 1JEEA 2FJUB 1YR6A 2D3WA 3HDTA 2M7NA 2J41A 2CMKA 3QOFA 2CBLA 1PUJA 4E03A 1YZUA 1D9XA 3AKDA 1Y3AA 5K8LA 4TYYA 4PQRA 1NP6A 3RS4A 4U8DA 2FJUA 1Y6WA 1G4AE 2OXRA 1JEDA 4GT1A 2X77A 3THYA 2Q9CA 3RS3A 2EYUA 1MR3F 3D10A 3IUYA 4HATA 2Y4QA 1HV8A 3KXLA 4LYHA 4E09A 521PA 2DFTA 1XEWX 3W5IA 1FPMA 1UKEA 1ZAKA 1OW3B 4Q1DA 2ORIA 3PUYA 4HLUC 5JRJA 5PALA 2GEUA 2OZEA 1E6CA 3F8TA 4BEJA 1TTTA 4F7WA 4A1FA 1KK8B 1IJ5A 1UHIA 2JLZA 1K9PA 2XEXA 3LDAA 3OIUA 4EDHA 5F6TA 1GJYA 1UJ2A 2OCYC 4YDHB 4C30A 4EPXA 2GXSA 1BYUA 2WCFA 4B73A 1OB5A 2YWGA 1WBDA 5K89A 2E30A 1W36D 1QLKA 1MQ1A 1G8FA 1T0JB 1ZM2A 2ZN8A 2IXEA 4TMVA 3PSRA 5KO2A 4LSGA 4TN1A 1AS3A 4PC3A 1KO4A 2ZPTX 3CPJB 4M9QA 1IRJA 1XB2A 5TV2A 3NBYC 4BFWA 2PBRA 2NMVA 1G4UR 1G9XA 1CR1A 3TK1A 1P4SA 3F45A 1L4UA 3ZZTA 3LNCA 1ALVA 5FL7A 4ZIRA 4BUJA 1YUTA 1DF0B 1E2FA 2A5JA 4LJ8A 1G3RA 1XF9A 1MO6A 4FMCB 4WZAE 1IM2A 2WNDA 1NY5A 4PANA 1GKIA 2H92A 1XMJA 3NSIA 5JLJA 4JKIA 4PPNA 3QRXA 2FMXA 3DVEA 1NIPA 3B85A 3KFXA 2OCAA 4P0TA 2OHFA 4AKHA 1ZNYA 4KVGA 5CSJA 1XJ0A 2QE7D 3WMFA 1HT1E 5A5GA 1G21E 2VIIA 4TMXA 2JDID 2QACA 1AZSC 5DI3A 3KUDA 4MQBA 2YZ2A 3NEYA 3GLHB 2MAZA 3K09A 1GL6A 2F3ZA 2N42A 5CDFE 2LP2A 2PLFA 2PSRA 1Z6GA 4Q9JA 4Q04A 5J4YA 2F43A 1XYDA 2D62A 4Q19A 1F2TA 1OFIA 1T8TA 1CMFA 4UNSA 1KGDA 2YNMA 1A29A 1K96A 2P6UA 1ZM3A 1NMYA 1WRLA 5AERA 1IGVA 3TH5A 2G9BA 2ATVA 5E3HA 1XMVA 4XYNA 3SJZA 4YMVA 3DF0B 1Q20A 1GG2A 2BMEA 3TKLA 1BLQA 1CJMA 1TQ6A 1TNXA 5D69A 5EP3A 3CLNA 2LCPA 2NQ2C 3LFUA 3JZMA 3GJ4A 2DCUA 1C07A 5GJCA 5DYGA 4TLCA 4TL6A 4B3FX 3DD4A 1QG2A 4I1UA 3TR0A 1ZD8A 1H8HA 1ZU5A 4LJ7A 3CR8A 4B76A 4CT4B 4OHYA 5J3XA 1AQUA 3ZS9A 1IG5A 2OTGC 3AKEA 4Q1FA 4HUQA 1E2JA 4BZXA 3L0PA 3VR2A 1W7IB 4IXNA 3AAKA 4NP6A 2IYRA 5L3SA 1KK7Y 4GFTA 4MVFA 1F48A 3KJEA 3TSWA 2D2EA 4URZR 2XB4A 3BH0A 1M8PA 3SYKA 1XEWY 4L15A 5FPTA 4R2IA 1EWQA 3KFVA 1IY2A 1VTKA 4KYIB 1UHHA 1YR9A 2X2FA 3T5GA 2YV5A 1G4YR 1UBEA 3VAAA 2NZ0A 1KK7Z 1NBMD 1ZC3A 2FE4A 3I5GB 1A7JA 3SU8A 1TEXA 3EIQA 4YDSA 2HQ8A 2W0MA 1OT3A 2F9LA 2O8BB 2CTNA 4ICBA 4A0HA 4M8NE 1ZCBA 2VQSA 4EKDA 2KQYA 3FKSD 3OFNA 2BMJA 1NX2A 1NWDA 4JBYA 3K0CC 4QGGA 1K93D 3LL8B 2XTNA 4G5OA 2WC8A 3UPUA 2QUZA 1CLLA 3VX4A 1ZC4A 3WRXC 1Z47A 1L2OC 2V4ZA 3H4MA 1DO2A 1FBVA 5IBWA 1D2EA 3SQWA 1K5GA 5E7IA 4A2WA 4YRUA 1T6NA 3B9QA 2EYQA 4IJMA 4EPRA 5EE1A 3CIOA 2L4HA 5G53C 2WICA 4XSHA 4RZUA 4HRGA 3LK1A 4KFSA 1ZUHA 1W36B 2D4HA 1NLZA 1S3PA 1SGWA 3ASZA 3DMNA 3PITA 4LJ6A 5K8IA 1CDNA 5GADl 1XXHE 2GA8A 1TCFA 5AWFC 3A58B 1AKYA 1E2PA 2KI5A 4LOAA 2HCJB 1K6MA 2I2RE 3TUYC 1E2QA 1GSIA 1KZ7B 1Z08A 2YC2C 3FKQA 3NKVA 4RCYA 3D6TB 2ZU0C 4EFMA 1BJFA 2GILA 2QP3A 4A8JA 2ZRCA 4PC6A 4NZYA 4Q1CA 1S8FA 3IO3A 4M9ZA 4Q7KA 4V0MA 1PZNA 3GLIA 2LNKA 2AX4A 2J87A 2ZAMA 2WWFA 1ZBDA 4QNMA 4ZCVA 3WYGA 4JLOA 1X8JA 1UPTA 2X2EA 3OESA 3P32A 1B7TZ 2ZANA 3ZJYA 4ZDWA 2CL0X 1C7VA 1HEIA 2GESA 3CKLA 5KPDA 1LNZA 2FSIA 4KLZA 3GLFA 4MZKA 4IHQA 2SHKA 2JJ1D 2F6RA 1SHZA 1XXHB 3SS8A 2GRJA 1KWOB 4F4CA 1SW8A 3AVQA 2XNDA 4RZ2A 2KQ6A 4UNNA 1KDPA 1KY3A 2IK8A 3A37A 1QVAA 2V55B 2C95A 1P9NA 5JI3E 1N65A 3IQQA 1JBKA 1ZUNB 1JF2A 4IW3B 2UKDA 1G7RA 4LK2A 4WZBE 4CPVA 3SE0A 3QEJA 1T9HA 1Z0KA 1KK1A 1HQYE 4QJ4B 1KTVA 1WDCC 2J9RA 4NONA 1ZNXA 1RFJA 4JLBA 3NHAA 5B8IB 4PQYA 3RYTC 3K70D 2M0RA 4ZKDA 1KSHA 4TYNA 2C99A 2YOHA 2Z0MA 1G8YA 5AK0A 4NTZA 4PDZA 5FPSA 1CR4A 1E1RA 4A4CA 5FTNA 4ZDIA 5K8TA 2WORA 2J46A 3EKHA 2YYZA 3M0EA 5EUMA 4YGDB 1TU4A 4QBIA 3AKAA 2RGNC 3B1XA 2H5EA 4B74A 1RFLA 4C2TA 3THWA 2HF5A 3QI2A 3A36A 4P4UA 1ZVQA 3RHFA 2CVHA 1XPUA 3AB3A 1II8B 2ZFDA 2DR3A 1Z63A 2O52A 5C4GB 3DM9B 4TL9A 1Q80A 4AYWA 1JB1A 2OBMA 3T1TA 4D2IA 2RKOA 2IYVA 3GJ3A 3FS7A 4HLCA 1CNPA 5CM9C 4BRUA 5I8NA 1FUUA 2B7BA 4I5LB 1KFUL 1JBAA 4QGFA 4KCGA 4D81A 3AF4A 2OEPA 2XSZD 1DJYA 3BAFA 1NSHA 1TX4B 4EFLA 3DVMA 4QC2A 1Q44A 3UKDA 2Z83A 3VNUA 1N6KA 2WZQA 3RS0A 1YZKA 4HUTA 2IYZA 5G41A 1LTQA 3BIFA 5FBVB 3GPLA 3IBYA 4MYUA 1NG9A 2FPMA 1CXZA 1KFXL 2ATXA 3RS7A 1W4CA 3TJZA 1LA3A 1KOFA 2SCPA 4FQOA 4UNPA 2QP9X 3I5YA 2R2IA 2YJTD 2J0QA 2GJAA 4IVPA 3K70B 4FIDA 3DHWC 3FB4A 1TU3A 5HCIA 5AFPA 2WM9B 2ZRFA 2RB4A 3MLEA 1YR7A 1BH2A 4M1YA 2GXAA 4PHMA 4EAQA 3MD0A 4PPQA 4U7DA 1KJZA 4PO9A 4JQ0D 3BQ3A 4PXAA 4URVR 4B34A 1JC2A 4UNQA 2YOFA 5IDVA 4DCNA 2PMDA 2XJ9A 4OQXA 1Q1QA 3IEVA 1W1WA 3PUZA 1OFUX 4Y0VA 4DVGA 2ZSEA 1S9DA 5EE5B 2BKHB 2Y5IA 2BMFA 4JYCA 2QTFA 3BFXA 3KL4A 1I4LD 4OQFA 3GLFB 2R9VA 4PSKA 2QMUA 1BOFA 3A1VA 2F3RA 3QY0A 3VR4A 2O8BA 4GNKB 4A6PA 3ND8A 3DEFA 3BOWA 4NCHA 2JGNA 2V6IA 3B78A 4UXHA 2J0SA 3TVTA 1W0KD 5D3MB 1VG8A 1K9KA 4C0JA 1E79A 3AEZA 1KYIA 2OM2A 1QHHA 3NVAA 3T12A 5KNCA 1W36C 1Z0IA 2WAXA 1QIVA 3GEHA 3NBXX 3LRPA 1PLKA 1UM8A 3NXAA 2VHCA 3CUEF 3EVVA 1YZTA 3CBQA 3BOSA 2TN4A 1TCOB 3E1SA 3CR5X 5D3MA 2LAPA 3AVPA 5JFGA 8OHMA 4OCIA 1L2OB 1R5NA 2WWGA 3KX2A 4ZDJA 3ZH9B 1V43A 1HYQA 2GJKA 2O8FA 3UG6A 5DKRA 3MUFA 5H68A 3U3JA 2Q3MA 1EG4A 2OBNA 3UWKA 4OI0A 2YOGA 4C4PA 4P2YB 1CMGA 2KHNA 2ZJAA 2Q0HA 4ZCUA 4C2UA 2A5GA 3H86A 1YR8A 4J0QA 2Z4SA 3EIHA 1J1DA 4B2LA 3PN7B 1X1SA 2JT8A 1IHUA 1NIJA 1SXJE 4TSFD 4DDTA 2IS2A 5DGXA 1QVRA 1SXJB 1XTIA 3EWAA 3AVUA 3ZD6A 1CBUA 1LF0A 1JFKA 1XEFA 4HAVA 4N1AA 3QXSA 1TPZA 1VIAA 3NH9A 2OS8C 4PALA 1XTQA 4ARZA 4TQAA 1VHLA 3B9PA 2PRUA 4Q4HB 2O8EB 4Q1EA 3Q72A 4MUBA 2CL7X 4OKSA 5FTMA 4E07A 2QAGC 3NBZC 4I5KA 1MH1A 3EW9A 1XXHA 2OTGB 1F6BA 2H16A 3NBFA 4B75A 3CTNA 1CIPA 2MMGA 3FTQA 3NG1A 3OAAD 2L51A 2UZ3A 3AVYA 4N1FA 4G5QA 4HAUA 2G0NA 2C04A 3N5CA 121PA 3CF2A 3KKNA 2WKQA 1X86B 4ASUD 3GJ8A 3NXSA 4E68A 4BRWA 2ZSAA 4KFTA 4B3XA 3UK6A 2VPPA 1Z28A 2CJWB 3HYTA 1MO3A 4NYIR 2D2FA 1P2SA 1EXMA 2R6DA 3QPVA 2R44A 2KGRA 5CK5A 5BPJA 4B47A 2EFCB 2QRNA 4B6EA 4ORCB 2GTPA 4BFUA 621PA 2F1HA 4G3XA 4MEWA 1DADA 3THXA 1E9BA 1SXJD 4BFTA 1F4QA 4MRSA 4M1KA 1SVLA 1FUKA 2IWRA 1N2DA 2RHMA 4WRIA 1EFTA 2VP2A 4M2LA 1KJYA 3B1YA 3L8YA 2ZXUA 3CM0A 4JBWA 1US8A 1R2UA 4KSCA 1E2KA 2ZRGA 1GM5A 4LBVA 2LC5A 2K0JA 1P7CA 2AD1A 4MYTA 1SXJC 2JIZD 4FINA 1SKQA 1A82A 2IYQA 2REOA 1ZD9A 5C46F 3HCMA 5FOTA 1F55A 2HUPA 1Z0FA 2GGZA 2WAYA 4A0RA 4MDFA 3MJRA 1WRZA 3H1TA 3D7MA 4US2R 1C7WA 3TRFA 3B13B 4LHZA 4FD2A 1SPYA 5BN5A 3ADBA 1SKTA 3WHTB 1TEVA 2JOJA 2FU5C 2NCPA 4C3ZA 4WZ6A 3OB2B 2FN4A 2VRWA 1NPQA 4HSZA 1G17A 1HH4A 1N25A 4MKIA 1SBJA 3NC1C 4JS0A 1E2GA 2R65A 3LXXA 5HKWA 4XVQA 3QKSB 1U98A 2FV8A 2DY1A 2KBIA 2ZE8A 5AXIA 3TE6A 5J4VA 1FW4A 1RYFA 2BBOA 1TADA 2GJ9A 4MBEA 1Y63A 2ODEA 2QA5A 2DB3A 3OIVA 1UBFA 4R7ZA 3I5IC 2WVJA 3SYLA 5L3SB 2P0EA 2LM5A 2IYLD 3IIKA 2X19A 1RRFA 1OHHD 3WBJA 5AJZA 2EFGA 4RY2A 3U7EB 1NVUQ 4HRHA 3W34A 2ZREA 2QMOA 2FOLA 2WJIA 1PVOA 2M1UA 3KTAB 1CEEA 1F3OA 5IHPA 1GNRA 1BS1A 4OJKA 1L7ZA 1OSNA 5CSIA 1CLBA 2RCNA 2ZRNA 5LPNA 1XO5A 4YGAA 5ANRB 1CM4A 3FVQA 4YI9A 3PXGA 3RLFA 1DEKA 4MRRA 4D26A 2ZVQX 3I8XA 3ZVLA 1FFHA 2GXUA 2CHGA 3KTAA 4US0R 2GCOB 4XD7A 1G41A 1GILA 3DMDA 3FHOA 1QHHB 1BOCA 3EC1A 821PA 1H8EA 1A5TA 1ODFA 1SVMA 4II7A 4D6PA 2PX3A 3GP8A 3QKRA 4MYHA 4NE2A 2E6WA 3THYB 1IJFA 4DT1A 1WA5A 1MXLC 1RECA 1VRKA 5HLVA 2H8KA 4TMZA 3RRZA 4D4KA 5B30A 4PR0A 5JOLA 3ICBA 1WRBA 2C77A 4MRPA 3T1OA 1NN5A 3ZZ0A 1IQ5A 1JALA 1NVVQ 1TF2A 4F38A 2KI6C 3WBKA 4USLA 4C0SA 3KXKA 3AP3A 3C15C 1N6PA 3TUJC 4D0GA 1A2BA 3EC2A 3C8UA 4G5RA 4Q7MB 3CLVA 1MV5A 1BMFD 3C4JA 1BR4B 1MXEA 1XX6A 4DSOA 3MWLA 2CLDX 3ETLA 2IUUA 1RVDA 3QSYA 1CRQA 4RD3A 2IYTA 3K0FB 1YHNA 4NCIA 1GRRA 4BE7B 2KDHA 2EFEB 2KBMA 3GLHE 5EP2A 3KQLA 2ANCA 2JJ8A 1E9EA 2AXPA 1G33A 1VG0B 1Z0DA 4M0LA 2PT5A 4V0ME 1FW6A 1M46A 5DLQC 3WMEA 2JLWA 1GGWA 4JL5A 4PAMA 3PFVA 5DIFA 5C4MA 5FOSA 3KQUA 4OK5A 4QL3A 1AJ4A 2AKYA 1J8MF 1N6OA 2PJZA 1FI6A 4POAA 2GKSA 3LA6A 3TQFA 1X3SA 3TSZA 4B33A 5IF9A 5I2QA 1XFXO 1ELOA 1LS1A 1EWRA 2P67A 4M9XA 5DH9A 1MABA 3T34A 2VHTA 2H57A 4LC0A 1JQJC 2ZN9A 2ZRLA 4B32A 1FI5A 1Q12A 5K8UA 3BC1A 2GCNA 2IS4A 3OEED 1PULA 2XOKD 1KK3A 3IPYA 5FOUA 2R6GA 3S1AA 1KNQA 5F9HA 4P32A 4DEXA 1IONA 1EESA 2ZJ5A 4YXWA 1KCYA 2V3CC 1EL4A 4FCWA 5AJWA 3SG2A 2QZ4A 1DARA 1AZTA 2E9SA 2KE5A 1R4AA 4FMDB 4V0NA 2AXNA 3T15A 1MF8B 4PPGA 3A8TA 5L8VA 1UHNA 2YWHA 2JWWA 4XTCS 5FUWA 3R9WA 1QS7A 4KJZA 4RFVA 2CE7A 3WYFA 4URYR 2LKCA 2O8CA 5TNCA 1GAJA 1UDWA 2NTYC 1ANKA 4AG5A 3GLGB 1BR1B 2BBSA 1CULC 3B60A 2JATA 3LQQA 5CSNA 4UJ5A 1WCV1 2QT0A 4R71A 4A8JB 3K53A 3RSOA 1Z22A 2JEOA 2VO1A 2V7QA 3DOFA 3A6PC 3L82B 4PE1A 3OFND 4MN0A 1ZM4A 4V02A 2XB2A 2P2LA 1J55A 1E2NA 2NZ8A 1WLZA 1U9IC 4N0EA 2QY9A 1QX5B 3VR1A 1RRCA 5HZHA 3AKBA 3TS5C 2VLIA 2Q91A 1RKBA 4YMUA 2IYUA 1E8AA 1XVJA 1KO1A 2EWWA 1JPNA 3H84A 3HR8A 4S35A 4GMDA 1YRBA 1QHIA 4WA7A 1OMDA 2F33A 2H61C 3VHXA 4FXPA 4TYWA 3RRMA 1W2HA 1AVSA 2PCJA 2A30A 2UZIR 4EPWA 3PJRA 3JVUA 4PAQA 4WIAA 1G8IA 2OUKA 4ESVA 1W0JD 2BKEA 1Q3HA 2GHIA 3LQRA 1YVHA 1Y1UA 2HJVA 2GETA 2V1UA 4LPKA 3TAHA 1OFTA 1JXMA 1YZGA 3SC3A 1VG9B 5TMPA 1KO8A 2EGDA 4O2LA 1AHRA 4HAYA 4IKEA 1OKKA 2MA2A 3OE7A 2C78A 3B1ZA 3I5GC 2HYIC 1UEJA 3CRMA 2ODBA 4BLOA 1A4RA 1IBRA 4IOMA 3U6BA 4I4LA 4Q21A 4HAWA 3U5ZB 1SHKA 4V0KA 3PM8A 5FBWB 3QKUA 5FBLB 1J90A 1VIYA 3E5HA 2ZS9A 3LLEA 1ZINA 1P2TA 2FPLA 2OBLA 3KO0A 4DB4A 1E2MA 4Z8YA 2XOKA 3SG7A 1GFIA 2GZDA 3HP1A 2D74A 4M1SA 1RRPA 2YC4C 1TRFA 3CRRA 4ORAB 4MGKR 5DHAA 1CFCA
chains in the Genus database with same CATH superfamily
3DGEC 3M4JA 2XWQA 1UXKA 4GEKA 4KJXA 4RLSA 3ZU4A 4PE5B 1NZJA 2G28A 3I6IA 2RGBA 1T14A 2JB9A 3EASA 3P9KA 4OGKA 5DN6A 3WGYA 2C7OA 2HRRA 2PO5A 2HMYB 1STOA 5JMPA 1TZBA 3UXHA 3L46A 4W9MC 1LWNA 4BP9A 2IGTA 1DJXA 1JU3A 1OFGA 2HETA 2VHYA 4ZZ2A 3OHMA 2E55A 2HSWA 2Z3WA 2NXNA 1U8XX 3K9QO 4CM8B 3P52A 3CLTC 1E9SA 4IINA 4NARA 4NU0A 3F1LA 4X92A 2PUGA 2GZHA 4TWRA 5KKNB 3LM8A 3M6LA 4OJMX 3C3WA 2B0JA 5FPYA 1ZFNA 5A6SA 1WUYA 1O0SA 1KR2A 3BXEA 4NK5A 2OM6A 4GZMA 3RR2A 1FL9A 1XCPA 2OPHA 4DIUA 2O8DB 1PUIA 3H1AA 2C7BA 2QTHA 3NJ8A 3OLWA 4GMFA 3R9KA 4EJSB 5HQTA 1KGSA 1XK4A 1AM4D 1LW7A 2L82A 1Y3HA 2ZWMA 3IP3A 3KT0A 5ENVA 1E63A 4YP9A 5BUZA 2GM4A 5DKNA 5IBQA 2I78A 4DQUA 5KTKA 3GK4X 4NESA 1T8WA 2QX4A 1U3FA 4MKRA 1VMDA 2EC5A 2W58A 3A10A 4RNDB 4MVJP 9ATCA 1SNLA 1E7QA 1VYUA 4HXYA 3Q7PA 1F4OA 1I3LA 2XVZA 2ALJA 4X8MA 4E1BA 4WCFC 2YHUA 1WXHA 3S2GA 4I5JA 2ZT8A 3D1LA 4P33A 3RYHB 1O57A 3CSUA 4YPFA 5H02A 4WMLA 3UCEA 4M2OA 2NVUA 3UOWA 4AJHA 1PEAA 5LU9A 4GBMA 1DRUA 4D82A 1ZK4A 1CUCA 1DTEA 4RADA 3JWPA 4OQDA 2KBEA 3D0YA 1IVNA 3KTDA 3OZWA 1XRJA 1JEQA 4FFBB 4L5JA 2JLBA 3EY9A 4MDHA 5IUNC 5K8CA 3R77A 5IVKA 1NF2A 1K08A 4N03A 2HEIA 1JAHA 3BMCA 5F2KA 5HMMA 2ZZKA 4JAVC 1TT5B 3D31A 4WN9B 2B8TA 5M04A 1D3AA 2CT8A 1FP4A 1MGPA 1EHIA 1W44A 3BIWA 4JKTA 1IIRA 1V2HE 1C14A 2GN8A 1E0SA 3GJ6A 4ZO9A 3BK7A 3X2FA 5B6PA 3KELA 5BWMA 5KYVA 3O31A 5HUQA 1P2BA 4XVHA 3U3ZA 3LPLA 5TC4A 2G08A 4BFVA 2HNAA 4CCSA 1YC2A 4LCBA 1KI7A 2XCUA 4AVYA 4DRXB 3AEQA 3X1ZA 3THXB 1PVBA 1PNTA 2CHVA 2NACA 1S5GZ 2F00A 3RC7A 3RS5A 1P2DA 4Q4JA 4CUZA 3EQ2A 4PAGA 4EMSA 1N7GA 3VR4H 2PMKA 3IFSA 3JD0A 1Y5MA 3KALA 3GAFA 1QX3A 3PR2B 1T5LA 2IUEA 3KZVA 1ES9A 2D1YA 2WYUA 4M46A 4TLLB 5A4FS 4NF2A 1A9XA 1F9AA 2Y1NA 1K8RA 1I1HA 1XRNA 1S2MA 2C2HA 2ERYA 3C45A 3I2IA 3M2TA 3O9MA 3V6LA 1DGVA 4ARAA 4DCTA 2A6PA 3V4FA 4DIKA 3AVTA 3KB2A 2R8ZA 4UVHA 2IHKA 1CQJA 5CIQA 5F1OA 3IO5A 1XMIA 1JLKA 1KI3A 2MSCB 1OZSA 2X3YA 3PLRA 1CY4A 4RLQA 3WVNA 1ZXXA 4YTEA 2HMSA 1MRZA 2PD3A 2UVPA 3H7IA 4I6EA 5C5IA 1KOGA 1Q0ZA 1R50A 1VCNA 2EV9A 4WHMA 5KOYA 5K3DA 1AMNA 3TF5A 1ZGJA 2Y3IA 2A9OA 1WUJS 3EAGA 4LBYA 1LK7A 3KTOA 3RUIA 3LQ2A 3Q9NA 1HZZA 4DIBA 2G1AA 1SL8A 3P5SA 5FOXA 3F6CA 3U3RA 4K0KB 4A2CA 2ZI6A 2B36A 3NTOA 4Q0MA 2H5JA 1G6HA 1UAGA 2W2KB 4P5OE 4P4LA 4RJJA 1OTXA 4RA6A 4AJIA 4D0LB 3KKEA 3A9UA 1HT0A 2K2WA 3GZTB 2M2IA 2OORA 1KK0A 1MA3A 2A84A 3DEZA 1OXXK 3DBRB 3HHEA 1E1LA 2AN1A 3SDBA 1HFEL 1ULSA 3ZHBA 2V0GA 3QU4A 1D04A 1WKCA 1CUDA 2F17A 2HCRA 3WGTA 5HZGA 2PVBA 3N7AA 3R0JA 4RA6B 1NVVR 4IDQA 2JA2A 4MTCA 3REGA 4S3MA 2FNAA 2NVBA 5FI1B 4TNCA 1SCNE 2VPZA 1YRTB 1ZOOA 5DHTA 4Z8XA 2X8LA 5REQA 1N78A 2ZROA 3IHWA 2V8OA 4A9AA 2O3JA 3GFOA 4C6SA 4D02A 4XUCA 2JA1A 2WIJA 1DO8A 1V9LA 1XEXA 1U81A 3VMFA 4XH9B 3P9CA 1HGXA 1KSGA 5CPFA 2GN4A 3F4BA 4ASUA 3FDJA 5LP1A 4WCVA 1N8TA 1ZH0A 2FR0A 2BN4A 4P31A 3W7BA 4LVOA 3HGTA 1KBOA 3L2OB 4E2YA 3CF0A 3W7VA 1N0IA 3RC3A 3QLVA 3D75A 1I5OA 3ICVA 4I9NA 1ECGA 2IHNA 2ZJOA 5I7UA 3TPFA 4A6EA 2FGJA 3K0SA 1YA6A 4LZOA 2FCAA 3L4BA 3TKAA 1SIUA 3WLPA 1NSFA 4OHWA 5IAGA 3RKSA 4NBVA 4UU8A 3QE3A 4FHZA 2IC5A 3UW1A 1PVDA 3EPLA 1H8ED 4CDNA 1IY0A 4IUBS 5IEJA 2GRAA 3D3WB 2JIBA 3DOEA 5JJCA 1UK9A 4F3TA 4F4UA 3EGXB 2HK7A 5GWXA 5BURA 4IIFA 1LLDA 1CUIA 4MARA 1EFHA 1CUHA 1SBYA 2BAGA 1PZMA 3AEQB 2QLFA 5DISB 1IBSA 4AC9A 1BG1A 1HT9A 3LPAA 4MPDA 1ZXLA 5AI6A 4MVJD 2XNHA 4RVUA 3ILYA 5C3MA 3RFXA 1I30A 2OCXA 2YNMC 4IPTA 4RKFA 1OUMA 3A9CA 2E4UA 3HNPA 5AKHA 2KWIA 3R8XA 1E20A 4II2A 1OE0A 4RGYA 1NXXA 2DLNA 1N7HA 3SBEA 4HH4A 1VJGA 4ERNA 4ZICA 1C9EA 2QNRA 3DD5A 1DPFA 3WL8A 4NH0A 2PLRA 5D5QA 4D3SA 4C0HA 4AYXA 1KERA 2JGFA 5AW6A 4C0WA 1WXDA 3K20A 1M6EX 3I42A 5TE9A 3SG4A 2D7JA 5AKLA 1CP2A 1ZXBA 2P2ZA 1E3DA 3DJFA 5E2BA 3QKWA 5I7SA 1BVUA 3SY8A 4A73A 1Z18A 1SBNE 5BNIA 4UBJA 2XT6A 4XQGA 3SHWA 3G8BA 2HNKA 4JR0A 3MC1A 4ZO7A 4EUSA 3N2GB 2YXLA 1L4HA 1ZD5A 2BZGA 3IXLA 2XQGA 3O2SB 3W78A 4ZN6A 5AVJA 2OTCA 3OQVA 3AR3A 1L7MA 3A9VA 1YQXA 2WF6A 2ZYGA 4J90A 4CM1A 4ZYTA 2GAJA 3W6OA 1KWKA 2B9VA 3ZJTA 5DN6D 2QEOA 5KHLB 1O87A 3U44B 1U4NA 2PH5A 3MCAA 5CNKA 2A1IA 4YAIA 1DUSA 2P2YA 1V1GA 1XD9A 4ZCIA 1U2DC 3C5CA 2OKCA 1N0WA 2OQIA 4QBFA 2W6QA 1E2HA 3D4PA 4MO2A 4BNWA 3JQDA 1MEEA 4GIBA 2VYFA 4Q93A 4UDYX 5CT5A 4L4SA 3U4IA 4YRTA 3BCSA 3G49A 3I30X 3PQ5A 1X0VA 4QJ5A 4RV9A 5B3JC 3V7WA 1M6HA 4KBGA 5BXQC 2PLNA 2Y1OA 4EEXA 4YYEA 1OXTA 1C7EA 1CDDA 2YN0A 4QDJA 4QFCA 2XTZA 4L9WA 5CW2A 3UV7A 1L7VC 2HI0A 5AVVA 3EZNA 4M1ZA 3MFQA 4MVCA 5THKA 4Y0AA 1M74A 2P8SA 4KN9S 4GDFA 3RNOA 1M0WA 2IYFA 3BGSA 1ZSYA 3L7BA 5T3YA 4YO8A 3TGPA 1GGNA 5TJ9A 1SZPA 5JC1A 4ON9A 1ZK3A 3TQCA 3Q6IA 4F92B 2WU0A 4G01B 1E5DA 4CKWA 2FXVA 5EZ5A 1QHXA 5AVRA 3W6NA 1KK8C 4QD3A 1BWRA 2H4HA 3EK2A 3FNRA 1OU0A 2CUNA 2OCPA 1NHGA 4IJVA 2NUAB 1VKHA 2IDMA 2HF7A 2QNIA 1IQPA 1BXGA 1DQZA 1RBZA 1UZUA 2VYNA 3KJHA 4IXMA 3TXYA 1HE1C 2J0VA 3ZG6A 5HOQA 1K7YA 2JAXA 3ER8A 4ERXA 4R2IA 5K0JA 1OFUA 1LNSA 3HU1A 4NV0A 3ZHUA 3OG9A 4UD6A 4DIFA 4DLXA 4ZI3A 4C3UA 1MNAA 2CXRA 3C1UA 4Q03A 4N82A 5BT8A 1YMUA 1OVGA 2IIQA 2PH3A 1IQ3A 4IJUA 3TRJA 3PWKA 2XB8A 3IL2A 2JBHA 1E4EA 3RRNA 3V9AA 1T9BA 1VBMA 2W2OA 3NV9A 1RRMA 4MRXA 4QHYA 4AF8A 3VAYA 1WHTA 4BV2A 3AUYA 4FXOA 2FWAA 2OAQ1 3LXUX 3QXHA 4TTQA 5DIZA 5FIUA 3OSZA 3SOPA 3KWMA 3PE4A 4X7RA 4ZQCB 1ODCA 2CXOA 2PFGA 3GLTA 3W4IA 2F55A 3ESQA 4X6XA 1OD6A 3PGXA 3UCFA 2PWYA 4O2BA 4QDUA 4NNOA 1U3TA 1NX0A 1ARZA 1HDZA 3CWGA 2YKGA 3CU5A 5EG5A 3SJCA 4XLZA 1U94A 2P91A 3GFBA 3QQ5A 4H6VA 4J6EA 2HXSA 4JLVA 5KAMA 4D44A 4NAHA 2Q1SA 4MJ3A 4S1PA 2JC3A 2PJDA 3VRRA 3OQNA 1Z2NX 1P5JA 2J6CA 2X5OA 3KDSE 3N5KA 2QT9A 4FW9A 4E2ZA 4GKVA 5AW0A 2I1QA 1H6DA 2GHRA 1Y89A 4Q66C 2PR7A 1XTKA 1ZMOA 2IY8A 2YZNA 4Q01A 2IVZA 1Q1ZA 4R5MA 5JBIA 2CBGA 4C0XA 1LFAA 2I8AA 4I9HA 4R8VA 3CW8X 5D1NA 5D87A 1DC8A 4OA5A 5L53A 3OM1A 1LX6A 2FEMA 2Q2NA 3BDIA 1ADJA 5M7EA 3MHTA 5H3LA 3DDNA 4KMSA 2WWVD 1C9DB 2FA9A 3DOIA 3EPPA 4L50A 1QBKC 1P81A 3DF9A 1CR0A 3FX2A 3R6LA 3HS3A 1HMYA 3U61B 3ZDCA 3JV7A 5C8YA 1N3BA 3G85A 3VH3A 3DZHA 4BS9A 2DWOA 4RL6A 3UJ7A 1GRVA 3NOOA 3FY4A 3UUGA 3VH4A 1M34E 1Q1BA 2V6GA 1QTXA 2NQTA 4LC9A 2M3WA 1KFUS 2FPXA 3QX8A 4PX9A 4EYGA 1S96A 3HPRA 4P4SA 5FV7A 5FI3A 5LZ7A 3EEFA 4BUCA 4N47A 5H9WA 3QX3A 3OZAA 3GLFE 2QUJA 1P1RA 1Z0JA 5BYBA 2PX0A 5AUPB 1W2WB 4YI8A 5JNUA 3K71B 3M1LA 1GRNA 3L0YA 5DTQA 4AZ3B 4QJBA 1K9UA 2QD3A 3RUDA 7REQA 1BU3A 2NO1A 1XZDA 2VKTA 2CSXA 2C1ZA 1NXQA 3LT1A 2CWDA 3C7TA 2QQGA 3F6BX 4CMJA 4RQBA 4ZYUA 2EF1A 1LDBA 4NJEB 3A2LA 3DQPA 4YRKA 2H63A 4KYTA 5FQNA 3FRJA 4FQ8A 4MVJI 4HRXA 3RZSA 2WIFA 3QE4A 4Q18A 1N5LA 1W8DA 3PQDA 4C5CA 5IANA 4X62B 2IA5A 2ZBQA 4LQLA 3QEBZ 3CLHA 3LF1A 4R69A 2FPWA 5K45A 4RV5A 5DGTA 3I5XA 6NULA 1E7YA 1CEYA 1BROA 3IQEA 1KWOC 1NFRA 1FEZA 3N2IA 4L8YA 3GRPA 1SVNA 3ZWWA 2Z2YA 1NN0A 4IO0A 3UAVA 1B7GO 4QGHA 2A5DA 2FCEA 1A9PA 3ZDEA 4ZVNA 1QFMA 5EJ5A 2OFOA 3DNFA 1ID1A 3NWJA 3OTIA 3AEKB 4Z5XA 5EXPA 3VNVA 1X7WB 3H2SA 1SU8A 4Q1AA 3ZC3A 3OZ7A 3L18A 2VDJA 4A6DA 4DADA 3NTLA 1W4LA 3FR8A 4GRAA 2PBZA 4AQDA 4DGQA 1TW3A 2MYTA 2RG1A 5MF6A 1TCUA 2IBMA 4KR7A 4L16A 2AR7A 2ORVA 1LPOA 3NM6B 3P0JA 4FPXA 3V8BA 1X02A 1ZVVA 1A9TA 2YWCA 1NF3A 1YT5A 2ROQA 3SFZA 2IQ5A 6YASA 1GKYA 2J3JA 2FQXA 1Z9BA 2OR3A 3I6ZA 3K31A 3P9IA 4W99A 4JI7B 1W85B 2FFBA 2R4TA 1LPBB 3K9GA 1L5WA 1LF5A 3BH7A 5FBKA 4BVBA 1FJ2A 1KARA 4DYDA 1TJ4A 3AFNA 1NYTA 1YFKA 4MV0A 1PL6A 1N1GA 4WINA 2WFMA 3MT7A 1H9CA 1NVBA 4DM3A 4XSGA 4YP0A 5KJ6A 2IYXA 2AJ8A 1X9IA 2JNXA 4OI2A 3PJGA 5FPKA 4LBZA 2VEOA 2E6UX 3KXDA 4WXHA 1PQWA 3R24A 2ISCA 4ZODA 3OC6A 1DKNA 4MZDA 2CYAA 3MRSA 1FFWA 1T43A 2RGEA 1IHOA 4XSVA 4NE7A 5LIRA 2BR3A 1AGRA 4G5GA 1QYDA 4PSCA 2D6FA 3I62A 1JG6A 2BR4A 1SU7A 3E84A 4TSFA 3S2UA 5CVVA 2OSVA 2NUPB 3CWQA 4NZNA 3EX7C 2Q9AA 1ZUD1 2IEZA 2DUNA 4Q9AA 4ATNA 1MKYA 2GEKA 2RBEA 1GSAA 2QMEA 4I1VA 4F06A 2QPTA 4J76A 5BMOA 4RTKA 2JIZA 1XFYO 3NH6A 4UC0A 2AW5A 1OLUA 1R6AA 1ZWKA 2P65A 1HE8B 1M2JA 3I9MA 1P91A 4LDJA 2FUNB 2X42A 3JPWA 3RRBA 2VBIA 4B8ZA 1OYWA 1DCFA 3LLSA 1DWUA 5DCWA 1ZUIA 1YD7A 4YN3A 2NV2B 3P27A 1UMCB 1A96A 2CVZA 2OHGA 4IILA 3T7IA 5ITZA 5LMNB 4HWTA 4YCDA 3SZLA 1Y6RA 2GPJA 5TQVA 2YZ7A 3A2NA 5FI6A 1NWCA 1ODBA 5BP7A 3ZVMA 3AJ8A 3JR3A 3PDIA 3O75A 5J4KA 3LSYA 3E1KA 4YT2A 1RXVA 2WQ7A 5D5HA 1U1EA 4GF5A 1N6LA 4DY4A 1M10A 1VOTA 3D5TA 3F6EX 4KAJA 4UEQA 1H0SA 4UXJA 4ZO4A 3OFJA 1L8AA 2IHJA 4G5YA 2VJKA 5CDFA 4HGRA 1OOEA 1NUAA 4PHKA 3L04A 1RXUA 1DRVA 3EZ7A 5SY6A 3S81A 4YLEA 3V97A 2OGZA 4RZ3A 2XYRA 4R3NA 2XUAA 4POOA 5BR7A 4QJ5B 1NDHA 1QFZA 1Z33A 1XDWA 2FX3A 4MZJA 2PZGA 2TS1A 3P2IA 4JK3A 4N9QA 5B7PA 2HXYA 3OA0A 1LBSA 3OOYA 4IJWA 2DWPA 4HREE 3EUEA 2E82A 3GJZA 3M3PA 4KZPA 4RZXA 3WWOA 5ICFA 4DCKA 2Z08A 4WK2B 4ZAGA 1VYVA 1TT7A 3W7AA 4UNRA 2HT1A 3C6ZA 2HMWA 2QX6A 4Q4AA 3QOWA 1ORVA 3HCRA 4R98A 2HA5A 3EQ8A 1USGA 1LLQA 1EE2A 3GJSA 4L08A 2WB4A 2X9QA 4KQ9A 3NPAA 1YS1X 4O4JF 4S2UA 3OZXA 3V4OA 3TL2A 1V6CA 2OO7A 2JLXA 4FFVA 1RPTA 4QAJA 3T7CA 3WLJA 2QT1A 5CCEA 1K4YA 1LBTA 2JZIA 4PNEA 2XUZA 2BPOA 3FWHA 3OX1A 3QUTA 1EVIA 4EI7A 1T91A 5HGXA 4UVEA 1BH6A 1NN3A 2NYAA 1PIWA 3OT1B 4CE6A 5LYJB 4CEIA 4F46A 1RAFA 3DDZX 3S29A 1PVVA 3CURA 3G5LA 3JVTB 5IH3A 3CO0S 1VZ2A 3QPWA 2AL7A 4RPHA 3H5RA 5K2MA 3ZE2B 3OP4A 2JHGA 4IDHA 2HSGA 4KXUA 1QQ5A 3GEIA 1UFRA 4N7JA 4BLVA 1E2DA 3I52A 2XJ4A 3VPAA 2W2NA 2QXUA 5LQDA 2UYOA 1JSCA 3F6YA 3QTBA 1DJPA 3IHLA 3MK31 4H17A 3WGQA 1VECA 2K5UA 2PX4A 4WRRA 1GDDA 2H1LA 4E11A 3MT8A 2WKSA 3VRNA 1NDQA 3QP9A 4FX2A 4H35A 4HD8A 4IOKA 2OPOA 4LYYA 4CCWA 1ZCAA 1BVRA 3ZCUA 2PYQA 2CXPA 1XVLA 3IP9A 3UHPA 1PFVA 1I10A 3BWEA 3IPXA 4S0XA 4X94A 4Y2JA 4MVYA 4GOOD 3FUUA 3D6UA 3HG7A 3ETGA 1L7QA 2KJQA 3LH5A 1QXSA 3TBKA 3TXAA 4HWKA 4CFZA 5A0FA 5LP6B 2P68A 3ZKAA 2QENA 4IV0A 1SG9A 2P6NA 5CRIA 2HQSA 4JVOA 2YXPX 1XZNA 1SOVA 3A4UB 2DKNA 3AUTA 5ALWA 3ZDYB 1YZVA 4KO3S 1MAWA 3K9HA 2FFHA 3KXIA 1DAKA 4Q3DA 1E0AA 1JIJA 3R76A 2DXIA 3K30A 2RI1A 1Y80A 3QIVA 2MRDA 2ZRMA 1IRIA 3DC7A 1DDIA 3EOZA 1WY5A 2AQHA 3LHFA 2OECA 4NX2A 5AQ1A 2M29A 2HSJA 2IFTA 3E23A 4LTDA 2HLPA 1HORA 4NEQA 4FWIB 4RGBA 1R37A 3MGGA 1HQVA 1GARA 1JDZA 1F9EA 1OZGA 4GLJA 4GYKA 2HT6A 3SJSA 1RADA 5BSWA 4YCBA 3RYFB 3QVMA 3VYSB 4E46A 1Z4JA 1VHJA 3LOPA 2XI4A 2BDTA 2Y9MB 3K0FA 3WLTA 4G1VA 3H42B 2VSFA 4LYDA 1RM4A 2VJDA 3T3HA 2Q1XA 1AQLA 2XF2A 4OQMA 4DWVA 4EQ6B 3RIMA 1GG8A 3PQ8A 3KG2A 1JA1A 1RJ9B 1TQ4A 2MOKA 1YJQA 5G0SA 1QIFA 3T6KA 1Y37A 2ZE6A 1ZGHA 2R8XA 3QOXA 1RCTE 4IVQA 4A92A 1I6MA 5FYXA 3N3BC 1VMAA 1PQPA 5DSXA 4EYKA 5HZMA 4YRCA 2O0HA 3T4PA 4OX9Y 1GKUB 2CHQA 4TMKA 2NNWB 3IUPA 4EG1A 3K72B 1G60A 1PR6A 1CERA 1IEVA 1GSOA 5EN4A 4EITA 1WF3A 2CXTA 2DBYA 2ORWA 4UATA 3D7RA 3I58A 4RIFA 3CUVA 3D4IA 1H65A 3EEQA 3G9XA 1QHYA 4I3FA 4RS3A 4QYIA 3SBDA 2G8NA 1FX0B 2GCPA 2XDQA 3KYJB 2Y8EA 3OKCA 3PX2A 4M1EA 1RAHA 1UHJA 3HXTA 4ML3A 4EI9A 2H0RA 3L6CA 5HTKA 3ZY5A 3R0IA 4JFRA 3PVZA 4ZU3A 3PD0A 4BX2A 1QHGA 2C5HA 1K88A 3N8DA 4D43A 3CEMA 4F4FA 1E3LA 2WIBA 4C01A 2F2PA 1L7AA 4MMZB 2DYKA 3I8SA 4PINA 3RVKA 1ZQ1A 3VSBA 4D3DA 4L75A 3AERA 1S1EA 1NV8A 1O94A 3U7RA 1ZIOA 2AQ8A 3EFOA 4HOYA 4Y2VA 5TS3A 5DXJA 1HG1A 2X6TA 5E7MA 3UAZA 1XMXA 2XPCA 3WP0A 4A0GA 4KR6A 1H2WA 1AS0A 4ZCLA 5IEBA 2ZBEA 3QE0A 4MGIR 3GGOA 2KLDA 3F98A 3TTSA 4F7DA 3JQAA 4LCJA 1T1IA 3ZHZA 5ECWA 4CIYA 3RHZA 4DR5B 4KKVA 3O2PA 5DTEA 2OE2A 3DF7A 3F4KA 1NRIA 3TZ1A 2TMGA 4RBNA 4BECA 5JBQA 5CT4A 4RX1A 4AF6A 1SCMB 3DW3X 4R8MA 5CUQA 3DLBA 1K6XA 2FLVA 2HFJA 4CHTA 4E13A 1YCFA 4YDQA 3FIAA 1EDOA 3FMPB 3SX2A 1Y48E 5D86A 1UDCA 3G0HA 2H2GA 1CNMA 3RVQA 5JSZA 3BHNA 2EF0A 4NMLA 1DJWA 1FRNA 3WK7A 2PQ6A 1U0LA 3JVIA 4TKZA 1M2OB 1BODA 1CLEA 5FKJA 2I2DA 3MQFA 1BSVA 4GECA 3AF1A 1NDUA 2B8NA 5IKEA 4K40A 1MUXA 4HQ0A 3FNEA 3MWKA 4J49A 2QSJA 1MB2A 2ZRPA 4J1SA 4QPNA 3TTVA 2HV8A 4YPOA 3H0KA 5AEQA 2FWIA 3AU9A 2WCBA 1HWYA 1NBIA 1ORRA 4JQSA 1NR7A 2ZJ8A 3D6NB 3LO5A 3LVQE 4FR2A 2WJ6A 5F5LA 1JA0A 4ETOA 3RTGA 3GL9A 3UHAA 5AW5A 3CEAA 1EUZA 2BCXA 4L6CA 2O7RA 4RPIA 2ETXA 4XFDA 3C1TA 2GN9A 4M2PA 4EL5A 1I51A 2CUZA 3N2GA 4ENRA 2X0NA 2W6JA 3ZWHA 3KQYA 4W5HA 1M1ZA 3VTZA 3ZWVA 1I2BA 5C1BA 4US1R 2AHRA 4O3FA 4QPZA 1NBMA 3NHWA 3LYHA 1RJ9A 5BW6B 3RC1A 3REQB 2CB0A 2Q5LA 4QWMA 3ZD8A 2J67A 3GX1A 1L5OA 1NLYA 4OUKX 5L3ZA 2FPKA 1YX7A 3ABZA 3FZGA 4D9MA 1A4UA 4Q4HA 3HE3A 5EZQA 4OQYA 1QGUA 1IXRC 1A95A 1ZP6A 2Q6TA 2XCTB 1QHFA 2DSNA 5I7FA 2H1FA 1TOPA 3DBIA 2PX2A 3B20A 1BJKA 1J0BA 5TQJA 2I7CA 2AFHE 2WD8A 1PWEA 1V8ZA 4TTPA 1QKKA 1X13A 1ODTC 1E77A 1TUBA 2GLTA 1SY7A 2P27A 3GI1A 3I72A 4LJAA 4XDYA 1ODKA 4ZANA 1W0CA 1IZ7A 2WA1A 1KORA 3MCTA 4KFRA 3SXUA 4CNQA 3TS5B