4C0LA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one magnesium ion and mg:gdp (mggdp-miros)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 120
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0lA03
1SPYA 1A75B 1KSFX 2CLCX 3MG9A 4HB0A 2I18A 4OQLA 3DVJA 1NMXA 5LB4A 4FI3C 1EX6A 1E9FA 1N6NA 3A1SA 3T1OA 1N6IA 1SL9A 1JPNA 1O3YA 3U3RA 1FFHA 1Z2CA 4TZ0A 2MSCB 3CKLA 3DHWC 4RZUA 2ZAOA 2BVNA 4EPVA 3I1FA 2R2IA 2WTUA 4QFMA 3NKVA 2CNPA 2Y4QA 4IOLA 4LUCA 4AKHA 1A75A 3H84A 4MUAA 1RC8A 4IDQA 4Z8YA 1MH1A 1U8YA 3L0OA 3KKPA 3OHMA 2ORVA 4IOJA 2JLRA 4YMSA 4O2LA 2PX3A 2G6BA 5I2LA 2FU5C 4RD4A 1NF3A 3IF7A 4JLBA 5K8LA 1E9AA 1NY5A 2F9MA 3AVQA 3GJ5A 2WJIA 1CLBA 3BH0A 4J0QA 1KI6A 5FI0B 3W8NA 1MABB 3GCGA 4DDUA 2ZI7A 1JR3E 2BV3A 2JLQA 2AD1A 3WNBA 1M63B 2AUCA 3FPAA 1NNEA 2RMKA 1YUSA 2FWRA 4I1SA 5TDHA 1VG0B 4M9QA 4UKDA 1JR3A 2HQ8A 2ZS9A 4AQJA 3C15C 1YX7A 2RGGA 3TR0A 3P26A 4A36A 3KXKA 4FCTA 2W2TA 4Y0VA 4ZV4A 3IIJA 4M1SA 2QGZA 4ON9A 1CR1A 3TUYC 4HB2A 2OTGB 2F33A 2WJGA 2XJ9A 3NXSA 2YWFA 4OQNA 5B57C 1J99A 3QG1A 1OH5A 1DAKA 4D0NA 4G5GA 1A1VA 1Z6TA 1A4PA 1SW8A 2FG5A 3GJ4A 1XFYO 1LNZA 3N2EA 4YDHB 4C0HA 4PDZA 3AUXA 3C16C 4K46A 4TYQA 3RS2A 4YRUA 3GLIA 2XOKA 4OI2A 4UNSA 2LANA 2XGJA 1IQ3A 1NN0A 1T4GA 2HPSA 3WHKA 4OI0A 1MV5A 5IDVA 3LBIA 3N2IA 5HYDA 1IHUA 1P73A 3QE0A 5E4FA 1ZUHA 3B13B 1W2HA 1OE9B 1V5WA 2OLKA 2FH5B 2GEUA 4JVMA 3GLFE 4Q03A 2JLZA 3AVWA 1F2TA 2CJWB 3ASYA 1L2OB 2QEQA 3JZMA 4KFUA 4LYJA 3MMPA 5HLVA 1GSIA 1P3JA 2PALA 3EVUA 4QGFA 3V9PA 1DVRA 4Q7LA 3CR8A 1CM1A 1RJ9B 1G7CA 1RFJA 5IK2D 2MLEC 3BFXA 1E2GA 1EFTA 1EK0A 2V7QD 3K70D 1UAAA 1CU1A 2GILA 3ZLJA 2GCPA 3QENA 5JECA 2V7QA 2AN9A 1XXHA 2AK2A 2B8WA 4S35A 1RRGA 3U3MA 1DTLA 3I61A 1XF9A 3CB4A 2OM2A 5AWFC 1N5KA 4BRWA 2BM1A 3LVRE 3U61B 2PMYA 4BZQA 3EK7A 3BFKA 2G0TA 3WY9A 5L3QB 1S5GZ 1N5JA 4R2IA 1J90A 4YQFA 2D7DA 2NO0A 2A5YB 2WPDA 3VRQA 3FVQA 3V4RA 2NPFA 3B8HA 3H4MA 2KOTA 3P27A 2JATA 3D0YA 5TNCA 1TQ4A 1AZSC 1DADA 3QJYA 3OEHD 4OK6A 2CTNA 2I1QA 2DB3A 1FUKA 3O6BA 1F8HA 2CVHA 5GVRA 1CDPA 1R0ZA 1U99A 1XD8A 4AD8A 3I8SA 1WRZA 3FDIA 2M9GA 5EXXA 5C1BA 4HAVA 5AK0A 2O8FA 5EJEA 3EIHA 2GESA 3KJEA 1E1RD 3AKEA 3FWYA 2CCMA 1K5DA 4M1MA 1IN6A 4Q9JA 1VDZA 2NGRA 4KITB 4LHZA 4MYCA 3K0SA 2GXAA 3PVSA 4DXAA 3GLHA 2RGAA 4PQRA 1G7RA 3AAKA 4NH0A 4RVCA 4PSAA 1ODFA 2P6BB 721PA 1N0YA 2BMJA 3C8UA 2QP4A 1FW4A 1QG2A 2N42A 3BAFA 4LDJA 5CYPA 2ZRMA 1M1YE 2JA1A 1L2OC 5K89A 2J0UA 4AKEA 4IL1A 1E6CA 1X8KA 2F1HA 3M4YA 2BKIB 1BIFA 1FTSA 3RDPA 3RANA 5JCZA 1KI4A 3BJIC 4NDDA 2JJ2D 4DSUA 2BC9A 2QMEA 1VCOA 4U7DA 1FW6A 2HDNB 4YXWD 4MZJA 3PUYA 1GNRA 4DCVA 2KE5A 4OJQA 1N2DA 2C8VA 1WY9A 2QTVB 4URWR 1XRJA 2KFHA 2ZVPX 3SE0A 3A4NA 2C9YA 2F43B 1CXZA 1L8QA 4EFLA 5L3SB 3I3SR 1DEKA 2IYZA 4WW0A 1KFUS 2R6CA 1M45A 2WWFA 1IJ5A 2OE2A 2CCGA 2V1UA 4QL3A 3T5GA 2ZU0C 4V0ME 2OT3B 2OXCA 2JC2A 4C0AC 3K0EA 2JNFA 4HZUB 1PZNA 4TYPA 1C9KA 1F5NA 2MA2A 3OB2B 1MXLC 4BEJA 3U6BA 2FV8A 1PLKA 3VMFA 4MVFA 1KDRA 1ZD1A 2AKYA 3BOWB 1KJYA 3TDZA 4RZ2A 3PALA 1CLLA 1XEWY 2BKUA 2VSXA 2IYTA 2WVJA 2YWGA 3B1YA 4HEJA 4N0EA 3ZZ0A 4LWZA 2E87A 4QJ5A 1YRBA 2CE2X 1CDNA 1E0JA 3QRXA 1ZCAA 5IF9A 1OH8A 3GPLA 1EWQA 4B3BA 3DM5A 4WXPA 1KO7A 3B78A 1OB5A 4LJYA 2ZM5A 1IG5A 1WA5A 1NCZA 4DIDA 1OH6A 5DI9A 1M39A 2CCKA 2P67A 3HU1A 2H2KA 1JI0A 2D74A 3FMPB 3GFPA 3LAWA 1OB2A 8OHMA 2XXAB 4GUKA 3K70B 4URYR 2NZJA 1RROA 3SYKA 1VHTA 2ZAMA 2UZ3A 2JQ6A 3I73A 3L8ZA 3RHFA 1Z63A 1ZNWA 2WPDD 2XB4A 2R9VA 1JB1A 4KO8A 1NKSA 3CW2A 1SXJE 1N2CE 5HPYB 3IGFA 3UG6A 3ND8A 1UBFA 2Y1MA 4O2RA 4WVFA 4UXIA 2LNKA 4KU4A 2KAVA 1QX5B 1CB1A 3TSOA 5EXPA 2NCPA 4ZCIA 2BBMA 5KDOA 2F3ZA 1OXXK 1XPUA 1II8A 1AS3A 1OFIA 3EASA 1BT6A 3MRSA 3K1JA 1QVRA 2REXB 2JLYA 1W7IB 1PV4A 2VHCA 4TL8A 3SHWA 3SFVA 1WRLA 2OILA 3PUVA 1R5OA 2R62A 5BN4A 5TV2A 3NH9A 4EPWA 2F8PA 4XYNA 1JECA 1ESMA 1Q0UA 5HKKA 2R6DA 3NSOA 5FTMA 521PA 3GMTA 4M2PA 1EFCA 1J7RA 2OV2A 1QATA 1P75A 1DJXA 2D7CA 2J9RA 1SCMC 4WZBE 2EWWA 2QNRA 3E3RA 5DI3B 1SL7A 1DAEA 1G3UA 1R7RA 2XTMA 1FBVA 1G5RA 2QSZA 3W34A 3CX6A 3OAAD 5L3QA 4Q7KA 1XK4A 4EQ6A 1DJZA 5CSIA 2M8UA 1G3IA 3D3QA 4CDGA 1S9HA 1SHZA 3CR2A 2EU8A 1NMYA 2CLSA 1ZNYA 3LW8A 1B7TZ 4I81A 4G5SA 2KNEA 1W5TA 1WB9A 2IYWA 1M2OB 1UEIA 2C9CA 4BGDA 2NCOA 3CNLA 3PATA 4CEJA 3M0WA 2BBWA 2G1KA 2PEZA 4JL5A 2CT9A 4UQOA 2M49B 2GVDC 3KQKA 5JHGB 3D31A 1KO4A 1NX1A 2KBEA 2KHNA 3RWMB 1Z0JA 3KUCA 4NMMA 4Q21A 1XPRA 1Q1ZA 3SBDA 1IN5A 1SKYE 4BFUA 5LDDC 5F3WB 4DCKA 1ZVQA 3GQBA 2A5FA 2ZU6A 2ZEJA 1MR3F 3VX4A 3MWLA 2B92A 2PT5A 3SG6A 5BQ5A 3GLHB 4DC9A 4M1YA 4FD2A 1TAGA 3QF7A 1NBME 3WHUB 5KO2A 4GNKA 2VP4A 1KJWA 2O0HA 2OBLA 2VSOA 4LJAA 2J7PD 1JQJC 2WNDA 1OFUX 3BK7A 1BMFA 3CF2A 3ZIAD 2QROA 1ZD8A 1E1RA 1ZRHA 5DHFA 1U5IA 5CB8A 2M97A 4PPQA 2J7KA 2GTPA 3N70A 1LA3A 1CJMA 1RRPA 4OQMA 3ZVMA 2DY1A 2KQ6A 4Z54A 1WQ1R 3U7EB 4D1EA 1XVJA 1HE8B 4NZYA 4QRHA 4LHYA 3BGWA 4QNMA 4POAA 2DFNA 4KAXA 2Z4RA 4EPRA 4JQ0D 2OHFA 4Q4LA 3A4MA 2JU0A 3RAPR 3KB1A 3SJSA 1Z47A 1XTJA 2ATVA 2YINC 2AL7A 3J81k 2FSGA 3LNCA 3PM8A 2BCAA 5JLJA 5K8UA 4TMWA 1RJVA 2XNDA 3RC3A 2ERXA 3HDTA 5DHAA 5JI2E 3A37A 2FCEA 2LV7A 3O8DA 2HLDA 4NDBA 1QHXA 3KX2A 5KU1A 2GZAA 3RSOA 1SKQA 4G01B 3BOWA 4LPKA 1G8YA 2KBIA 1K8RA 2VHJA 3ZWHA 2ZJYA 2ZI3A 1L7ZA 4JLKA 4B3CA 5JZVA 1QX2A 3F0TA 2G88A 4B35A 4NL4H 4A8JA 1JWDA 2W2VA 1NX3A 1JBKA 3QKRB 1BR1B 4FWIB 2J0VA 3E5HA 4YLGA 4HAXA 4ASUD 1GAJA 3UKDA 1K95A 1W4BA 1SVOA 2R65A 2GHIA 3EVVA 2YV5A 4IEIA 1W49A 2YJTD 4RFVA 4AYWA 4DS7A 2QZ4A 1QV0A 3AP1A 3B6EA 1D9XA 4HREE 1HE1C 1KCYA 3CPJB 4Q7JB 1ZU4A 2VRGA 5CB6A 2NG1A 1N5IA 3T35A 1J7PA 1JJVA 4GP6A 4HAYA 4IDOA 1HQYE 4FCWA 1IN8A 2NOAA 2QT0A 1FPMA 3BWDD 3M1IA 2KI4B 1FZQA 1X1SA 4KXFB 2QBYB 4ZKEA 2MMCA 2X19A 1PVAA 2B21A 2C99A 5IRCD 2W6JD 1F4QA 4F0ZB 4W7SA 3SJCA 1TQ6A 3W6PA 1DJWA 1OKKD 1W0JA 2ANBA 3IPXA 3VR1A 3BIFA 1LVGA 2LKDA 4U02A 4EPTA 3O8BA 1IKUA 1F4OA 1RRFA 1Z5ZA 2CBZA 3B1WA 3LX5A 5D3MB 4LX0A 2J41A 1BG1A 3NEYA 2KGRA 2WWYA 1IRJA 3DMNA 1NUBA 1E2QA 4QBIA 4D80A 1TU4A 2ZSAA 4TTQA 5G40A 1GVNB 4YMUA 2WAXA 1NPQA 2D2EA 4HRHA 1E9SA 2QM8A 3EKHA 3ZJYA 5EUQB 1CULC 1P72A 2Q9BA 3CM0A 4X8MA 5FOUA 4GZLA 4RJLA 2LP3A 3WXMA 1JJ7A 6Q21A 3AVVA 1IM2A 2OPOA 2EW1A 1GL6A 2BCXA 1HQCA 1YVHA 3K9GA 1PSBA 5AUQA 2OFOA 2K2AA 3CNNA 2H61C 2GJSA 4B47A 1WRKA 4BE7B 1ZJ6A 5E3HA 1OHHA 1XEWX 4TTRA 3FMIA 1VCIA 121PA 2R6FA 3ADBA 3R9WA 1DPFA 3CH5A 1FF1A 2F2PA 2C9OA 4L15A 3UK6A 3KQLA 2FPMA 1PULA 4CFRA 2Z0MA 3CPEA 2YC2C 4JLVA 2O8DB 4EJSB 1G4YR 2OAP1 1XCGB 4S2EA 1HY3A 3CWGA 3AF2A 5DGXA 3B82A 1GRQA 1US8A 1ZC4A 1XA5A 2XJ4A 3MWYW 1JEDA 5TVKA 5KNBA 1YURA 2WOSA 4YI8A 1X8JA 1T0HB 1CMGA 1AS0A 1AKEA 5TARA 4D6PA 4BZPA 2C04A 1JXMA 2L4HA 1E2KA 1XCPA 3SG4A 1YKSA 1Z0AA 2FFHA 3ZZUA 2IEYA 1P9RA 3TR5A 2ZJOA 4F4CA 1B23P 3GJ3A 2JXLA 2JCSA 1H8BA 2PRUA 3ND9A 1N25A 1N6OA 2AMIA 1Z83A 4OKSA 4B3FX 4B2PA 5KHOC 3UWKA 1BYIA 1P4SA 3WXAA 5J4LA 1DJYA 3B9PA 4V0LA 3BORA 4XVUA 1J1EA 2PASA 4RCYA 3DVLA 2QN6A 3LQQA 4LCBA 4XWAA 5JOLA 3UMRA 2BMEA 1FI6A 1L7VC 1XMSA 3BERA 1LF0A 3ZQJA 4PO9A 1HT9A 5GQQC 1G19A 2Q9CA 1S3PA 1ZM9A 3SG5A 4DKXA 2GRJA 4UPGA 1RECA 5HKYA 1T8TA 1YZQA 4I1VA 5I8NA 3U44B 2GJ9A 5B30A 2ZRPA 3KEVA 2WOOA 4ZKDA 1G33A 5FR2A 1OV4A 3GLIE 2HCBA 4XTCS 4DDTA 4BFSA 2ZFDA 2J87A 3G5UA 3W3AA 4A8JB 1T5IA 4OKHA 1U90A 1N6KA 4OK3A 4ZCVA 2PVBA 3KF9A 4I5JA 3TQCA 4Q4HB 2ZRGA 3GLFA 2JLWA 1CTRA 3I5FC 5SZIA 4NYMR 1GTVA 2RGCA 2GEDA 3F5FA 4B71A 1CM4A 1OMRA 1CJUC 1W7AA 4L4UA 5JRZA 3KQUA 3EK4A 4EJSC 1AQYA 1FMJA 3BXZA 1S6JA 2VTKA 1E4YA 5AXIA 1P2VA 3DZDA 1TN4A 1LVCD 1XTSA 4CEIB 2OBNA 2LP2A 1TQDA 2JLXA 1XTQA 1F70A 2HT6A 3SJZA 4JPZB 1H8EA 4IDPA 4CEJB 3GEHA 4I1UA 2JTTA 2QM7A 2RGDA 3FIAA 5CSJA 1ZINA 4LYHA 1G7TA 3DEFA 2KI5A 3DD4A 5DLQC 2O8EA 2HUPA 4KSBA 5KPDA 2AAOA 1L4UA 2BBTA 4JYCA 4YGBB 1I2DA 4DCTA 4URVR 4WRIA 3Q8XB 3BE4A 1I4TD 4DUGD 3RLFA 4GZMA 3BB3A 4AWXA 4U5XA 5HLOA 3FKQA 3SG2A 2QSYA 5FPSA 3JVUA 2BKEA 1KK0A 5KNCA 1MXEA 4L9SA 5FOWA 5DH9A 4MRXA 1KAOA 3ZD7A 4Z1MD 1ZCBA 4WAUA 4Q04A 4KVAA 4YDSA 5CLLA 2QG6A 2DOQA 5GJBA 4PCWA 2ZKMX 3KJHA 3MWKA 2CNWA 1B7TY 4RD1A 1T3SA 1N0VC 5HR5A 1EH2A 5TB5A 1TOPA 3LW7A 3LXXA 5C4GB 5J4YA 4OV2A 2F1JA 3DF0B 2VF7A 2QU8A 4HZUA 3RWOA 3U5ZB 2ZR9A 1G291 3QVUA 3PCRB 4BY4A 1BJFA 1G8FA 3EAQA 1KMHB 1OSNA 2GA8A 3PUZA 4XD7D 5EUMA 3RSLA 1TF7A 4Q4JA 2WAYA 4O0MA 3D7MA 3K21A 4NONA 1F54A 2Q91A 3R20A 4NU0A 4FINA 1PVBA 3BFVA 5GVSA 1GKIA 3KHEA 3FKSA 4RD0A 3CPHA 5FPTA 4IDNA 1E9CA 2PLFA 1XTIA 1SBJA 1AQUA 2O8DA 1B1GA 3WMGA 1KSGA 2A30A 3CRMA 4BFYA 3B1VA 5FBVB 3AEZA 4TLAA 4TN1A 1L2TA 2V4ZA 1NCXA 2TN4A 1GZSA 1ALWA 1YZNA 3AAJA 2ZUDA 4B43A 3TE6A 1N3BA 4ZI2A 4F91B 3QPUA 1D1OA 3OE7D 4UXJA 5IHPA 3SHFA 4QBFA 3RC8A 3PN7B 4X8HA 1GQMA 3KKQA 4MITA 2OCAA 4OQFA 4BECA 2IS4A 3DO6A 2P6UA 2ZE6A 3D8BA 3HU3A 3KB2A 2QL6A 3SR0A 1GWNA 4M8NE 1XU4A 1MRNA 2ZRIA 1XJQA 3TZ1A 1AZTA 1KFXL 2LLSA 1N6RA 2AXNA 2WICA 2ZS8A 1CP2A 1KHTA 2G83A 2XSZA 1OZOA 1AK2A 2O5VA 2WJYA 4GOKA 4JL6A 4WBSA 1RPZA 1E3MA 5JRJA 2R44A 5BPJA 1ZBDA 2ZJ5A 1IN4A 2WWHA 3DVEA 2ZTSA 4MRRA 4FN5A 4ZCUA 3WP1B 2QAGC 1ZIOA 2ZRCA 2PZGA 1U81A 4IVRA 1M8PA 1LY1A 4L8GA 4P4SA 2I94A 1GRRA 2V9PA 3FKSD 2LVVA 1GG2A 4LOAA 5GJVC 1PJRA 3VHXA 4C2UA 1CF4A 4Q48A 1QG4A 3K09C 2H61A 2Z5FA 4ZIRB 5KSZA 1S5GY 3VR2A 4GOJA 4XD7A 1Z07A 2Q3MA 2ONJA 3THWB 3FMOB 4AQIA 2V1XA 4DB2A 1WXQA 2UVQA 3QF4A 2ONKA 4DLSA 2DCUA 5KTYA 4RFSB 3W6OA 2OUKA 2ZYUX 2H5EA 2J3EA 4BZXA 2QMHA 4C4PA 2YWEA 4A2WA 5JCPA 3AVTA 2LE9B 3RRYA 4GGNA 1EFRA 3I8XA 1W36B 1DGUA 2BJVA 4LJ8A 1FP6A 3A4LA 1UF9A 3U60B 5AJXA 5PALA 1COWA 3QKUA 5A5GA 1NIWA 4URZR 1IXZA 2BIFA 4Z1MA 2EYUA 3FHCB 1TCOB 2V53A 2PZEA 3LWNA 5CITA 4Q1FA 4M1OA 4TYYA 3I72A 2IXGA 2ZI6A 3AGQA 4JLDA 4DWJA 5J47A 1Q1QA 5G41A 2LUXA 2W58A 2YC4C 5K8TA 4AC9A 3AF0A 3THXA 3PN7C 1K9PA 3MFYA 4HAZA 4EDHA 1YUUA 5F2EA 4B3XA 4M53A 4YMWA 4GAOA 1UEJA 1EG3A 2C77A 5DN6A 4ZCLA 4HAWA 1SVLA 4C0QC 4Q01A 1G3QA 4UNPA 2MRDA 5EXTA 5G53C 1F2UB 3R7WA 3FE2A 4OHXA 2P6RA 2H8KA 2G0NA 2ZRBA 1C4OA 3RRZA 3LQRA 3TVDA 2ASEA 3PEUA 1K5GA 4QJ4B 2CDNA 3WHLA 1MHOA 2ODBA 1E2HA 1M6NA 2RGNA 3IHWA 2QAGB 1KK8B 4QJ3A 1X3SA 4X8OA 5LD2C 5C4MA 1UBEA 1Z8FA 3EPLA 4IXNA 4CZ2A 2A2ZA 5KNDA 4OYHA 4Q1DA 1DGVA 3I5HC 3U2QA 3AKCA 4GNKB 1BH2A 1YRAA 3NTUA 3ICEA 4QHTA 2RKOA 3LK1A 2JJ2A 1QXPA 1JR6A 3A1WA 2QAJA 1SZPA 3K0AA 1JC2A 1UKZA 2YNMA 3WMFA 5JJIA 2IXFA 3ZGXA 3GD7A 4PANA 3Q5DA 4PFSA 1LF5A 4II7A 3IQQA 2NO9A 3DVMA 1IAQA 1KY3A 2WJVA 4LBZA 4PHJA 3WNDA 1KKLA 1U0JA 2GK7A 3AVYA 1WDCC 4PC2A 4QM6A 1UBGA 4B76A 1DF0A 2RAPA 3EZFA 1FTNA 3MJRA 3EK8A 3R8CA 4TZ6A 2K2FA 2C96A 1R6PA 4C3ZA 1KSMA 1XFUO 2C2HA 1GNQA 2ZANA 2GAOA 1IY1A 4WZAE 1E1QA 2GCOB 3K0CA 3LBHA 5ER4X 2W00A 4HDOB 2KI4C 4GBMA 4YMTA 1S1MA 4C0SA 1Y1XA 1IJ6A 1NKTA 2KYCA 2VHUA 3RS0A 3AKYA 1KWOC 2J1LA 1GKUB 4Q1BA 1DARA 1NVVQ 4TMXA 1XFVO 2VF8A 4TMVA 2JLUA 4HB3A 4V03A 1BMFD 4PZZA 3MWJA 1ONBA 1D6JA 5B8IB 2X1VA 2F2OA 1TL7C 2IHYA 2KBFA 4YGDB 4BLOA 4AKGA 4MRSA 2FX3A 4TMKA 3M6AA 3I4LA 4BEBA 1QASA 1JBAA 4DLUA 4GRAA 4OK5A 2VPPA 5TMPA 3LLMA 1NSFA 1GILA 1S96A 4HZIA 3BUMB 3VROA 5JWOA 1AK8A 1IXRC 4D2IA 4NQGA 3IEVA 1KI6B 2ZN8A 2RGEA 4Q9LA 2VP9A 2JOJA 2ERYA 1OXUA 2MAZA 4RCZA 4CEHB 3SU8A 2WJHA 2NLNA 4HUTA 1D2NA 1OW3B 1BMOA 3PLFB 1G4AE 1B0UA 2HQWA 4PHNA 2XTZA 4YI9A 1JALA 1I2MA 4PO8A 4QC2A 5KSOA 2ZI9A 1JAIA 3R8FA 2OLJA 1WP9A 4ZIRA 3L82B 3T15A 1H8HA 4R7ZA 4TMZA 2L0XA 3NDBB 3AH8A 2WCFA 2FZLA 1Q44A 2YYZA 2ECKA 3AP3A 2J0QA 1S4QA 2IF0A 2ZETA 3U3OA 3Q5EA 1IQPA 1R0YA 1XFAA 1LW7A 1R2QA 3MAAC 1BOFA 2J45A 1PRWA 1G20E 4BFVA 1EFUA 4TYWA 1YRUB 4R98A 2BE6A 2GXUA 1QHSA 1RFLA 2C5LA 5CDFA 1XP8A 3REFA 1CBUA 3MD0A 2VSFA 1VMAA 3QNUA 2QE7D 1C1YA 1RZ3A 3ZVLA 3PXGA 3A58B 1BO6A 4DBLC 3O8RA 3AGPA 3CX8A 2PL3A 3HPQA 4BFZA 1QIVA 5CK4A 2FCDA 2ZVQX 5JEDA 2JT8A 1P60A 1L4YA 1TCFA 1MF8B 1E2JA 2WMOB 3GFOA 4IFBA 4JYBA 1E32A 4QJ4A 3JTDC 4V0KA 3CRVA 5KDDA 1KK2A 3T06B 3TUIC 5AJZA 1AJEA 2A5DA 2GV5A 5J40A 1TNDA 3QPWA 4JMPA 1ZM2A 1S36A 4M22A 1YR5A 2QT1A 4D25A 1S2MA 5JWHA 4MGKR 2Q3HA 1J7KA 3I5IB 5CIQA 4CFQA 1NY6A 1XD2B 1ZOTB 1AGPA 1KDOA 4JSYA 4PAMA 2MHHA 5C46F 3K0AB 3VNUA 3REGA 1TQ2A 1ZNXA 1UADA 1LB1B 1A2KC 1ZM3A 1CJKC 3GEEA 1OE0A 1UKYA 1XXHE 4OHWA 4B48A 1DG1G 3ADCA 4LYAA 4PE0A 2VIIA 2VLIA 2HLDD 1G8IA 1KI2A 3BD9A 4WOPA 2V55B 3WYFA 1SXJA 3ZNIA 2JJ1A 2OS8B 1GP2A 2ZE8A 2VHTA 4B2IA 3OFND 1MRSA 2HYDA 5EE9A 2E1RA 3CZTX 1OFHA 4FIDA 4CLNA 4NPHA 4V02A 3TMKA 4PQYA 621PA 3U4QB 4EJSA 1P5ZB 1DJGA 2WCEA 1S1EA 1R8QA 1E2LA 1SQ5A 1TUIA 3QXHA 5HCNA 3ZYCA 4QJ3B 1E8AA 4JLOA 3AF1A 4PSKA 4B32A 2Z43A 1DAMA 1UUSA 4KHZA 3KTAA 2BL0C 3NVAA 2LCFA 3S1AB 2KFGA 1KJZA 4EFNA 4F7WA 4FWTA 4GL2A 2I7AA 3AF4A 3OF5A 2HEIA 1BS1A 3E2IA 2K0JA 1XBTA 2WWXA 5AR1A 4QJ5B 1G1MA 3MGCA 3Q85A 1BYUA 1AN0A 4U00A 1CTQA 5H8WA 2QRNA 3QEJA 3TW4A 3DL0A 5TY0A 2XZLA 1YX8A 1UDXA 4JJKA 3NH6A 2LLUA 1HTWA 2YVUA 2CK3D 2W0SA 4F92B 3K09A 3AV0B 4ETOA 1Q80A 2GXQA 2MJWB 5EXSA 2KAXA 1U0LA 2CXJA 221PA 2V6IA 4MH0R 4ACBA 4EIWA 3QSYA 1QHIA 2IS6A 1W1WA 3AF3A 3ICBA 2OZEA 3ZS8A 2F43A 3BH7A 3TS5B 1LKJA 2PCLA 3SI7A 5CPVA 3KKOA 2ZUBA 2FZ4A 3AVOA 4LBYA 1EG4A 5AERA 4B34A 1Q21A 3A8RA 2IYXA 3NBXX 4NDZA 1SKYB 3TW8B 3HYRA 1M46A 2KQYA 4FMDB 4PAOA 3R7WB 2ZRNA 4ZDJA 1K9UA 1UKEA 4QGAA 4C2TA 5I2QA 3A6PC 4IKEA 1QZXA 4QNRA 5SZKB 2LCPA 5JEEA 3CLVA 1R8SA 1KSOA 3KTAB 3L0PA 1G3MA 1CFPA 1ZW6A 4E03A 1IGVA 2DR3A 5EP1A 5G3ZA 4D4MA 1NBMA 4B73A 1MOZA 3P1JA 2MBXA 4XTRA 3TK1A 3IPYA 2EFGA 2O8CA 1S6IA 1J7QA 1YVLA 2W83A 4KV9A 4NYIR 4Q4HA 4F93B 2KSPA 4BY5A 1MO5A 2O8BB 2X2FA 3EZ7A 4KJZA 3K0FA 2LHIA 4Q9HA 1OMVA 2GNOA 4LYFA 1OXTA 1UHHA 1RWYA 1JAHA 3QXSA 5KYKA 4W5JA 1LA0A 3Q7PA 1FNMA 1E79A 1Z6GA 4N1FA 1A4RA 1TF5A 2O60A 1RIFA 1XXHB 1ZM4A 2FJUA 3UMSA 1JQLB 1YR7A 1T0JB 5I2OA 4JZKA 4MGZR 1EFHA 3K0FB 3T61A 2FEMA 1T3HA 2NO6A 3I5GB 3LY5A 3NSKA 1JFJA 3WNCA 4RD3A 4M1TA 1S0UA 2BBNA 1EXRA 2LMUA 2L98A 3DF0A 4JLPA 1VYUA 2JNXA 1WE2A 5AUNB 4V0MA 1UBCA 1ZNZA 3WBJA 2ZR0A 3W90A 2O5GA 2K7BA 1N6LA 2JJ8A 5FH9A 3A8TA 1TRFA 3OAAA 2B7CA 2EQBA 2IEZA 2P6NA 4CYMA 5EQTA 821PA 1QF9A 2GJAA 3BS4A 3RNLA 1HQVA 3SZRA 3VU9B 5HKZA 2LM5A 2SHKA 2UZIR 4URXR 5K8IA 1SMGA 1OIXA 5HE9A 1N0WA 1QLSA 1I4LD 3CZPA 2FGJA 1ZMXA 3KXLA 4P32A 1SVMA 1YR8A 1UHJA 3X1DA 1OIVA 2QPAA 4AKIA 1OYWA 1YRTB 4EFMA 1F55A 5JMTA 4PE1A 4LV5B 1E0SA 1XYDA 4HDQB 5EE1A 5GJCA 2L4IA 2LAPA 3RLZA 2I1VB 5CYOA 3LK0A 2GGZA 3U7FB 5JS7A 1G5PA 1G8HA 3HR7A 2ZI5A 1G6HA 1FNNA 2IHBA 4NKRA 1R0WA 5E95A 2GXSA 1XPOA 1OIWA 1IN7A 5P21A 2Q4UA 3EW9A 2FN4A 4MKHA 5DIFA 2QBYA 1WLZA 1XMVA 2D4HA 2V8OA 3OZXA 3SQXA 3VFDA 4MA4A 2ZRTA 2XOKD 5AEQA 3IBYA 3T1VA 2Q3FA 1SKTA 2NXQA 3FTQA 3VRNA 2WJJA 5F9FA 3EPHA 1NCYA 3GK1A 1DMOA 1IBRA 1S8FA 2CHVA 2L2EA 2QMUA 2A4JA 2XEXA 2GF0A 1G21E 2VA8A 2ZSBA 4RD6A 5FTLA 3PUWA 3P32A 4YONB 2EVWX 1QHNA 1P9WA 2W2XA 5SZHB 3L8YA 4L9WA 4LY6A 2C78A 2PMDA 2B8TA 1XFXO 1U94A 1JUOA 1P2UA 5EZ6B 2IS9A 1QVIY 4D4KA 1TTTA 2JLSA 3OP0A 2Y8EA 3SS8A 4E5UA 1KI7A 3W9YA 1IJFA 3DVKA 4MGYR 4BLTA 2XXAA 3I5FB 4YGAA 1K93D 3NC0C 2H7VA 3IDQA 4LRWA 1GRNA 3U6KA 1WBDA 1AJ4A 4C7OA 4DZZA 2LMTA 2ZNDA 1TX4B 3W5JA 4JBXA 3FFAA 1COWD 4DEXA 4Q1AA 3X1XA 1R5BA 1GGZA 1CJTC 1DBSA 3TUYB 4A0FA 1E9EA 3SDZA 1LS6A 1MT0A 1SR6C 4TLBA 3EVRA 3TAHA 4AURA 1BODA 5CK5A 4P5OE 1YE8A 1V1FA 2KWIA 5J4KA 1KIMA 1QV1A 3UATA 1IWQA 4MLWA 2QPOA 3TLXA 1U0HC 5EP3A 5UKDA 5DE3A 2ZQ5A 2C03A 1KMQA 5CSNA 1KQVA 4DLTA 3AVUA 2RB4A 2GDJA 1M7GA 4DCSA 1Z0DA 1KI1A 4DLYA 2FNAA 3EIQA 1KQMC 2J46A 2DWQA 4GPTA 2DPXA 1AKYA 5AJYA 2LLTA 4DLXA 2H92A 1HT1E 1FMLA 1OXSC 4LV6A 3HJNA 3TVTA 4ZDKA 5LD2B 3TDIA 1NVUQ 4H9GA 4D81A 4PC3A 4TLCA 1XWIA 4PE7A 3TDUA 4MQBA 4PPFA 4US1R 3I5HB 2WMNB 2XTNA 1W0KD 1QHHA 3WRXC 1NI3A 3E70C 2EFDB 1Q22A 1DAHA 2PEYA 3SYLA 3EX7C 4QKQA 2F7SA 1CKEA 2BCBA 1KNQA 2M3WA 1Q1BA 3EIEA 4ARZA 3ICQB 1UFQA 3D0YB 3ZVNA 4MGIR 2BCJQ 4QM7A 2ZITA 3TAUA 1KI9A 2ZRKA 4CEHA 1IY2A 2GZDA 4C0KA 4DVGA 4HSZA 1DAGA 2Z4SA 4DHEA 5GADl 5IK2A 2KI6D 4Q7MB 3CO5A 2QQ0A 4KVGA 4EKDA 1WDCB 2ZJAA 4DRWA 2ZJ8A 3OE7A 5AANA 4Q1CA 5D3QA 5L3VA 2FFQA 4MDFA 3PQCA 1F71A 3GFTA 4CGZA 4P33A 3LRPA 4DIRA 4IXMA 4KYUA 3UMFA 3W3ZB 4DT1B 1TEVA 4DSNA 1E2DA 1VG1A 4KODA 1KDPA 4P4SB 3KQHA 4GFDA 4C9BA 2RGXA 421PA 5DNYB 4TWZA 2XZPA 3LD9A 4TQUS 1U8AA 4JKYA 1O87A 4BWYA 4C0LA 5D7FA 1NJFA 2IBMA 4KI0A 1G16A 2OAQ1 1XTKA 4MZLA 1LFDB 4BFTA 4R1EA 1SR6B 1N65A 3V00A 1M7HA 4K8OA 4RFSA 3GK2A 1F3OA 3LX8A 2DBYA 1Y0VH 1KZ7B 2IK8A 2REOA 4KCGA 5BYJA 3CBQA 3VR5A 1QRAA 4A4BA 3ZVRA 4B6EA 3JZAA 2F3YA 2X2EA 2W6JA 5DKRA 3FMFA 1XFWO 1FUUA 2BE4A 3OX6A 1Y6WA 1HURA 2WKRA 3ECCA 2GJ8A 3VQTA 3WRYC 3FHTA 1XJCA 4NTZA 4MKGA 2R6GA 1RW4A 5DISB 4BASA 2ORIA 3C4JA 1QIWA 4GGFA 4JSTA 1SCVA 4CT4B 4B75A 3KDSE 3IO5A 5CIWA 4OJKA 3C5CA 2QPTA 2FFBA 1GNPA 2AKAB 4NYJR 2HYIC 3EPKA 1NN5A 5FTJA 4MN0A 2IYLD 4M2QA 1A2XA 1E9RA 4CT5A 5BN3A 1NN3A 1ODBA 2ZN9A 1ZP6A 2WWGA 1TNWA 1W44A 3BYAA 1Z6YA 2RGBA 2VH5R 4H1VA 4RSGA 4XVRA 5BN5A 4OHZA 3U3JA 5E7MA 2K7OA 1RYFA 5J4HA 3GP8A 2O8CB 3KKMA 1TIZA 1F48A 3CRW1 3QKSB 1ZUIA 3D10A 3KPXA 1DOAA 3EC1A 4EUNA 3I5YA 5JBQA 5FYXA 1J2JA 4N1GA 2E30A 2QACA 4ACAA 2CLDX 4A0HA 2Y1NA 1WBBA 2G3YA 4M21A 3PFVA 5FTKA 1E2EA 2GAAA 2NPIA 3ADKA 4PSVA 1NYAA 1XEFA 2ORWA 3CH4B 4P3YA 3SBEA 2EFHB 3I5IC 3GJ7A 4Q5IA 2W6IA 3WYAA 1SL8A 1A7JA 3HP1A 4H1UA 2BWJA 4MRNA 1E9BA 1CRQA 4QXAA 4RY2A 3QKRA 1P2TA 4Z51A 4ZDIA 4MZKA 3EA5A 4PHGA 2O0KA 1UKVY 3QUSA 4TL6A 1YZGA 3LBNA 4OHVA 2JT0A 3LL8B 2YOFA 3ZIAA 5JS8A 4AK9A 1PK0D 2EHBA 1KFXS 2PSRA 4RZXA 4MDEA 3THXB 1XDBA 4DLVA 4ZPXA 2JLVA 3H2YA 1SULA 1KTVA 1DVIA 1ZIPA 2QTHA 2IUTA 3CRQA 1RKBA 1NJGA 5A0FA 1D2MA 1XB2A 2DWOA 2BL0B 1OFTA 1TU3A 1S6CA 1YR6A 2PLRA 3THYB 2HF5A 1EG7A 2OFXA 1NX0A 4AY2A 5HKWA 2QY9A 4BLRA 1D2EA 1KK3A 2F55A 1E2IA 1JNYA 5EE0A 4A15A 1NIJA 4PPNA 1TF2A 1YZTA 4P4UA 1R10A 1ZC3A 1RE0A 1LINA 1R2UA 1CS4C 4M9SA 5FI1B 4D0LB 3LLUA 1Y1UA 1QDEA 4UNQA 4A6XA 3R9XA 2C95A 2VHQA 5A4JA 4EAQA 3DPUA 2AX4A 4BLPA 4A9AA 5BWMA 5L3SA 2R2AA 3C41J 4AI6A 4DDWA 4PC1A 1J70A 4CPVA 4G3XA 4BLQA 2M7LA 4XOIA 3DKPA 1NRJB 1J8YF 1F2TB 1B47A 1KK7Z 1KKMA 2FSIA 3FFBA 4MKFA 2F6RA 2XNSA 4FMCB 4NBSA 3EARA 3W8RA 1OMDA 3BB1A 4JBYA 3A36A 1NP8A 5DI3A 2ZRDA 3KQNA 3B5JA 3C14C 5JI3E 1KK7Y 2EC6C 1WLMA 2B1UA 2IYVA 4JLNA 4HRGA 2J0UB 2CEAA 5EE3A 2ANCA 1W48A 4ARZB 2CE7A 3EWAA 1IQ5A 1X1RA 2KB0A 1KWOB 1KAGA 3EC2A 3KKNA 3CLNA 1AHRA 5HKKD 5DKQA 3H4SE 4JVNA 2ODNA 4DUQA 1K6MA 5H1YA 4TQAA 4BLSA 1GIAA 3IBGA 3QEOA 1DG3A 1HEIA 2CHQA 3BBPA 3QKTA 4JBWA 2FSHA 4JL8A 2LVIA 1A03A 1YUTA 3RM1A 4DLRA 3OEHA 1VCNA 2ZSEA 3HR8A 3CWZA 1QHGA 3GJXC 2CVFA 2P3SA 2KBMA 2L51A 1E2MA 2ODWA 2QENA 1K96A 3CNOA 1XTRA 2AWOA 5FPYA 1NIPA 1RK9A 1P9NA 1DJHA 3EG5A 3TUZC 2DFLA 3PFIA 1SGWA 1YHNA 3PEWA 1D5CA 3GJ6A 2ZE5A 4PQFA 3K53A 3U7HB 1ZFSA 2E6WA 2OCPA 2X77A 4UXHA 3RS3A 2QRZA 1QVIZ 1IH0A 1MO4A 4P4TA 4PALA 1PLJA 1E69A 3BUXB 1SNLA 1N6PA 3B2EA 3BH6A 3CONA 3IQWA 4DIEA 1JPJA 1NG9A 1C07A 4GT1A 5H70A 3GLFB 5FUWA 3AVXA 3KO0A 3K8YA 1TMKA 2NQ2C 2DFTA 2ZYTX 4O3MA 2G1JA 4DCUA 3NC1C 4RKFA 2WSSD 4MRYA 5DO9A 2QE7A 4I1OA 2V6JA 1II9A 1P62B 3U4QA 2G77B 4LK2A 1WRBA 4HI0E 2IA5A 2OO7A 5CM8B 3KFVA 2H18A 2ZYWX 4ILEA 2YKGA 3BC1A 4CW7A 1H4BA 1X02A 4FW9A 3VHLB 4ASUA 3ZDQA 1GDDA 4XIGS 1NMZA 3Q7QA 1S3GA 4C0BA 3PUXA 1TNPA 1YR9A 2P65A 4PC6A 4MYUA 1UPTA 3SIAA 4GDFA 2ZRSA 4TQ9A 1KFUL 1E0KA 4A0RA 4EPYA 2MSDB 2VEDA 5B2ZA 2G9BA 4UJ3A 4A82A 3L43A 5FTNA 2ZIAA 4LHWA 1QTXA 1E2FA 1ZUNB 2JDID 1SVIA 4WQ2A 2VP2A 3MSXA 1OH7A 1G9XA 1KO8A 1N0UA 4LJ4A 4AG5A 4UNRA 3THWA 2Z6VA 4F4IA 4NCJA 1EESA 1J8MF 2OS8C 4E68A 1IONA 1VCMA 3JVTB 1G64A 1VPLA 2CK3A 5FOSA 3LV8A 1JSAA 2AD5A 1OLOA 2O0JA 2ZYVX 3X1ZA 2QQEA 4KFTA 3PV0A 5JJLA 2IW3A 1E96A 4TT3A 2ZR7A 2O8FB 4US0R 2NZ0A 4GBAA 1NVXQ 2BMFA 1LXFC 1E99A 5KSPA 2FJUB 2R8RA 4MYHA 4OR9B 1IXSB 2KDHA 1Z28A 3PR1A 1M74A 4LC1A 3KJGA 2QAGA 2J0SA 1J55A 2I3BA 2NIPA 2Q0HA 2WKPA 4A6PA 1UHNA 2L0PA 4NE2A 4YGCB 3DOEA 5FUYA 4B33A 2J7PA 1CFCA 3BRWD 3AKBA 4HLQB 4HUQA 4LHXA 3NWJA 3O47A 4KLNA 3F45A 2CCJA 4Z8XA 1XZPA 5FBQB 3VX3A 5DKNA 5KOYA 3GLGB 4B3GA 2COLB 4B74A 2X8AA 1K9KA 1GL7A 4PHFA 3QBVA 1ZUZA 5FL3A 1W4RA 4MRVA 1UHIA 5E7IA 4IRUB 1EJ3A 2L50A 3OESA 1CFFA 2IWRA 4ZI3A 3M0EA 4TSFD 3TS5C 3FYHA 1PUJA 5SZJA 5CDFE 4DSOA 4IDHA 1MO3A 4JVLA 2VBCA 2RGNC 4IHQA 5B58C 5BYKA 4Q4JB 1DAFA 3AB3A 1WF3A 2NTYC 5JJKA 4ITRC 3FGNA 2P2LA 1V1GA 2VP5A 4IEEA 4XWKA 1GITA 2Q6TA 1C7WA 1YZKA 3BB4A 4A2PA 4KBGA 4PHKA 2AWNA 4OQXA 1KQMB 5CM9C 1OSAA 1U98A 3CRRA 1Z22A 1KGDA 3IILA 2WM9B 2D3WA 1OF1A 5D3MA 1IY0A 3RVBA 3GJ8A 1J7OA 5KPJA 5JSZB 1R6BX 3VU9A 3THOA 3T1QA 2CL6X 2M1KB 4HAUA 1Z0KA 1XD9A 1HUQA 3X1YA 1P61B 1DF0B 1ZM7A 2ZJBA 1AJ5A 3HCMA 3RRMA 2P0EA 3TJZA 1KNXA 4HATA 2BBOA 4YGEB 3O2PA 2B7BA 1B8RA 2LUCA 2QA5A 4F4JA 4Q4AA 5LPNA 2JRFA 2SCPA 3CR5X 2EGDA 1ESNA 4IVPA 3K9LA 4F38A 3C1VA 1CLUA 5EZ5A 2WHXA 2FSFA 3A1VA 2YOHA 4Q9IA 5HZHA 5TXGA 2PMKA 1NLZA 3VKGA 1JFKA 1NX2A 2VP0A 1QHHB 1HV8A 3P4YA 2VYFA 4PHTA 4A8JC 3DDCA 3KXIA 3QXCA 5H68A 3EXAA 1LV7A 1E0AA 3W5IA 3X1WA 2AHOA 3UG7A 3RABA 2K8MB 3K9NA 4EQ6B 1JXOA 1ZU5A 1JEEA 3E1SA 4HSEA 1S9DA 3FS7A 4OCIA 1Y63A 3PJRA 3IIKA 1DJIA 3O8CA 2MLFC 1GGWA 3WMEA 4WIAA 1OZSA 5M04A 5KDLA 2JULA 3OIYA 4B44A 3OIWA 4HLUC 2D62A 2FFAA 4A4DA 3DZ8A 1T8UA 2N46A 2XX3A 3C5HA 2TMKA 2XAUA 2D8NA 1FPWA 1FX0B 1BOCA 3AUYA 3GLHE 3QF4B 4TNCA 1FP7A 2HXYA 1VG8A 3LDAA 4D0GA 3FOZA 4MKIA 4LJ9A 1UJ2A 4ABYA 3MCAA 4I99A 2HF9A 2LVKA 1PUIA 1P6XA 1BR4B 3PEVA 5B64A 4D4LA 2REBA 1H8HD 2BBSA 1NSHA 1E2PA 1R0XA 5L8VA 4ORCB 1PSRA 4QHSA 2CXXA 1W46A 5EP4A 3LFUA 4O25A 4XVQA 3TIFA 4HLUA 5FOXA 4G0NA 3H1TA 3NBFA 1ETUA 2GJKA 4ZCMA 3P4XA 3TKLA 1P2SA 2O8EB 1M7BA 4MSPA 2JASA 4PPGA 5C18A 5ELXA 3VR6A 2WIAA 3FB4A 3RS4A 3QXXA 1AS2A 1XMIA 1E98A 2FOTA 2IF2A 1W36D 2XB2A 4GPLB 4RZ3A 3ZQ6A 3U44A 1XJ0A 1B4CA 1G8PA 1M31A 1VECA 5ANRB 2VRWA 4LJ7A 1UWOA 4A2QA 3IQOA 1OHHD 1R5NA 2IL1A 1SK6D 2JXCA 2PT7A 3L2OB 1XEXA 2IYSA 1I4DD 4NCNA 2BJWA 2F1IA 2JAQA 2QMOA 3DOFA 3L0IB 1XMJA 5FOTA 2QORA 1MWNA 2FGKA 1BLQA 4V0NA 1GKYA 3CTNA 3AKAA 3AP2A 1K94A 4BRUA 3EZ6A 4M2LA 3GOFA 4JIMA 1E1QD 1RYHA 3GK4X 1HYQA 3QI2A 2BDTA 2H57A 2OBMA 4URUR 1UM8A 4CIDA 5BW8A 1IOZA 1TUEA 3CIOA 4M1WA 3SNHA 2K7CA 4LBVA 1U5IB 5AJVB 2JWWA 3PENA 1NLFA 5F98A 3SFZA 3SN6A 1XK4C 4B3DA 2NMVA 3OFNA 4USLA 2IWHA 2J5XA 1RRCA 4U8DA 2XZOA 1RJ9A 4L9MA 3EZ2A 1J1DA 1KI8A 1U2RA 1CR2A 2F3TA 1F60A 2GK6A 2LKCA 4M0LA 2HT1A 2YZ2A 2GKSA 2ZRJA 2WWWA 4DSTA 1X86B 2BKHB 4IJMA 5FL7A 4JJZA 5EP2A 1MABA 2RGIA 1SXJC 2GETA 4TL7A 3KL4A 4RKEA 1D8TA 1Q3HA 1T5LA 3LXRA 3FWCA 2OSBA 3THYA 2M7NA 4I5LB 1BF5A 3FWBA 1H8ED 2B6HA 2ZRFA 3ETLA 5AJWA 2IC5A 5LBIA 1XEXB 1E9DA 4KFSA 3T34A 3VR4A 5JSZA 2QUZA 4HLCA 4ZDWA 3WBKA 3VNVA 2HJVA 4W9MC 4KBFA 2H17A 4A1FA 3EKJA 2ZRLA 3RS5A 5CLQA 1ZYUA 1CDMA 2V54A 4WQ3A 3UWOA 4B2LA 1CFDA 4LBWA 3BOSA 2OESA 1SXJD 2G2BA 3CS1A 4G5OA 1SYMA 4DUGA 3DMDA 4JVSB 3ADDA 4N3NA 2WV9A 1NLYA 1XFZO 3ASZA 1QBKC 1CKKA 2ODEA 4NCHA 1G6OA 3TSWA 1IJEA 3IHLA 1VIAA 4DDVA 1VYVA 3AKDA 1MQ1A 1QX7A 1T3LA 4TL9A 1GM5A 1UDWA 1EWRA 3BQ3A 2ATXA 1Q1EA 2OG2A 3TRFA 1YJ5A 4FCVA 1X6VA 1AUIB 4M9ZA 1XNJA 1MO6A 4G5QA 4ESHA 2QTFA 3X2SA 3IKJA 3B7GA 2AK3A 4FTGA 2CJWA 5G08A 1CJVC 3SG3A 2EFCB 3RS7A 4PXAA 4OI1A 3GJ0A 1OJLA 3TSZA 1Z6AA 2PZFA 4Q18A 2K5UA 4M2OA 2RCNA 2UKDA 4M9XA 4YMVA 2GF9A 1B9AA 3QKSA 2CMKA 4YC7A 4R71A 2IYUA 1OOJA 1PLLA 2BEKA 2OCYC 1X8LA 1G7SA 5J5CA 3EPJA 4PO1A 5HE8A 1W7JB 1EFRD 2EC6B 4B6FA 5IT5A 1PVOA 1VHLA 1DS6A 4R2HA 3NSIA 1VYTA 4BPBA 3BUWB 1TPZA 1OXVA 4OL0A 5FPKA 4N5XA 1Z0IA 2BEJA 4ICBA 2DHRA 1GOTA 2GBLA 2W6ID 3NIBA 4NYJQ 3ZD6A 1B8CA 3LH5A 1KSHA 2EFEB 1HT2E 2DWPA 1VRKA 3G82C 1D9ZA 2WZQA 2M0RA 1W36C 2BOVA 2WWIA 3K70C 3LO5A 4JLJA 5DYIA 1Y1AA 1DE0A 4I5KA 4CRWB 1SXJB 4P2YB 3OB1B 2ZRAA 3TBKA 3IO3A 1G8GA 1JR3D 2GCOA 1JF0A 4P31A 4PAQA 2WKQA 1S1CA 2IX3A 1TTXA 4GSYA 4JLAA 4Q66C 4TTPA 1W4AA 1LTQA 5AUOB 5JWRA 3VRPA 4IW3B 1KK8C 1Z2AA 2XSZD 4NCKA 1NBMD 1SVSA 1FX0A 2GCNA 2JTZA 1Q20A 1UURA 2OFWA 4QBHA 4ZO4A 1KK1A 2ZREA 2HETA 1CLMA 1YTZC 1AVSA 1YZUA 1II8B 2RHDA 4K81B 4MRPA 3T1TA 3MUFA 5LB2A 4HYYA 3G0HA 5J4VA 2LWIA 4XWOA 2ZXUA 4WA7A 2JPTA 3W6NA 3F8TA 1W5SA 2D06A 4HDCA 5CJ2A 4PTLA 2VL7A 3ZZTA 5D69A 1SCMB 2NO7A 5AFPA 4JLMA 4X8LA 4AIIA 2GEVA 1UHKA 2NZ8A 2ZNEA 2Q9AA 3B60A 2EYQA 1KOFA 2FEOA 1T91A 1CDLA 4OBEA 1RTP1 2CNWD 2IXEA 4V0OA 3VTKA 1W47A 2P5SA 1HA3A 1QVAA 3VAAA 2H1LA 4TLDA 1N5LA 2MMGA 2ZSFA 3OEED 4GOXA 1FL9A 2CL0X 3PG5A 5DYGA 4EPXA 1Y3AA 2AXPA 2O8BA 2JT3A 4AYTA 3Q72A 5HCIA 1Q3TA 4UJ5A 3NSLA 1QLKA 1A82A 2PH1A 3NDPA 3QOFA 3PEYA 3SJAA 2A3RA 3PITA 1XCMA 1KI3A 1U9IC 3R9IA 4US2R 1DO0A 3CZQA 1BU3A 4XSHA 2FA9A 3CWQA 1GL9B 2AFHE 1S3SA 2CHGA 4TYNA 2ZUCA 3SIBA 1QHYA 5DN6D 4TLEA 2GWHA 2N1BA 4LZZA 5FR1A 4DRZA 4OI4A 3UPUA 1XO5A 5EE5B 1G4UR 1KZGB 1DAIA 1SY9A 4NYMQ 3U7GA 4LJ6A 1UP5A 1ZD9A 2ZS7A 3HWSA 4DLZA 5HZKA 1G41A 2QGNA 3HYTA 1YVDA 3Q3JB 1MKYA 4JT4A 3B9QA 4M1KA 4N1AA 2K7DA 2JIZA 2OXRA 5DSZA 2H16A 4DCNA 3BUNB 4GMXA 1TEXA 2JZIA 1YQTA 4DB4A 1NP6A 1BKDR 1Q12A 3CF0A 2JIZD 2PX0A 4FMBB 2JJ1D 4N0DA 2HF8A 2HXSA 2NO1A 1RVDA 1OKKA 1W0JD 1F6BA 4JT2A 5CJPA 4M4SA 1W4CA 4BFXA 3IIMA 2IS1A 4G1UC 3PIRA 3KUDA 2A5GA 2GBLC 4XSGA 2IUUA 4Y0AA 1SVWA 2KFFA 3SOPA 3QQ5A 4CVNA 4CEIA 4GGFC 2FOLA 2QI9C 5KSYA 1DTSA 2JEOA 4NDCA 5HTKA 3DKVA 1AM4D 1ANKA 4OVNF 4GMDA 4ESVA 1Z0FA 4ERNA 3GLIB 5L3RA 3VKWA 1ALVA 3HU2A 2QP9X 4WXRA 3SYNA 5JFGA 1FQKA 2KGBC 3CR4X 2HV8A 4PZYA 2L5XB 2GZHA 2RHMA 5FUXA 4W5HA 3B1XA 4TMTA 3OEEA 2LC5A 2DFKB 2I4IA 2YOGA 1K8UA 2ZE7A 4JKIA 1QJTA 2PJRA 2JDIA 1Z08A 2A7QA 3CR7A 3IEUA 2LVJA 4FXPA 4KFRA 4GFTA 4Q19A 1DO2A 3CUEF 3WNXB 5KUTA 4C7OB 3HX4A 4OHYA 4LV8B 1OQPA 1NG1A 4QHYA 5C2JB 1CRPA 1JF2A 5FL7D 4YXWA 3U3KA 3C7KA 3GEIA 1WDTA 3KJIA 4L5BA 3Q9LA 4DT1A 2V3CC 3I62A 1EX7A 4PE4A 2OEPA 5FBWB 1XZQA 3QIAA 4FQOA 2BMDA 2MSEB 2G9NA 1TADA 1OT3A 1CIPA 2GVZC 3JVVA 2LHLA 2A9KA 4C0JA 1HH4A 2XNDD 3NBYC 3NHBA 4UNNA 1VG9B 2KSQA 3LA6A 1NWDA 1ZACA 5FBRB 4E07A 4LGMA 4I5NB 4HUQB 1Z06A 4MEWA 4P0TA 3A1TA 2ZI4A 3OIVA 4HB4A 4XJKB 4GP7A 3H0KA 1G3RA 1W2GA 2CL7X 2F3RA 2LMVA 3JTDB 4QG7A 2XITA 4Q1EA 1AGRA 3TQFA 2GGMA 2KYFA 2WSSA 4E22A 3O78A 2A78A 3CF6R 1KY2A 2EWVA 5E7JA 3OHMB 3RRNA 1GUAA 1LS1A 2BECA 1U8ZA 4JWQA 2IT1A 4XJXA 3SJBA 4IVQA 3BUOB 4PX9A 4KSCA 2KAYA 2E9SA 4LJ5A 1GJYA 4A4CA 1XX6A 2WOJA 3NBZC 4W5WA 2F9LA 4Q00A 1SVKA 3KZ1E 3IUYA 4PR0A 4LPSA 1AA9A 2CBLA 1AP4A 1V43A 4IFEA 2YHSA 3PSRA 2DYKA 1Z29A 3EZ9A 1A2BA 1II0A 1NN1A 3N5CA 2PCJA 4I4LA 2FE4A 1SRAA 4PC7A 4WZ6A 4E09A 1EGAA 3ONWA 3GLGE 4Q4AB 3WP0A 4AG6A 3OIUA 2IS2A 5F9HA 3F3YA 1XD2A 3B85A 1TNQA 4ORAB 3EWSA 3TGPA 3K9HA 2PBRA 4XH9B 5ER5A 4Q02A 3L0SA 4FMDF 1FQJA 2Q21A 3S1AA 4L16A 3H86A 3AQ4A 2JGNA 5FPHA 3GLGA 1FOEB 3EA0A 2RH5A 1KYIA 4QBGB 3D6TB 4C30A 2ZSDA 2ZJ2A 5G3YA 1CMFA 3NG1A 4G5RA 2A5JA 4NP6A 3NEJA 4NCIA 1B8LA 1SHKA 2WSMA 3BXKA 2FPLA 1MR8A 1NVVR 3T12A 5BXQC 4QOSA 1S26D 3MSEB 1NSTA 3CGAA 3O4YA 2IYYA 2ZRHA 3A1UA 4PHHA 1VKJA 4D4JA 5J3XA 3MJHA 3UXMA 3QG5A 4JS0A 4GI7A 3TNFA 4BQSA 5GJWC 1Z3IX 1E94E 1YZLA 2HJGA 4MYTA 3NHAA 3SEAA 2F1RA 3V4FA 1KO5A 3QVVA 3WYGA 3LVQE 3MLEA 1T6NA 1CNPA 2SASA 2IYQA 2WCBA 2Z83A 4NYIQ 1EL4A 1WCV1 2HCJB 3AVPA 3I92A 5FBLB 4BFWA 1G5TA 3I5XA 1U9IA 3TUJC 4HLDA 3QY0A 4DEYA 2C98A 1US8B 2KJQA 4IOMA 4A0GA 3SG7A 1DELA 1K90D 3TH5A 2Y5IA 5FOVA 1DT7B 4Q47A 4QGGA 3JVTC 3A4UB 2KI6C 1CR4A 2OCBA 3AM1A 3FHOA 3ZS9A 5AUPB 2ZPTX 5JHHB 1KDTA 1H65A 2BCGY 4LC0A 5JJGA 2BM0A 4Q9KA 2AFIE 3P20A 1A29A 4PHMA 4MUBA 1AIPA 1ZAKA 3T5DA 4PZLA 2AR7A 1N6HA 3CX7A 4ORBB 3B1ZA 2I2RE 3QPVA 1NVWQ 1E79D 2VP6A 3RYTC 2R6AA 2BHRA 2D2FA 4YBHB 3I5GC 1YU9A 4R9UC 5FUVA 2IYRA 2WC8A 2W0MA 4DLWA 1CR0A 2WIBA 1K2HA 4MBEA 2WBLC 4DJTA 4KYIB 4BUJA 5F6TA 1KMHA 1E4VA 3LLEA 1WMSA 1MUXA 4AOMA 3IQXA 4CF7A 2YWHA 1OPXA 4KLZA 1M34E 1ELOA 4AYXA 1T9HA 2WORA 3NXAA 2ZROA 2IUSA 2VQSA 1G17A 3KFXA 3SQWA 1ZMZA 5CSFA 4D26A 3VKHA 3VRRA 1R4AA 1C7VA 4XJKA 1E2NA 3VR3A 1KO1A 2FF7A 1GFIA 4RD2A 2FPKA 2P5TB 2OTGC 3SC3A 1KSJA 2QP3A 5FFMA 2K61A 1F2UA 2ISDA 1VIYA 3UIEA 3QXJA 1A5TA 4FMCF 1PALA 1EXMA 1TNXA 3LCPC 2FDCA 1P7CA 4NHOA 3UANA 3WHTB 3VGOA 4LI0A 2ZJZA 4QGHA 3ZH9B 2M1UA 2FMXA 3HPRA 1QS7A 1G18A 3K0CC 3I32A 4LSGA 2VO1A 2J59A 1NL3A 4A92A 4LHVA 1W0KA 1CEEA 1FI5A 2O52A 3OX5A 1VTKA 4IOKA 2PJZA 3DM9B 4TT3D 5IBWA 3QBTA 4TSFA 2M29A 1OYYA 1Q57A 1Z6XA 4D82A
chains in the Genus database with same CATH superfamily
1MC5A 2OFFA 4R3NA 3TCKA 2R1ZA 3EXG1 3MG9A 3SZUA 3VTAA 3NOVA 1NI4B 3PNSA 3Q10A 3DS8A 4JJ6A 3O7WA 1D6NA 1N6NA 1LPPA 1PNOA 1OX4B 2OHXA 2ON6A 3CLUC 1JPNA 8LDHA 4MWBA 5EIXA 3P52A 2OCIA 1IM5A 4G1BA 1RRMA 2ZAOA 3FNBA 4ZVLA 3UWPA 4KACA 3UJBA 3I1FA 5E6RA 3OTWA 3NKVA 2CNPA 3AWIA 2ZBVA 2LR0A 1OLXB 3Q7IA 2VS1A 3H84A 3FPEA 3CRNA 4KO1S 1JLSA 4IDQA 2AZDA 4PXYA 4Z8YA 1MH1A 3CCFA 3WV5A 3IUPA 2C42A 4IOJA 4YMSA 1LTKA 3EB9A 3MGBA 2Q4RA 5L4LA 2YWCA 2G6BA 4K9NA 1SO8A 1XQVA 2FU5C 4RD4A 3NHYA 4QQRA 3TZKA 3GJ5A 4MKRA 2EDCA 5MN4A 3LKBA 2YZKA 5I3ZA 2R6JA 2BFMA 3GRZA 1KI6A 4TWRA 5TGDA 1O9BA 2WQZA 5FX2A 2Z6AA 2JLQA 2VVTA 5CFRA 1YVPA 1PL0A 3D4LA 3BZBA 4QTUB 4F8JA 1M63B 2AUCA 2PRYA 3FPAA 4B0OA 3H4IA 5KAPA 1NNEA 4ND7A 3UJDA 3EXIB 5TDHA 2XF8A 1VG0B 2ZS9A 4WLUA 3C15C 2C7RA 1ORGA 2I5PO 3P26A 1OC2A 4PRZA 4Y0VA 3ER9A 3OTIA 3ONDA 4GH5A 4AJ1A 1LPBB 3TPCA 4M1SA 3QV2A 1CR1A 1MJNA 4HB2A 4ETWA 1XZLA 3EIUA 3NXSA 4OQNA 5B57C 3LFHA 3EZGA 1J99A 4JEHA 5JZBA 2W8BA 2ZB8A 4IHKA 3K9FC 3BDAA 1DAKA 5FPPA 1OH5A 1A1VA 2FG5A 3T6KA 1U2QA 4F8EA 4C0HA 1H42A 3C16C 3AUXA 4TYQA 4M9RA 2XOKA 3L4LA 4OI2A 1DEHA 2LANA 3KT8A 3GZNB 3Q7EA 4UNSA 4ZOLB 2XGJA 3WHKA 2HPSA 1JIXA 5JVDA 3TB4A 3TZHA 1RNLA 1LC3A 3PRHA 5HYDA 5TGTA 1XYGA 3CUWA 1GCUA 1BW9B 1ZUHA 3CGWA 4MRMB 4JYMA 2HQSA 3B7PA 3Q87B 4O6VA 5EMMA 2PIDA 4YMLA 1SZCA 1GTMA 2ODQA 2FH5B 5I9NA 4JVMA 2AW3A 3PP8A 3R7NA 1X7GA 1F2TA 4LYJA 2DFPA 1P1FA 4KFUA 5L4NA 5T4EA 4QQNA 5HLVA 3EVUA 4IIYA 3UB4A 1ZG3A 1CDZA 5COBA 1CM1A 4I8DA 1U1FA 2CKMA 3DYBA 1RFJA 4R7GA 3VPHA 2MLEC 5KKNB 2JKYA 2V7QD 1UAAA 1CU1A 1JE1A 3HO6A 3EWNA 3WK7A 1J1ZA 1NYTA 2CJYA 5DXFA 2AN9A 1KVSA 1XXHA 2QTAA 3CT6A 2W2LA 3S2ZA 2C61A 4CDMA 4OYLA 2H5LA 3Q98A 2PMWB 1BEEA 2EJTA 5AWFC 1N5KA 4DA6A 2BM1A 2C9MA 3DXFA 3LVRE 3R6WA 3U81A 3U61B 2PKQP 3BFKA 3K9WA 2B1QA 4YCMA 4F04A 3QVGA 4HNTA 1PR4A 1SD2A 4AO7A 4IDBA 2HQBA 2NO0A 2A5YB 4UASA 3VRQA 4YCDA 2YY5A 5DBGA 4YI5A 3ZEIA 4CKZA 3U19A 1K63A 3QOWA 3LNTA 1IFXA 4I9NA 3P9KA 4WJKB 2AZMA 3DONA 1JDNA 2X5KO 5TNCA 1AZSC 1SBHA 4RHTA 1QFJA 2BR4A 2CTNA 5AW4A 3CEMA 3HLYA 2V7GA 4KE6A 3S55A 3VZPA 3DY9A 3WLNA 5AM3A 5DGHA 1B26A 5T3UA 4NBTA 1UJ4A 3K6SB 1EZZA 2NP7A 1DKUA 1EVEA 3GXOA 4C43A 2M9GA 3CLTD 4J1TC 1YTLA 4HAVA 2EERA 5AK0A 4E1AA 5EJEA 2O8FA 3BMCB 4HEA6 2A14A 5DLDA 1Z7BA 4K9DA 4J6EA 3DPSA 2AFRA 3NHPA 2QEOA 4FOTA 4CLRB 4IDCA 1K3FA 1VB5A 4Y9SA 5F23A 1VDZA 3QBJA 2BZ1A 3E3AA 4FZRA 4LHZA 3PLAE 3CFYA 1C1XA 4HGYA 5JO9A 5K3CA 2Z2YA 1P4RA 3PVSA 3LT2A 2MYNA 4PQRA 1ODFA 5GP1A 4FNAA 1SQSA 721PA 4GL4A 2BMJA 1DBVO 4H6XA 1A8QA 3RO7A 1FW4A 3G2IA 3VOTA 3V97A 3H2HA 2CEKA 3CC8A 3EIFA 4LK3A 4UTVA 2IY8A 2WYHA 3BGSA 1XRRA 2J0UA 5E9QA 4YQEA 3UAOA 2F1HA 2DPYA 1XC7A 3GT0A 1SOWA 2Z09A 2XYRA 1KI4A 3RV3A 4NDDA 4ZJZA 1P1IA 5JZOA 4GO1A 5C8YF 4RSRA 2NM0A 4NU5A 1IBKB 3AJEA 2GLXA 4QXMA 3S68A 4PAWA 2QTVB 4PFKA 4ND3A 4N01A 3A4NA 3ZG6A 2HCRA 1Q50A 1CEYA 3DXXA 2GN2A 3HVJA 1CXZA 1L8QA 2YWJA 4GLOA 5ES4B 3OKCA 3QEMB 4K6GA 3IXLA 2WWFA 2IKSA 1TVMA 2V1UA 4IXDA 5IAJA 1LJ8A 4QL3A 4FGUA 4JDPA 2ZU0C 2OT3B 4JBIA 4OQDA 4PZPA 4KJXA 3K0EA 3NETA 4HZUB 1Q83A 1PWZA 4JKOA 4X7RA 4D79A 2AFHA 1YUNA 4BJ1A 1DHRA 1T35A 2UAGA 3NC4A 4BEJA 3KK0A 1DI0A 4MVFA 1KDRA 1E5TA 3BOWB 4OCZA 2B5VA 1WNTA 2C29D 2D3TA 2G71A 3L6DA 4RZ2A 3PALA 4HDNB 1CLLA 4MAMA 5EVJA 3LT5A 1SOAA 4L8YA 3B1YA 4HUJA 4IIDA 4AFNA 3NPMA 2E87A 3KXDA 3UZUA 5CEEA 4KHPB 2X7HA 1ZCAA 3GK3A 2CLLB 4RQBA 4X1OA 4WXPA 3V8NA 3UPTA 1OB5A 3R0ZA 4NEHB 2VZEA 1T5BA 3RTAA 3TZBA 2P77A 2UYYA 3A6KA 3G1WA 3GPCA 5DI9A 3DWFA 4REQA 1JI0A 3LAWA 4FEYA 2RH8A 4FYYA 3R76A 4GUKA 3U7QA 1KZ1A 4QBKA 2YY6A 1TA0A 1L5WA 1I9GA 2UZ3A 2UYCA 3RHFA 1EK6A 4MMYB 5CA1F 1D2HA 1MX9A 3CPSA 3FWKA 1N7JA 3OPVA 2R9VA 3B89A 1JB1A 4GOND 2IU4A 4BLQA 4KO8A 5DCWA 1N2CE 4UMEA 3IGFA 4IJUA 3ND8A 3IKTA 4LRYA 4WVFA 1H93A 1BQ3A 1GHTA 1EQAA 2UZ4A 1XWFA 3QVOA 4ZCIA 2UUPA 4GLLA 4Y6SA 2F3ZA 1SBQA 2OXFA 1AKUA 1H5NA 3H9CA 2QLFA 2WU3A 1M2JA 2VHCA 5D2CA 3MS2A 3SFVA 3OQJA 4Y2JA 1EWTA 1HETA 2OILA 2O2CA 1T1SA 2R62A 3NVDA 4JOQA 1I24A 1JV2B 4KV7A 4CUZA 5LYJF 2OYCA 4AI6A 2P9HA 1TOAA 4R1LA 2YZGA 1RYBA 3M1YA 3X43A 5CG1A 3UYLA 5E9JA 2JFPA 1ZICA 2X4GA 3PL5A 5E4YA 4BMYA 4RK6A 4WZBE 3ZVMA 2QNRA 3BFAA 2C3MA 1G3UA 1R7RA 2GGSA 4EUKA 1FBVA 3K1YA 2XA9A 4YBRA 4LXIA 1AO3A 3LUDA 5CT6A 4YHBA 1WTCA 4K40A 1GZ5A 4EQ6A 3D78A 2D1QA 2GJ4A 3JQAA 2JKZA 1GQQA 5EJ6A 2O6LA 4S0XA 2EU8A 3LW8A 1NMYA 4CR6A 1ZNYA 3X2EA 1OGJA 1M2OB 3OFKA 2DHEA 4GYWA 4N5MA 1Y7HA 2NCOA 2FPGA 5EWLB 2EGUA 5BSEA 4CEJA 1L7MA 1JDTA 5CAEB 1SU4A 2UZ1A 1JKFA 3LHIA 1I6LA 2B9VA 4TGLA 4WLEA 2YV4A 3GWZA 2GVDC 3U3XA 4PVCA 4EFKA 3KQKA 1I4OA 3RK1A 5DNUA 1KO4A 2KQUA 3WL6A 1PEKE 3RWMB 3BA6A 3HV2A 2VDWB 1WLYA 4Q21A 4ESOA 3BMQB 1NQTA 2X8BA 4K7JA 4I4IA 4B3JA 4X92A 2NU6A 3K1EA 3H7IA 2GM4A 3N7TA 3E9MA 3B3FA 4RH0A 2A5FA 1N78A 5H3LA 4B0PA 5KX5B 3MWLA 3ZDXB 2DTEA 2POCA 4Y2RA 3K9QO 2EBFX 4Q1VA 1N2BA 1CUWA 3QFCA 3G5AA 4YXFA 1WDWB 2D8MA 1EM8B 1XELA 3ITEA 2HMSA 4RL6A 5JU6A 4OMFG 5LYJA 4KRGA 3DKIA 1T4BA 4FD2A 4DC9A 1M0EA 4EO4A 4JR2A 4N6OA 3WHUB 1BKSB 5IEBA 2RE8A 3AUFA 3BWBA 3HB4X 3LCVB 5K0TA 3KYCB 1ZAYA 2OBLA 2O7RA 1BC5A 1DC4A 1JQJC 2J7PD 3BRWA 4U2BA 1BMFA 1W85B 2N47A 3SDSA 4UBLA 3UJAA 1GDTA 1JSLA 3J7TA 4C6TB 4ZREA 3KEGA 3HP4A 4B7UA 3P0JA 1JFLA 4HK4A 1E7RA 4MI9A 5EEGA 2M97A 3NWBA 5JD3A 4TVKA 1RRPA 1CJMA 2HPVA 3PEFA 2WVHA 4OQMA 2KQ6A 2F3PA 1WQ1R 2ZJ7A 5SY9A 3RBVA 4D96A 1XQ6A 4N8EA 2DOKA 5FHQA 3CKYA 3OURA 3WLSA 5LZ8A 1C50A 2IY9A 5EPOA 2H9IA 5ERGB 1YC2A 5BSGA 5E6UB 4Q4LA 1BMQA 5EIWA 3SJSA 3ZXYA 1NP3A 2ATVA 2BGKA 2NADA 2YINC 1YCFA 3LNCA 6GPBA 3EQ7A 3PM8A 2BCAA 3TMAA 4BKRA 5JLJA 3TF5A 3ROGA 1DIGA 1RJVA 1GLVA 2BFNA 2XNDA 3LHSA 3GRUA 1JTFA 1C4WA 4PBRA 3UJCA 1A9XA 5DHAA 1PBNA 5BSWA 3EDMA 5I4KA 2H06A 2LV7A 2JC3A 3LQ1A 2HLDA 3MHPA 4H2DA 1B43A 1QHXA 1WKVA 2GZAA 2Q1YA 3ENWA 2P35A 4A2CA 1SD1A 4G01B 3BOWA 3LZDA 4YAJA 2P2YA 2V4MA 4E2FA 4C7OB 2C9ZA 2ZI3A 4A10A 4JT8A 2COEA 2B83A 3C5EA 2G88A 4B35A 4NL4H 3IDFA 4PYIA 1JWDA 2IXTA 3EGXB 1N5MA 2W2VA 5EUCA 4Z4QA 1Q3KA 3GA7A 2HWUA 2PXXA 1UUFA 3OT1B 1PFQA 1NURA 2PUWA 4HAXA 3RU3A 1GAJA 4D7AA 3U7QB 1K95A 4ETMA 4LF4B 2NQTA 5CLGA 5JDCC 1RJWA 3DTNA 9GPBA 4COOA 5I7SA 1W49A 4FE3A 4NV0A 2VXCA 3GVXA 4P3KA 4L5CA 3QKWA 4KNYA 4IJVA 3VNBA 3FUTA 1GG9A 3B6EA 1RMQA 4HREE 4MGHA 4W6QA 2NU9B 3I76A 1HRKA 4Q7JB 2J5QA 2Q4TA 4QUEA 4YP0A 2FOIA 2IVZA 1FP1D 4PN3A 1EUDB 1N5IA 4RBNA 4HAYA 1AU9A 1IN8A 4TX1A 3BWDD 3UK7A 4N48A 1CIJA 2JJQA 1LLCA 2W6PA 1Y48E 1HFJA 2JZNA 3B1FA 3PXUA 4KXFB 2X19A 3UGTA 2QBYB 1CVRA 1DBQA 3OJLA 3N1UA 4W7SA 2XB9A 5DBHX 4QUBA 3W6PA 4BTLA 4LX8A 3VR1A 2JJMA 2JGAA 3ITKA 4GYJA 4U02A 1N2GA 2GSDA 2CBZA 1EIWA 3A31A 2IGBA 1ZRMA 4LX0A 2NXNA 3B1KA 4QYIB 2WWYA 4XEUA 4J75A 1IRJA 1E3WB 2X8JA 3DMNA 3RIYA 4YO8A 5G40A 4D80A 4D41A 1DKMA 1C9DB 4ZVKA 1B2LA 4FLMA 4YACA 2QM8A 1E9SA 1YO6A 3OECA 5TS2A 1EFDN 4YT5A 5EUQB 1V3QE 4BC1A 4DWWA 2Q9BA 4KNWA 4LEIA 5FOUA 5HG0A 3JD1A 2B5WA 2A92A 4PLYA 4CKBA 3HUDA 4R7TA 3MTGA 4J2OA 4F2GA 2XCRB 1GL6A 2PO7A 5CA0F 1HQCA 1YVHA 1SG6A 3IP8A 1PSBA 1D1QA 2H61C 1QIEA 4D8VA 4B47A 2P4QA 3MA0A 5CH3A 1WRKA 4P0QB 5E3HA 3AK4A 3PC7A 4NCBA 2DVMA 1FJXA 3FSEA 1ZW1A 121PA 2R6FA 3H11A 3H97A 3QA9A 1XGKA 2IYPA 5F1KA 5BMOA 3M9LA 1DPFA 3CH5A 1FF1A 2F2PA 3O3NB 4EG8A 3VYTB 1QGZA 5C32A 4YCLA 1PULA 5IVPA 3VU3A 3FVVA 3RUCA 4IDFA 1G4YR 1B6GA 2HCTA 2IYOA 3AF2A 3VC1A 4IKOA 1QIJA 4P22A 1ZC4A 3MWYW 5KNBA 1P7ZA 4DVJA 1PEYA 4YI8A 1B7GO 3MZ0A 4ND2A 1EH5A 1ONSA 4I5EA 1PZMA 3OPYI 4R54A 2C04A 3QY9A 3A6LA 3TB6A 4ZVPA 1Y6FA 4ZYYA 3JQ6A 4R9NA 2WYOA 4F4CA 4YJFA 2ZJOA 3ME5A 2WCHA 3GJ3A 3BEOA 3W2GA 1M34B 2WU4A 4LYGA 1W30A 2PRUA 3FTDA 4OFZA 3CF4A 1F51E 5JTUA 2AMIA 2CF6A 4JK3A 3B6XA 1W4ZA 1LWOA 1YTUA 5J4LA 1DJYA 1XALA 4UU0A 4GYKA 4L74A 1P29A 4ER3A 3HYLA 1C7EA 2EG9A 5BVGA 3QE3A 3PT5A 4GEGA 1J1EA 1JDSA 4L0CA 5NULA 3UT5B 4EECA 5K0GA 3FPBA 3EXHA 1USUA 3UOWA 2C4VA 1G60A 1Z8DA 3FRHA 4FYMA 4K3VA 3WRXA 2BMEA 1GGJA 1L7VC 3BERA 2IPLA 5HX7A 4PO9A 3V3KA 4H7DA 1L8OA 2IV7A 3D4NA 3FDJA 3LLCA 3RBXA 7REQB 3DV0B 2JBAA 2GRJA 3P9CA 1RECA 1YJQA 2FR8A 1KU6A 2R5WA 4RQTA 1JKJA 5DHPA 2O2IA 3GRYA 3WIOA 1KETA 2GJ9A 3UB3A 4CM6A 3U44B 2M6LA 2LZ0A 3EVCA 5IXJA 1VSBA 3TTYA 5TQVA 2ZWAA 4C1NA 5CU7A 3F6SA 3NKLA 1H9AA 3U1VA 4UAJA 4BFSA 4LXHA 1CUBA 4E94A 1P1HA 1NGSA 1W8IA 2V03A 2V45A 2FLWA 3OSUA 4W9RA 3I4CA 5JCOA 1ZVVA 2GEKA 3RSQA 4KQ6A 1U90A 3G5LA 5BV0A 3PNQA 4UQPA 2PVBA 3TQCA 2O14A 5EMJA 1SAYA 3CDNA 4IH9A 5FA8A 2DH5A 3GLFA 1JHPA 3AUKA 2YUTA 4JC8A 3RWBA 3G85A 3BTUA 3O4JA 5SZIA 4QVKA 2RGCA 2BGNA 2GEDA 4TS9A 1AZLA 1E3DA 1P0QA 3DBLA 3O1JC 1DJOA 1UBTS 3B8EA 4JIGA 4L4UA 1T2UA 3LT0A 1AQYA 4HWOA 4LOLA 3NVKI 4NDAA 2VTKA 2YXBA 1FMTA 4CEIB 1LVCD 1K9SA 1NPDA 5BOSB 4WTOA 2YX1A 2HT6A 4Y2XA 1DOZA 3OY7A 2JFYA 4XOUA 2PS1A 5EIHA 3PD7A 4C4ZA 4F5ZA 4CEJB 3GEHA 1SUIA 3S0FA 1M72A 1N0HA 4I1UA 4BKPA 3KOUA 2DZDA 2V6FA 2QM7A 2RGDA 5JH7F 5CSJA 4CQNA 2GAJA 3QFFA 1TIBA 3DD4A 2KI5A 1QMGA 3ELBA 3SS9X 3FZQA 2AAOA 3I0NA 4HNSA 3TQQA 1I2DA 4DCTA 1Z4MA 3AHHA 2DP4E 2PVSA 4G9EA 2BGJA 3A6EA 2R8XA 1RKQA 1E3JA 3BB3A 1FQOA 5IXYA 1WCYA 4U5XA 1VLJA 2LE0A 5HLOA 4HRXA 1KK0A 1ESCA 3OZVA 4RGBA 3A9TA 4Q3NA 1WNFA 5FOWA 1YASA 4CCWA 2Q50A 1M9NA 2PTHA 4AKTA 4R2WA 5LYJB 4MS3A 1V25A 2QG6A 3ZI4A 3DFZA 1OYOA 1YD7A 4RVOA 4C7MA 5AI9A 1PR9A 3E9CA 2H1HA 4JT9A 5FI6A 4EHNA 4RD1A 2QD5A 3FAZA 4I4CA 3WB2A 1EVYA 3AO0B 5TB5A 1Q1AA 3QELB 3WLEA 3FOFC 5KAMA 5THKA 1EFKA 1F1BA 2FWMX 5C4GB 3DZGA 3MHTA 4OV2A 5BUZA 4B6OA 1TYEB 1G291 2A9FA 4EHAA 3QVUA 3PCRB 4BY4A 3T3GA 2ZIFA 5CPFA 2O5CA 3VVLA 5JAUA 4JXXA 1KMHB 1OSNA 3RF6A 4AN4A 4YRAA 3KAKA 3TXYA 3H1GA 4KIGA 2F62A 4O1IA 4YJGB 3RSLA 4EA8A 1U0TA 4X45A 1IATA 3O9MA 4NU0A 1V8DA 3FG9A 3KDAA 5E38A 3BFVA 2IU0A 2WFZA 1GKIA 1EJ6A 4RD0A 4BVLA 4EQZA 4B3MB 3D77A 1E9CA 2BE9A 4RKQA 3HE3A 2G9RA 3U5TA 3I01A 2HL6A 2LVBA 5BN1A 3CSDA 3QWIA 5A05A 5FADA 4YLYA 4ZXPA 3VDMA 4NK5A 3HKBB 3CRMA 3PPVA 4RDXA 1HDXA 2WHPB 1CERA 3N2KA 4KL8S 4TN1A 4AF7A 5AVYA 1OVGA 4BY9E 3QH4A 1L2TA 1E3SA 5D3OA 1ALWA 2ZUDA 1M1ZA 3MELA 1MPXA 3OWXA 1POWA 3TE6A 2CXPA 3ON5A 1D1OA 3OE7D 3QPUA 4OM7A 4Y1FA 4F3KA 1YQDA 3SHFA 1PKXA 5MGBA 3EG9A 2WYVA 3OQ6A 3PJFA 3KOMA 4MITA 1Q1GA 1RI5A 1TVKA 4OFBA 4E2WA 4KQ2A 1KQNA 2X0FA 3HU3A 3FE6A 3TXAA 2QL6A 4A7PA 3SR0A 4YT8A 5IS2A 3MF4A 2VT3A 4YGXB 1EVQA 1B1CA 3O0TA 5F5NA 2W4MA 1RZUA 3D4IA 2BP7B 3OP1A 2G82A 1Z73A 2ZS8A 1U65A 3GVPA 3NT4A 2G83A 3I39X 2QN8A 1EGHA 1OPRA 2O5VA 4GR5A 4JL6A 4PZAA 3R4VA 4RZQA 5I45A 3KAPA 3HCBA 1U5BA 4V0OA 1IN4A 4MRRA 3BSSA 4FN5A 1WBJB 2QAGC 1ZIOA 3AU9A 1FYXA 4K9OA 2PNJA 4OX9Y 3GYGA 4GLJA 1LY1A 4UHKA 4DCPA 2I94A 1N8TA 1W0CA 4O02B 4EWLA 1O9HA 2JBAB 3FKSD 3MFQA 4DM7A 1GG2A 4BMDA 3MOIA 2ZBPA 5I9MA 3HKEB 4Q48A 3JAKA 4ZGWA 3NIFB 4L6IA 5KTKA 2Z5FA 1STOA 5JSKA 4LMAA 2BCEA 4XD7A 1Z07A 2W98A 4L4SA 1QRRA 4ZCSA 4AQIA 1ACJA 2DE0X 2V1XA 1ZH4A 2UVQA 5TPWB 5TMBA 4BPRA 4DB2A 4KSYA 2A5LA 1W59A 2ONKA 1RQNA 3EQ9A 3LTEA 3EODA 3CYZA 4BZXA 1EQ2A 3UMMA 3OBBA 1KDZA 4JNKA 4ITUA 2XKKA 1L5SA 4J9VA 2LE9B 3EHDA 4KTTE 2XCIA 1LLQA 1HFWA 3I8XA 4JCOA 2BJVA 3JARA 5ALRA 5IWAB 4EY6A 1FP6A 2GPTA 2XDWA 4CLEA 3LVFO 1VLVA 1FYFA 4F97A 1COWA 4FOOA 4OKNA 4URZR 3TLZA 4IH4A 2NAFA 3FHCB 5CR9A 3WK9A 1FSZA 2EWMA 2PZEA 3H9GA 3ZUPA 4Q1FA 4ZMSA 4M1OA 1IC6A 4LNUA 1T14A 3I72A 1SOMA 1D0VA 1BHSA 3L1HA 4J7CA 3RFXA 4DYHA 4EF4A 1SUAA 1Q1QA 4MYRA 5J47A 1DT3A 2H9YA 4LXXA 2LUXA 3ESZA 3QYPA 4YN3A 4IHJA 1EBBA 2VAVA 1J21A 4OZDA 1T1EA 5ULLA 3RRXA 1J7JA 4AC9A 4B31A 3N58A 1HDZA 1R9GA 1NNSA 2CVPA 2JIMA 4F1KA 5A4MS 3LRTA 1UMDB 1I33A 1QKIA 2WD8A 4FP9A 4BBPA 3V48A 4EDHA 5M7EA 4M53A 4PYRA 5DN6A 4EVIA 1JQBA 1ITZA 2QUAA 1SVLA 2L69A 3BZUA 3ZCTA 3FA2A 4NATA 2ZSKA 5IPFA 1F2UB 2YJGA 4DV5B 3RK0A 3S2FA 1P6QA 2H8KA 1CRWG 1RM3A 2RK6A 2ZRBA 3TLEA 2ASEA 4YP7A 3GHHA 4CHTA 4QJ4B 4PLWA 3JW8A 1HM5A 3UAZA 3DLCA 3DZIA 3H8JA 4BN5A 5DX8A 3QMMA 2QAGB 1PZEA 1L7PA 2AJDA 2J6HA 2WLSA 4X8OA 2O20A 2VZ9A 1IL0A 1G2OA 4GLFA 4MINA 4EARA 4CZ2A 1RRVA 1U0RA 2H29A 2JHAA 5CW2A 621PA 3FNFA 3R77A 5KNDA 3R6GA 2C7OA 2R1VB 4MZDA 1P2FA 2Y1CA 2OP1A 3AM5A 5CX1A 4ZQGA 6PFKA 4LJKA 4GNKB 1W9HA 1BH2A 3NTUA 2AYXA 3WLQA 1SIUA 3KWJA 1VXOA 1WL8A 2XDQA 2BISA 3KAQA 5IAOA 1QE0A 5GWXA 1Z4KA 1IN1A 3PTZA 4HQ0A 1QXPA 5CVVA 5JCOC 1DRWA 1T2VA 2F1KA 1SZPA 3A4VA 3LQYA 3GBPA 4GM4A 1JC2A 5FKJA 2VG8A 1S02A 2E48A 3V4OA 3ETNA 4E5MA 3PWZA 2IXFA 1MB4A 5JJIA 4NV1A 4XDHA 2P2NA 3CINA 3OHPA 3Q5DA 4PANA 1CPYA 4KKXB 4LBZA 4PFSA 1AXGA 2CNDA 2NO9A 1ONOA 3DE1X 1KKLA 4M55A 4E51A 1ISJA 3IMFA 4BQFA 1I10A 3NJ8A 4MQFA 1ZCJA 5I4IA