4C29A

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
PLHDFCRSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 70
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4c29A00
3TW0A 4DMUB 2ADFA 5E6RB 1ZOOA 1M2OA 4UM9D 2VDQB 4WK2B 4C2BA 2I91A 1M1XB 1PT6A 3VI3B 4FX5A 1XUOA 2ODQA 1DZIA 3HI6A 3K6SA 1JEQA 1BHQ1 2VDPB 4CN9A 1JV2B 1V7PC 2NVOA 2I6SA 4HQFA 4A0QA 1L5GB 3EH2A 4G1EB 1SHUX 1SQ0A 3QA3E 4M76B 5E6UA 3V4PB 3EFOB 1AUQA 2QTVA 5HJ2A 5KYYB 1MQ8B 4HQOA 3E2MA 3HXQA 3N2NA 3NIGB 2ICAA 3ZDZB 4MMXB 2VDKB 3IJEB 1PD0A 3PPWA 3RAGA 4WJKB 3ZE1B 3NIDB 5LN1A 2WINI 1AO3A 2XGGA 4Z7NB 4WK4B 4HQNA 2M32A 2ODPA 5ES4B 4JDUA 1JEYB 1AOXA 4BJ3A 3FCUB 3PPXA 4F1KA 1YVRA 1IDN1 4UM8B 1ATZA 1N9ZA 5KYUA 1M2VB 4XW2A 1JEQB 4IXDA 2NUTB 4NENB 5HGJA 1IJKA 1FE8A 3EGXA 5E6SB 5E6SA 1RTKA 3NIFB 1ZONA 2VC2B 1LFAA 2NUPB 2NUPA 5HDBB 2VDMB 1JLMA 1IJBA 1RD4A 5KYNA 3BN3A 2VDRB 4UM9B 3IBSA 3EH1A 2NUTA 3TXAA 1PCXA 5E6UB 4CN8A 1N3YA 4IGIA 1T6BY 2XWJI 3EOAI 2XWBF 3HXOA 3F78A 1U0OC 1U8CB 3EOBI 3BQNB 3EG9A 3K71B 3F74A 1QC5B 1QC5A 1Q0PA 3T3MB 1RRKA 4NEHB 1IDOA 1TYEB 3BQMB 4Z7QB 3ZDXB 3Q3GE 1OAKA 4Z7OB 4HQLA 2I6QA 2WW8A 4PN7A 4WK0B 1YVPA 1MQAA 1NA5A 3ZDYB 1T0PA 4NENA 4F1JA 3K72B 4G1MB 3EFOA 5BV8A 2VDOB 1RS0A 5KYYA 1MHPA 4IHKA 3PPYA 3TVYA 3EGXB 4MMZB 3TCXB 3V4VB 1U0NA 1MF7A 1SHTX 3VI4B 3EGDB 5KYXA 3EGDA 4C2AA 5KYXB 1UEXC 2O7NA 5KYWA 2VDNB 3K6SB 3T3PB 5E6RA 1QCYA 4MMYB 3ZE2B 3FCSB 2B2XA 4CNBA 3ZQKA 2IUEA 3EG9B 1BHO1 5KYWB 1CK4A 1M1UA 2VDLB 1XDDA 2X5NA 5KYUB 4HQKA 1M2VA 1M10A 3PPVA 1JEYA 1MQ9A 3M6FA 4C29A 3ZE0B 1PD1A 1MJNA 1CQPA 3GXBA 1XDGA 4WFQA 4O02B 1FNSA 1DGQA 1ZOPA
chains in the Genus database with same CATH superfamily
1GKLA 4PPNA 5HOQA 3I5MA 1YXMA 1FXUA 1QXSA 2BV3A 1KS9A 1Y63A 5EIBC 1Z0KA 1Z13A 2P5UA 1Y80A 1T2NA 4OQXA 4INAA 1K89A 3FYCA 2SECE 3KOZA 1E6UA 3ZS8A 3CF0A 4LX8A 2CXRA 1PUIA 2GM3A 4UFNA 4XUCA 5E7IA 4ARZB 4YCNA 3I61A 2QORA 5CTJA 5IKOA 3KVYA 3UQYS 4F4UA 1AKUA 1B0UA 4A82A 3OE5A 4YJFA 1IM8A 2CGEA 1TJYA 1VMIA 3GHYA 1LC0A 3OZTA 2FLWA 1B43A 5I7AA 2R1VB 5CT8A 1U3VA 2PGDA 1Q0ZA 1T5DX 4YY3B 3PD1A 3HYRA 2YH2A 4WA7A 1W1UA 3F5DA 4GWLA 1HRKA 4J0CA 3K4PA 3RRYA 4DV7B 4EMTA 3STVA 5I48A 5BUCA 2O2JA 2ATIA 4MA5A 5DLDA 3OU7A 2IS1A 1P8JA 2FFRA 4Y6RA 5JCJD 2OQRA 2W2NA 1QVVA 4DG9A 1E1DA 1JECA 4GZMA 4JBXA 1A5AB 3GI1A 3NVAA 1RHMA 4ZI7B 1NNSA 4H4DA 1HM5A 5KVCA 1B6SA 2I7XA 1PE0A 5C35A 3MA0A 4KQ6A 1OTXA 4ZI5A 4HDRB 4ZD6A 1W5EA 5FI0B 1TQ6A 4DLNA 1N4DA 2MDTA 2RJNA 3D8HA 2ZK7A 4PSDA 4ZVMA 4F92B 1DHTA 2ILTA 3DB1A 1GL9B 3MT0A 2H92A 2PIAA 1FSFA 2ZIEA 2ZTMA 4H3KB 1C50A 2P2CA 3GRYA 2XOXA 1AXEA 1V5GA 3OM1A 3ZLUA 4MITA 4XD7A 3P26A 3AQIA 4PLZA 4KX5A 2IWRA 5U9CA 3WLIA 2BGNA 1TC2A 3O95A 2HA7A 1WP4A 3BMNA 3ZCQA 4P80A 4R01A 2EZ9A 4B84A 3P2JA 1O9HA 1YQGA 3OAAD 5HBGA 3PNSA 5KNBH 1Y5IA 4LNUA 1E79A 3IIIA 4G41A 1O5IA 1OSNA 1SG0A 1Z5VA 3P96A 5HW0A 1EJ0A 5DYGA 3SLGA 2AG8A 3RS8A 1JDNA 2QROA 2QN9A 3COZA 1GUDA 3E15A 4LSZA 1VGQA 3PDIA 3VOAA 3VR2D 3FB4A 5JTTA 3SC2A 3IEUA 1V8PA 1YCDA 2IH5A 4E5YA 2JLRA 2Y68A 3OLYA 1GCAA 1QHIA 1YJQA 1ZBDA 3KV1A 4JR2A 1RZVA 4TSFD 5BV0A 1DXYA 4Z86A 4IYRA 3E7DA 1ULTA 3E84A 1K5PA 2FSVA 2B35A 3LG2A 4TMYA 5DGHA 3KWFA 4RFSA 3GLSA 3QYAA 3HM9A 2FEWB 1W9HA 1KSHA 1OGYA 3NANA 3UFXA 1SPBS 5FB3A 1DEHA 3N2IA 4EKNB 2GK6A 2BGJA 3N59A 1SU6A 5A04A 4QFDA 2WZCA 3QKWA 2LPMA 3M3DA 3TAHA 2YZGA 5FTKA 2QI9C 2OZLB 2PWZA 3R4VA 3RVRA 3T5DA 2YHUA 3HLYA 3TVTA 4ZV4A 5IJWA 3D8BA 3AFMA 1AHHA 1B8VA 2NSDA 1NVBA 2ZFUA 2XQKA 3BCUA 4UQPA 2PJDA 5AI6A 4ZJUA 1ODLA 1TW2A 1X7ZB 2FPUA 5ECWA 3GBSA 4JYCA 4ED9A 3QJGA 3E7XA 4LX0A 2BW0A 3OOSA 1ZITA 2VRNA 2WQZA 3LDFA 4CLXA 3DSRA 5A02A 1RFGE 3WKEA 1BMFA 3A3NA 2QAGA 4EKEA 3KT6A 2WWYA 1CDDA 1PWZA 3SQLA 1ZL2A 3AERB 4FDAA 3TOVA 3OMXA 2O5RA 2VYVD 5LDGA 4AYXA 4FZ5A 3VKUA 2R751 1M1XB 5BNTA 1BA2A 3HKBB 3O7MA 4IIUA 3FNQA 2YBEA 4JKYA 2XLBA 3GGDA 3UFBA 2RHWA 4DIDA 4DM3A 5IZCC 2GHQA 1B1AA 1KI2A 1JG1A 3OTGA 3U4MA 5FPQA 4GKJB 4BP3A 1PVOA 1XRRA 1NVFA 4TLBA 5JC1A 5IFKA 1U31A 3L7MA 1MG5A 4IVPA 4U6NA 2H2WA 3CF4G 5SZHB 1KEZA 3RYTC 1PUXA 3GEEA 1W2WB 3CKYA 3JVVA 1DFIA 1X19A 2Q21A 4OJQA 1Z0ZA 2IGBA 2JNWA 4O2RA 3VX3A 3U9SA 4YUYA 1N2HA 5BT9A 2IS2A 3IC5A 1Z74A 1ZXBA 1G7TA 5JWOA 3ZU6A 4MR8A 4WOBA 4LRTB 1LSUA 3DEFA 4HDKB 2A4KA 5I9BA 3V9AA 2ZYHA 3DTVA 2CLCX 4KO1S 4BMSA 1ZN9A 4R9VA 1R0CA 4IXTA 3NTVA 1KDYA 1B0ZA 1M34E 1X7DA 1TMGE 4IDNA 2Z9CA 1T3ZA 5FD8A 4HAXA 4PN3A 3PNBA 1QG0A 3JR3A 1QO7A 2P6MA 2V0CA 2FNAA 2YYSA 4LV6A 4MLPA 2BEWB 4W82A 4CG3A 5C3MA 1MZPA 1T8UA 1PZNA 3R7LA 4B4UA 5JWRA 3K2BA 1KAEA 2AIRA 3AY7A 1U90A 4BLWA 3ZIDA 4E4TA 2J5KA 1OMOA 1Q57A 2JK1A 4AS2A 2QTMA 3H5AA 2XSZD 4CT0A 1UPCA 1AO0A 2O2HA 1IB6A 4D6YA 4LJ6A 3GDOA 4WNCA 5JXWA 3A1NA 3EF0A 4WVLA 5C7IO 4P4UA 2AOTA 4X8LA 5DBEX 2Y2VA 3EIWA 3T5MA 1K5DA 4MR7B 3ZNNA 3IKTA 2AQIA 2D7DA 2D00A 2QMYA 4JT4A 1QK4A 1RQRA 3EYAA 3IAHA 3QYFA 1DLJA 2NZ8A 1G5IA 4LDRA 1TZCA 1JHVA 1ADJA 1BTOA 4NBKA 4IMPA 5ESDA 5CFNA 5DT9A 2ONKA 1RI2A 5BOSB 3K2IA 4PXSA 5EVJA 4MI1A 4A23A 1NA5A 4CEHA 1CY0A 1GL7A 2Y92A 1C7IA 4DR1B 2X0JA 3M49A 5TQ0B 5IKXA 1U2QA 3GO4A 2AKYA 2J4FA 3HUFA 2YQZA 1KK3A 1ONBA 3IA7A 3MWGA 4QLAA 3QKRB 4UVGA 5TB5A 3RTGA 3SICE 4L0CA 2IIPA 2LIPA 3AJ8A 3M5CA 4MEBA 4C20A 1TX4B 5JNRA 3GH3A 1JDBB 2P68A 1RAAA 3GCDA 4FMDF 5HCUA 5KBYA 1BD3A 4H59A 3P9QA 3IXQA 2FJPA 1SCIA 1QYXA 4MMYB 1J8VA 3EDCA 4LV5B 4B45A 2PHZA 3X1KA 2UUOA 3INRA 3QFFA 2Z04A 1JFVA 2Z3VA 2O8CB 2ACEA 3A9TA 4MI6A 4I4CA 5ALDA 2RG1A 1BX3A 3CRQA 4I08A 2Q3FA 4M46A 4HNGA 3E9YA 5B4TA 2FH5B 2VJKA 4TUYA 2R66A 1NMQA 2ECPA 3ZGLA 4I4TA 3BIXA 2PKWA 4FI3F 1WKBA 1ULSA 2WSLA 1E96A 1QO9A 2PAFA 3ZI0A 3ZQ4A 2YC2C 1U9IC 1K6IA 1NKVA 2CEKA 1JBQA 2JJMA 3F8SA 4PC6A 4BO2A 1EFLA 2VDJA 3C5EA 4FHCA 4UBJA 4O6VA 1LA2A 1L8XA 2ZBRA 1II9A 3AEUB 3NTXA 1RKUA 3I28A 1IM2A 4OIFA 4CCAA 4B3FX 2C7RA 4R0NA 2W2OA 5EZ6B 7MHTA 4AY6A 2NIPA 3WWYA 4RZUA 4RLSA 3O2JA 3L1IA 4GYJA 5KYTA 3QNWA 2Z98A 1C3OA 2Q0QA 2DH6A 1AB5A 5I4BA 4DR7B 1G7SA 2C2ZA 1V3VA 4KR9A 1AJEA 4MLDA 1U9JA 3QGMA 1UT8A 1ML3A 2FHSA 3IEVA 4Q9JA 1XJWA 4TWZA 3UAVA 3F47A 1PR2A 4LJRA 4NAVA 4L9AA 2P9QA 1J70A 1ZGGA 3GV0A 3IXLA 5E2IA 3VU9B 3NVMB 3GAFA 3GRZA 4PRZA 4HQOA 5E4TA 1TO6A 4AIIA 1GQYA 5FTNA 1LPSA 3Q9UA 1MIHA 3S44A 3AP2A 2G07A 3CR7A 2PD6A 2WDZA 3M5PA 4C07A 1QX4A 5IJ9A 4LN1A 4RELA 1U4NA 2YC4C 1GZUA 1SCQA 3SSAA 2R7MA 5T8KA 2ODPA 2FDRA 2QRQA 5EWJB 4WPGA 1W0KA 1PWEA 2NYVA 4FEGA 1I3KA 1X92A 3DZFA 4RXMA 4ESVA 2R97A 3DLPX 3HVKA 1FFWA 2PJRA 4MB2A 2CLHB 4QJIA 1A0OA 3SC4A 1IPEA 4B4DA 1XCOA 1YZHA 2MYTA 3CB2A 3ZH9B 3I1JA 3FCAA 1VHLA 4UTVA 2AJDA 2E3JA 3ZTTA 4DLXA 3OKFA 1TCVA 5CT5A 3K9FC 3WGIA 2CDRA 3CB4A 5JLJA 3K09C 4Z9BA 3GJ3A 2RARA 5HP4A 2JB9A 4JENA 2DWOA 3RYCB 3GLIB 1U63A 5CYOA 4OL0A 3G23A 3IA2A 4DMMA 2GZHA 4W6QA 5KCMA 2IYLD 2OZEA 3NPAA 5IW8A 1VDZA 4ITVA 3SP1A 4MUXA 3U2QA 2W6ZA 2Q9BA 2J59A 1AKVA 1YB4A 3KSMA 5KI6A 3L7IA 5AI0A 2RI6A 2HRBA 3SEAA 5JBIA 3PXEA 5HRAA 1P7CA 2IHJA 5DULA 1M7GA 1QR2A 3O93A 1VLVA 1WBJB 3H2ZA 3HCCA 4HN2A 4PSCA 1Y1LA 4G1MB 1N77A 5FFNA 4RY9A 2JJ8A 4U6SA 4EB0A 3PHIA 4P38A 1IJFA 2QU8A 4PBRA 4YWJA 4BB6A 5JZBA 3CH5A 3T9BA 4DS3A 1KMQA 4PO9A 2Q1UA 3ZKWA 2XKKA 4QOEA 3V46A 3EY9A 3G5TA 4J4HA 2JBAA 5U1PA 4BKMA 3I4FA 5HPYB 1W1IA 1YB6A 4HLQB 3UWPA 5HJEA 4Q4DA 4HSGA 5HXAA 4WVFA 1NNLA 3CY6A 1R0KA 3C6QA 3DOCA 1WXDA 2B21A 3GYGA 1OX6A 4BNXA 5FOSA 4E51A 1YFLA 1XZ8A 1QLHA 4ISCA 1W4CA 3PDIB 4TL9A 1JWLA 4EG0A 3AVVA 1D2RA 4GX5A 4C89A 2PY6A 5HK9A 5GZ6A 4FPXA 4CEIA 1QOPB 4G0PA 3AM5A 4Q3CA 1OROA 2IVFA 2GKOA 2QVCA 3KALA 1ZI6A 4G4SO 3KSAC 4FW9A 3IEPA 1GNSA 2FFQA 4O02B 4C0AC 1EGHA 5L8VA 3FOZA 1A2QA 4GXTA 4DHEA 3TW6A 1UWCA 2IRWA 1A7JA 3IURA 1QTIA 2J9FA 2FZGA 4U9IS 1JE1A 3HDTA 3RI3A 5BMOA 3ASYA 4YLGA 1XVIA 3BWXA 4DCOA 3OCWA 1S8NA 5CPFA 1N0HA 2HJSA 3U1TA 2JFBA 1IH8A 3HWWA 5AFSA 3ASUA 8OHMA 2OFXA 5KO2A 1M0EA 4LZLA 4ZJYA 1Y42X 3MWEA 4HGQA 3HJHA 1GZ5A 2AJ8A 4XFKA 1HY3A 4NJEB 1SUFA 3RYHA 3O4GA 1K8ZB 2VPQA 4LOJA 1S02A 4LYDA 4QPCA 4UUOA 2F43B 2D5AA 3QOFA 2CLSA 4PC2A 2YMPA 1P7WA 1UBJS 1Y33E 1XLVA 5BSMA 2C3UA 1EMDA 3ZTYA 1SUEA 2RJ3A 4BNHA 3MQFA 3UOWA 1P1FA 3GNSA 4YAIA 4ZYWA 2A9VA 1NF3A 4NYMQ 4EYSA 4S1OA 1PWHA 5AJVB 4J1NA 2X14A 2WU8A 2X1LA 2JJ2A 3TZQA 3G0OA 5DWVA 2G76A 3T7IA 4S24A 3Q2OA 1V11B 3Q6NA 4MYCA 3WWOA 4A5OA 5LYJB 2P5SA 4V0SA 4F2DA 2EF0A 4IKOA 3ANMA 4BLTA 4DZZA 1GGJA 4Z99A 4HGNA 4I9FA 1WV1A 5TR9A 1Z7EA 2QY6A 1W9MA 5JRJA 4ZZIA 3FCCA 1B2RA 1OFTA 1BWRA 1NBMA 4ZMRA 5I01A 1BS1A 2B2CA 4DOMA 1JS1X 5C4GB 4JQSA 3LQ1A 2HK9A 3PJGA 4J7AA 5D00A 5T6MA 1DQZA 2WYWA 4JH0A 3F8TA 3ROXA 2IUYA 3VH4A 1T6BY 4WFKA 4HEQA 5JNWA 3SFTA 1BDMA 2SCUB 1IBCA 2I66A 3ABOB 1E9DA 3JAKB 1AZTA 2HY7A 5JJ5A 3PEYA 2JI8A 2WWWA 5GONA 4NU8X 2X2EA 4E21A 5ERYA 4MARA 1KJNA 1EHYA 3JWGA 4AN1A 3AR8A 4PW0A 4ZOLB 3USZA 1J5XA 5IVKA 3K2QA 1JTEA 4RQBA 4E94A 1A72A 1GTVA 2QX8A 3A6KA 3GJSA 3IAFA 4LE0A 1YZKA 3OHMA 3QU2A 2D1SA 3CUWA 3U44B 1DQRA 4LDZA 1UBTS 3RFUA 2Q9UA 2V7UA 2VLBA 4ZQHA 5B3KA 3JAWA 1EFPA 2BE9A 2HBQA 5IDXA 1UAGA 2EJCA 1M76A 1VL2A 2I71A 3B1FA 3A9SA 5K03A 4B79A 4FFLA 1H1DA 1G8MA 1MAHA 1RYYA 2HV8A 3UIEA 3CE9A 1SXJD 5AVYA 2MYPA 2WIKA 5ABPA 1X70A 3IGFA 1XD2B 1W75A 3N76A 2IBSA 2IHYA 4V03A 2V5AA 4B4OA 2XCIA 1J33A 4D0RA 4A15A 2BELA 2PH1A 4HYYA 4BE9A 4LF4B 3PFCA 2AZXA 2XMSA 2ZRGA 4LPKA 2R8PA 1DI0A 1I5EA 1H8EA 4WAUA 2NO7A 4Y1RB 2CCGA 4IWXA 3WBFA 4MV7A 3MWFA 1UP6A 3RF6A 1YJBA 3JW8A 4N1AA 3JSXA 4H7DA 4CLOB 5KHLB 4JLUA 4W5OA 4YJKA 3HMQA 5HBRA 3THXA 1FSZA 2IXBA 1KBQA 2JJ2D 5A5VA 2BMDA 1Q0RA 3D4BA 2AVDA 3KWLA 1O97C 1X39A 3DWFA 2BR3A 2QX6A 1E0JA 2CMGA 1AC5A 1Y8RA 2X1VA 3EVNA 1LRKA 1QRSA 4TKVB 4B3CA 1E60A 3KYCA 1LBTA 2G25A 2AN3A 4R1UA 1RM3A 2QG6A 3SJ7A 4QRHA 3HR8A 1GUFA 2AJLI 2ENWA 4N0DA 4WZBB 2SBTA 5SZKB 1PS8A 2YZMA 3HDYA 4WEQA 4IWYA 5C1BA 4B3IA 2HSEA 1GFSA 4H7HA 4BRSA 3SS8A 1NJ2A 5IASA 4HGOA 2FZLA 4M38A 2ZM5A 2ZSHA 4NK5A 1ULHA 4R6XA 2K87A 1Z6TA 2Q2NA 5K99A 4PSUA 4LAFA 2AG1A 1XMPA 4AJ9A 4W5RA 1EFVB 3BSWA 1I1NA 3UFXB 3UTDA 2PUDA 1NBEA 1JYEA 1S2MA 1X7YB 4B9AA 1Z2AA 4WK4B 2WIGA 2X8WA 2M32A 3VZQA 2DVMA 2M9MA 1C0EA 4JDUA 3UPUA 1WMDA 2Q9CA 1D8TA 2K2QB 4M22A 1I9CA 1SVOA 3KQMA 5AWFC 1HNZB 3ORFA 2HREA 2O0JA 1Z45A 3NNNA 4FOOA 3PXCX 4R7GA 4BB9A 3H7IA 2QVLA 2A0KA 4EYEA 1VHDA 1DQNA 4KZKA 5ALFA 6ADHA 3TZBA 3DE1X 3NORA 3NHZA 1S3GA 4OL9A 1PTJC 3CCFA 4EUHA 4I6EA 5HQ3B 2I62A 2AQ8A 4RD3A 4K26A 1S96A 1GVHA 1KEKA 1CY4A 4QGAA 4DR2B 4KVFA 1G5QA 1XI2A 4EGQA 4Y2TA 4A5SA 4H3VA 3STTA 3HG7A 1TCCA 5ALIA 4EFNA 4M4SA 1Z0DA 1MTZA 3GJQA 2A3RA 3ZY3A 1L0BA 1UBEA 2FEMA 1TI7A 5MGNA 2CUKA 4B2YA 2WC1A 5LJIA 1NF8A 2DCMA 2W6CX 2F17A 1OIWA 2FW8A 3CNEA 5TC4A 3ROMA 3A70A 4EY6A 1DTSA 4WK0B 3FW1A 2ZAYA 5FUQA 1FP2A 4FI3C 4F1JA 3GLFB 2W00A 4JP8A 1NU8A 3L6RA 1NVVR 4P33A 1UXHA 2ZVJA 5NLLA 3QU5A 1G2QA 1GKYA 1R6XA 1GXSB 1NWCA 3G0GA 3CVVA 1LWNA 3YASA 3VTFA 2Z4TA 3HLKA 3N6RA 5MDHA 5JZOA 3QM1A 4CCYB 3OCJA 4G37A 2B4KA 2OHXA 3CT4A 1QP8A 5DNAA 3W1VA 1C30A 3H05A 1GCGA 3EB9A 4MINA 2IWHA 5LYJF 3BMOB 4Y2GA 1GPDG 2ZCVA 4P35A 1FMTA 2JFHA 4D8YA 1BZYA 5DF1A 3PL1A 5TSDA 4YIKA 3BB4A 3QEBZ 4N0PA 4FOTA 1QK5A 4MVXA 4HB3A 3JZDA 1FQOA 3DXFA 3TLJA 4TV9F 5FO0A 1A1VA 1BDHA 3UT0A 2IHVA 1T8SA 3DDOA 3MBIA 1DC5A 4X3PA 5J40A 2BFPA 3G2LA 1TU3A 2HMTA 4EW1A 1FFXB 3UO8B 4MUJA 1P4HA 2PYDA 4AKGA 3DZIA 3FFTA 3KUKA 3MUOA 3GLQA 1BQ4A 4KG7A 4RTOA 2BE7A 1PN3A 4CQNA 1P2FA 1ZCBA 2FZVA 4HMQA 4LY6A 4DBZA 3UW3A 3QLVC 4XVRA 1BGXT 1IRIA 4AC9A 2IEAA 2I91A 8ABPA 1NASA 1Q95A 2GAIA 1IBRA 3DFKA 4HYQA 4GNRA 4X63A 4HWSA 4DIKA 2BN4A 4Y9SA 4NDZA 3D0OA 3N8GA 3SWWA 3LQYA 3VV2A 3ONFA 1SY7A 2VYNA 2HQBA 5I9IA 4F8EA 1UCFA 3F9RA 3CVJA 3VVCA 2L17A 5KTSA 4QJ4A 5DTRA 2KYRA 3GR6A 3ZDDA 3AFIA 2WUFA 3AM3A 4RVSA 5C52B 1M2WA 3L1HA 4FFBA 2XYPA 1VYHA 2QTVA 2QD1A 4XDGA 5LOVF 2BRUA 2FPSA 3F2VA 4KXXA 2VTBB 3UMYA 4N0MA 3ETDA 5I51A 4FZVA 1E7WA 1RYEA 7YASA 1N2XA 2W6ID 5AJWA 4L78A 5DI3A 3EOZA 1DAMA 4HBZA 4O4IF 5K6AA 3O8NA 1F0YA 1VJGA 4M7PA 1S2IA 4WASA 2OV2A 3JQ7A 1OE0A 3RSZA 5AM2A 2IYRA 2AZMA 1IHXA 2FFJA 4IIVA 1IATA 1Z34A 2PG3A 1QRDA 2XBUA 3L7KA 2EBUA 4YAOA 5CH3A 2OYCA 5CB6A 1WD7A 3I6QA 2XCRB 4NCAA 1FTWA 4BMVA 1FUIA 5A0VA 2CFTA 1Q7TA 2FW7A 4U63A 2ZUWA 1EFTA 1ZNZA 1HZJA 2C0CA 4GI2A 2WLTA 4INOA 2H7XA 4KFTA 1U8YA 1CY8A 1WZUA 4AWXA 3LSTA 3UWOA 1CZNA 3WIOA 4TZKA 3KX2A 4Z4CA 4E08A 4P5DA 4TRMA 4YX9A 2QS9A 4OU4A 1PHRA 4UAUA 2R47A 4AF8A 3IEKA 1Z39A 2A1UB 5K6TA 4R4JA 1Y6RA 2CWDA 2XODA 3O1JC 1GPJA 4Q4CA 3PGA1 3CUTA 3QMPA 1LF5A 2FSUA 2YS6A 3ESAA 4QUIA 1JXMA 3HGMA 3KR0A 4V0OA 5F7JA 2C7VA 1ZJYA 2AR9A 3M8KA 1ZS9A 1IEWA 3R3UA 2QLTA 1YNOA 4U7WA 2ZSEA 2AS0A 1DWQA 3ROGA 4HQ6A 1DP4A 1C8VB 4WCDA 2Z56A 2GTIA 4MRMA 5EUMA 3TLGB 1QLWA 1MJHA 1ZKDA 2B1JA 1Y4DE 3DM9B 3DPSA 5EY5B 2QUKA 4IQ8A 1P7ZA 3THYB 5JNUA 3FG9A 3R40A 4RCVA 5DHRA 3RSCA 5LPNA 1YJCA 3OPXA 3VDNB 4CG1A 3JS5A 3NNSA 3HXMA 1QE0A 1VIVA 2EKDA 2HMWA 1BVHA 1XVAA 1S7GA 3N2GA 3QHPA 1M34A 4YQYA 3RVJA 1FVHA 1P4AA 5HJ5A 2ORVA 2HA3A 1NNUA 2C3MA 3F97A 4H7PA 2FEKA 4J0IA 4ZARA 5L40A 3DHVA 5FJIA 1JR2A 4GVPA 3ZDCA 3SQOA 2IZZA 2QRHA 4OA5A 5IAKA 1XQ6A 2FQXA 3HNRA 4IHAA 3IVRA 3KVRA 5HF9A 1ZJZA 3ETJA 5TDHA 3U7RA 3TQFA 3LAWA 4XYBA 4DJFC 2C4NA 2ZWAA 3AFGA 1ISSA 2DETA 2BTEA 3U61B 3N2KB 3DLHA 5FJJA 3E22A 3CZCA 4YJ2A 3LC1O 2BSQA 1H6AA 1YI1A 1MX5A 1VCIA 5TS3A 3TIIA 4GX1A 5ELXA 4CI9A 1NPTO 4D92A 4G4GA 1IAVA 1M75A 1PFYA 3OX2A 1COZA 1DPFA 2QTHA 1PZFA 4XR9A 1VA4A 4U39A 3RHFA 1KRWA 3A6HA 2QUAA 3ABIA 4QUBA 2XTNA 3CG4A 4OQZA 1PGPA 4M55A 1QWSA 4UW9A 3MD0A 2XE6A 1ZJWA 4GP9A 6NULA 2BMAA 2BFNA 3L93A 4G26A 4AECA 1YQUA 1U5BB 3KYJB 4GPEA 2JC3A 4J1QA 1TT7A 3IERA 1P4JA 2L42A 2G04A 4FTWA 4JOQA 1IMOA 5FBWB 1MC5A 3SVZA 1Q92A 1QGUB 3VVLA 5HKKA 2CXPA 4LZJA 4BDSA 3MOGA 2XD4A 4ZU1X 2F3PA 2VJYA 4A91A 3K0SA 2FW6A 4NV3A 2DC1A 3A0UA 4ND7A 3AH8A 4FKMA 5ALJA 5DMHA 4EENA 3QVTA 4YALA 5BSFA 1F9AA 1EA7A 2O0MA 4GVXA 4MIKA 3UY4A 3VPAA 1DHRA 3F6RA 4IJQA 5DI3B 4ML3A 3EZNA 2CT8A 2A5JA 3AV3A 1OKKD 3LTEA 1VSUA 4JGIA 5FF9A 4HAZA 2O1SA 1AK2A 4D9BA 5KSYA 3JD3A 2G7MC 3FYUB 3LBAA 5DZSA 2Q50A 3PQ7A 1PYDA 2P2YA 3KWMA 4MSUA 4A1OA 3EEBA 3N2EA 2J0SA 1BGVA 2ABWA 3JWJA 3GDHA 3DUFA 3ZWOA 2ZT8A 1Y89A 4JI2B 3AK4A 2QSJA 1Y3AA 4GQBA 4L02A 1KI8A 1OI7A 2FPGA 1KJ9A 3FHCB 3QSGA 4IXDA 4N5NA 3ROPA 3FPGA 1LTQA 3PIRA 3ZCPA 5JS1A 4QFBA 4M53A 1U9YA 3SMVA 2WF6A 3OBIA 5J9FA 2VDRB 4DLLA 5JZVA 3DF9A 4XQCA 1NUPA 2VP5A 3OPQA 3ELUA 3HPRA 3SSNA 3NRCA 3P2IA 4EF6A 1OB2A 4PZPA 4G0NA 5LUBA 4LZZA 4HAUA 3HXOA 2FUG6 3BS4A 5LZ2A 4Z9YA 4EHHA 1J23A 2ZJYA 1RM0A 1Q7EA 3K8QA 1ACJA 4ITUA 3CISA 3WOVA 4LK3A 2UXCB 3P9PA 4BWVA 1AQLA 4LNHA 1KVUA 1NQWA 4KUGA 4CLEA 4K8OA 3B8HA 1NW5A 1WQ3A 2W6QA 3Q4GA 5LC1A 4B81A 2IBTA 3OM9A 3WZMA 2E5LB 4Z1MA 2O2SA 1G7CA 4ZAZA 3RS9A 2PT5A 3FI9A 3RQSA 2OMKA 2BISA 1C30B 1J09A 1U98A 3I92A 4WXHA 1HYEA 4HX2A 4XDHA 3ENVA 5JVDB 4UXIA 2F1OA 3TLEA 2IPOA 5BSVA 2HJVA 1NVEA 2BM8A 2J30A 2NYAA 3NTLA 3M6VA 1RRPA 2CDBA 3KYBA 3FWKA 4R81A 5AVUA 1U3FA 3OTIA 1KYTA 2FPGB 3C98A 1N0IA 2DFPA 4F3CA 1RQ2A 1C9NA 2J4CA 3HBLA 1Z75A 3Q87B 3ZWNA 3GN1A 4OY3A 3EVZA 1EUDB 2R6R1 3BE4A 4X3OA 1P60A 4TYWA 5E95A 2DCUA 4CR7A 1ZI9A 1GN9A 2B9VA 1RI5A 2RGWA 3NYRA 4YAUA 3A1DA 1GPWB 2H0QA 3DGFC 1Y7PA 4UU7A 3AL0C 3KKOA 1J0DA 1XCLA 4TYMA 2NQ2C 2QNRA 3CLRC 3U1VA 4CM9A 4F1WA 5TIIA 3W5HA 2ZI5A 2WTUA 3SVLA 4CTJA 1TCAA 3LO8A 3VU3A 4MB6A 2B83A 4G5XA 1P6UA 1GCOA 2ZEJA 1G1AA 3B51X 3BWDD 1N7JA 2IS6A 3H2HA 3IPCA 2ZJ5A 4QU5A 1H3NA 4IRXA 4OK3A 2GBFA 3VR4A 2PTHA 3AONB 5A3RA 1MW8X 2RHJA 2YHAA 3E0XA 4KLAA 1MH9A 3UNXA 3I37X 3W5VA 3MWKA 1YZNA 4JUFA 4X60A 4RVNA 4GLLA 3HCPA 2HSWA 3VFDA 3U7QB 1V6CA 1N2JA 1MEJA 3P4UA 4DQVA 2WABA 1OD6A 4L28A 3SGLA 2JGFA 5MFZA 3CINA 2P2GA 3O26A 1SNYA 3COYA 5K3CA 1KDVA 2BF4A 3AF5A 1S5PA 4UUQA 1A9TA 2XE8A 5DM2A 3TE6A 1JG3A 1HURA 4FYPA 4L08A 4RK6A 1CBUA 4G0ZA 2QYHA 1QH8B 1BS9A 4MR9B 1P0IA 1KZ1A 4TRJA 4C14A 2GA9A 3JVUA 1ONNA 3AJDA 2Q3JA 1U0SY 2CHEA 4HPXB 4TWAA 2REBA 4URZR 1JW9B 1W7AA 4L7QA 1QRUA 1WR8A 1K68A 1ZK3A 4F2WA 2QZSA 3B1JA 1H85A 2YWGA 3QI7A 4N7BA 3RUPA 4D0GA 6REQA 3U31A 5B7GA 5AKGA 2VYND 3I76A 1L1EA 1PZXA 2VLIA 3T38A 1PJBA 4DA7A 5DCWA 3KSZO 4KTTE 4A2QA 1YVRA 5AHWA 2GNAA 1H2BA 4OLJA 4UE2A 2QV7A 2TECE 1B23P 3OG9A 1NOKA 4KI7A 3QBVA 1QO0A 2I87A 2YMLA 2COUA 4KXVA 3VSCA 1JE0A 2GPWA 1YZTA 1YUMA 4NZPA 4KQXA 2P6UA 4RSMA 1NRWA 1YUBA 3ZS9A 1G38A 1ICIA 2RMKA 1MT3A 2QV0A 3AKYA 4LJ5A 4YRSA 3MGCA 2BGWA 1Z73A 2FN4A 3TOZA 3HZOA 4UFPA 1OJLA 1WHSB 2H2GA 2WAMA 3BMNB 4B8ZA 4QAJA 4Z3OA 1FW8A 3NXSA 2ZOSA 5F5LA 4YCSA 4W9NA 4L73A 4KQGA 4OATA 1C0KA 1OI4A 4KQEA 1DQSA 5D3KA 4ZAFA 2C3YA 4ZHQB 1RRKA 1K4KA 3NTQA 1USUA 3VYSB 3RADC 4PG7A 4EEKA 1VFNA 5C46F 2XHZA 1JFFB 2WIFA 3PDWA 2W0SA 1AA6A 1PR5A 5EE9A 3KQVA 1DE0A 3WLEA 4GXQA 4ID3A 3ST7A 4F5WA 4NESA 5AD1A 721PA 4ZRDA 2DPGA 1TYCA 5EXEA 3N6VA 3PHGA 5HF5A 3NEYA 5LUAA 4RD0A 2B98A 4B2IA 4YRZA 4Y6QA 2C4MA 5DV9A 5IX8A 3VC1A 5KYXA 5CLQA 4DJDC 2CJWA 1XRPA 4CMBA 1AHNA 4IIJA 4RHCA 2RH9B 1CP3A 4IZHA 3G13A 2EW1A 4PLYA 3AI2A 4P34A 2OXTA 3S8MA 8ADHA 2NSYA 2QR5A 2HRZA 2IW3A 2V0NA 3JQDA 3F71A 3KTAB 1CJVC 4MTLA 3B6MA 1IBKB 1YOBA 3MPUA 2EZTA 4MKXA 2CYBA 3MB5A 3GRPA 4KHZA 1GPKA 2ZU0C 1PZEA 3HR4A 1YRLA 3NHRA 3QZUA 2HL6A 4JOCA 3L6DA 4RMNA 2EV9A 3DPUA 2FW1A 3TW4A 3O7WA 4LHWA 3OKAA 1RJEA 5IT5A 4WBSA 1FP1D 2GZAA 4LHXA 3O8QB 1HXHA 2IDMA 3UF0A 2OZKA 2PWBA 5IM5A 3PXGA 3LZDA 3IRVA 3A1FA 4WXEA 2F9FA 1GV1A 1YE3A 1S89A 3H42B 4JLWA 3K8YA 4I4TF 5FOVA 5JISA 3VYWA 4CM5A 3S3TA 4X6LA 1U2RA 2IHZA 1KY3A 1Q1ZA 4MYSA 4PPQA 1J39A 5KPJA 1V1JA 3MMSA 2WY2D 4C1BA 4C0XA 1RHUA 1MZVA 1A4UA 1ZJJA 3GPDG 2QB5A 1YR2A 4E1AA 4G85A 4UOEA 4BQOA 4C0BA 1QIMA 3ORHA 1EYZA 5E4JA 5HA5A 5JNTA 5LQMA 4TV8F 4AIRA 2YRXA 3OWOA 1X7HA 3OEYA 1G20B 3KFXA 1J0EA 1JAIA 4L5AA 2NV0A 3DOJA 1PGJA 1ODTC 4QIHA 2WJHA 2XKJE 3DZBA 2XNKA 3FI0A 3MHPA 4GI3A 2FRDC 2PUGA 1XDSA 2AHRA 3MRXA 3FSRA 3H17A 3VAAA 4FFVA 3FVTA 2HI0A 3W5DA 4FGZA 2VSNA 3TPCA 2VFAA 3DOIA 3SI7A 2WTBA 2R65A 2O06A 1YTLA 3E9QA 1R0LA 1FLDA 3IUYA 5I47A 1Q2XA 3D5TA 4HDMB 4L6IA 3AB3A 3VU8A 3GQBB 4K9PA 3QFCA 4XVQA 3G17A 2GUGA 4DLWA 3FCUB 4WUVA 1R10A 4GQIA 1IRXA 1FZQA 1H22A 2KQUA 2WUEA 4TQ9A 3KFLA 3KL4A 3H1GA 1A8HA 3DEKA 3EGXA 4HNVA 1LNZA 3EZ7A 2ZWOA 1EBFA 3HSSA 4IIXA 2ZVPX 3NBZC 4Q4HA 5EOVA 4V1CI 2JCVA 1EBBA 3GRVA 3ISJA 4XIGS 3R5TA 4EL0A 3DBIA 4NAHA 4J4TA 5ECDA 3EF3A 3KAQA 2UV8A 3GD7A 4S1TA 4G1VA 1T0UA 2GEBA 4HZIA 4UNNA 1NVWQ 4ZQFA 5CFOA 4BKPA 4WDQA 4EP1A 2GEDA 1VB3A 2XUFA 1O8CA 1N0UA 2DUMA 2X9LA 4HWRA 4JXXA 2Y1KA 5KTOA 4YCCA 1S2OA 2XYGA 3DBHB 4HBGA 2WFAA 2NAFA 5JQWA 2IL1A 1VMAA 2FRDA 1EK6A 1M6YA 1O6CA 1P2TA 1V96A 4WIAA 4BS9A 1V95A 4ER0A 4A0FA 3PCRB 5FPKA 4XJVA 5EHNA 3MG9A 2H1LA 3I5XA 1SC9A 3INTA 2E89A 4AXBA 5JDCC 4DDVA 4Y67A 4NKRA 3QVWA 4MVWA 3HN6A 1ZW6A 3LBYA 4HNSA 4W8GA 3HK2A 1SXQA 2Y71A 3Q7TA 4OGFA 1R88A 4EJSC 2QN3A 4A16A 3D6AA 4YJGA 5C2JB 4OGWA 3GQBA 3LVFO 4HB4A 2J9XB 4L16A 1A9XB 4PV7A 3CA8A 3T35A 2QZ4A 2VDNB 3VGJA 5JQGB 1ARZA 1T5OA 2VG8A 4TWIA 3WL5A 4AO6A 4AT1A 1NOIA 1OYYA 1YR1A 3M1AA 1UDRA 4CUJA 3ZD6A 3PLAE 2QM0A 3ENKA 1KYZA 2VP4A 4P9NA 3T9CA 4COKA 4DUYB 4IUYA 4K6OA 3FTEA 1NJFA 2XZDA 2Q1SA 4XYEA 1AZSC 2J3HA 2WWRA 1BFKA 4FBMA 1M10A 4GR9A 4RJLA 1TW3A 5IVHA 3NWEA 4KSCA 2QRGA 3FA2A 4HATA 1IHUA 1N1GA 1VLMA 3G3EA 3O84A 3EGIA 4Y9UA 4UHHA 1J7JA 3SHWA 3ML1A 2HLPA 5G4KB 3LGSA 1A7UA 2A14A 3D5EA 3CH4B 1NXQA 1SC6A 2C20A 1DC4A 1AV7A 3DNFA 4RK4A 2LV8A 3KU1A 1P1IA 1G20E 1R00A 3VI3B 3LBHA 5TARA 3Q88A 3TRJA 2CUZA 4D4MA 4N3NA 2EFJA 5AHKA 1PRYA 3LUFA 4LTNA 1YS7A 3NX4A 3RBVA 1P5JA 2SCUA 4I5GA 4D80A 1T1IA 2QP9X 3H0CA 2VWGA 1Z26A 2CUNA 1ECCA 3A4VA 4R41A 5IUKC 3D4PA 3V80A 5CYPA 5GZ3A 1E2GA 1OH5A 2XNDA 4J91A 4HN9A 2RC5A 5KNCD 2JLQA 1JUDA 4V0MA 4QUGA 2H5EA 3JQFC 3CUSA 3E3NA 3Q7SA 4TXJA 3SKVA 4KQ2A 3UUGA 1UK6A 4IV8A 1ABBA 1O0BA 1MVLA 4R8SA 1T1GA 1X1QA 3RVKA 3IQFA 4CYMA 1NW8A 4WHMA 1SOUA 3ENNA 1A7AA 1N2CE 2V3WA 1E5DA 3LNTA 4QQ8A 1HETA 1R4AA 4POOA 1XZMA 4XLLA 4OMCA 5AJXA 5BRJA 1YQWA 1FFEA 4FWBA 2RKOA 1FMJA 2YW9A 3G5MA 1P80A 3PWKA 4Q39A 3THWB 1UH5A 2J08A 3FMIA 4RV5A 4M9QA 4D4LA 4DKXA 2L82A 2MSDB 3WO0A 1W36C 2CFRA 4MZDA 5D3MA 3O1IC 1T1RA 1C41A 2IPNA 4KUEA 4ZZ2A 1DLIA 2P8SA 2YN2A 4M0UA 1NQXA 2OKGA 4XX0B 3GLHA 5DX1A 4CFSA 1INLA 4IXWA 5TQVA 1ZUIA 5EFZA 2XMBA 1FRFS 3EE6A 3WVNA 4IQGA 4QTUB 2HA5A 1IVNA 4ZYZA 3KDSE 1U2SA 5ISMA 3CLTD 2ZIFA 3GWZA 2OHJA 2BF7A 4OOFA 1ZM7A 2AI1A 1KYIA 1KI7A 1CR0A 3KD3A 4KMSA 2OY0A 4RMGA 5HE9A 4FMBB 5FPYA 2IOHA 4LNAA 3VTZA 5C8VA 3H4TA 2OOKA 4J9UE 5ITSA 1P5FA 4C3OB 2PUVA 2YXPX 1KPGA 5CH5A 1E4OA 2Q2OA 2XAAA 3GVIA 1V8DA 1Y4AE 4XM0A 3CZ5A 3B9QA 4MV4A 1PFVA 1D6SA 2GFHA 2YDXA 4M7WA 2H59A 3OUTA 2TMDA 1KI4A 4TVOA 1SKAA 2IQIA 2LDBA 2RBEA 2ZB3A 3FNHA 3TS1A 2RGUA 4NBWA 5TQ2B 4XWKA 2FPPB 2PGIA 2ZIXA 4RGYA 4CG0A 3VA7A 1SVSA 3EXIA 3TZCA 5LVAA 5D3MB 4Z54A 1VL0A 4DE5A 5AP9A 3NHFA 1RJ9A 5KYWB 1XZEA 2CYCA 2CV0A 1NHWA 3L8EA 4GKAA 1JLRA 1Y5MA 1E2QA 2W7TA 3GVCA 3JQAD 2AW5A 3TDNA 3NXKA 2IZ7A 1YVEI 4F6RB 4EW3A 4C7XA 3D6JA 4RDXA 2P6PA 5FAKA 2A5YB 3AILA 5FNVF 4A0HA 1O2DA 1O6BA 2H9YA 4PHGA 3RW9A 1Y8QA 1WZEA 1RYBA 4NCJA 3C8UA 4OREX 3G6WA 3ZWMA 2E6KA 1ZK1A 4ZVKA 3VZSA 1L6RA 3OOYA 4Q21A 1GLGA 4TTAA 3ILVA 2HDNB 3KSBC 2IS4A 2XA1A 2VK2A 3P5SA 2XB9A 4OQQA 4ZO8A 1XXHB 3DKVA 2H1VA 1FDIA 3DEJA 3OD5A 3CH7A 1BHQ1 3N58A 3ORRA 3HJTA 1B0PA 4JUDX 4ZEOA 5G3ZA 1JR3E 3HDJA 3W3AD 4LF5B 1NQAO 2ZWIA 3KLMX 1YBVA 4BVKA 2OLJA 1U0JA 4HDQB 4D3YA 4YO8A 5E6UA 5LD2B 3EZ9A 2PH3A 1MR3F 1U3WA 2PSSA 2B25A 3ZW7A 3T7KA 1VB5A 2C5LA 1SZDA 2EG5A 2DR2A 3WWZA 1VJCA 3EXIB 2P3SA 2FCAA 3FSGD 1KSGA 5FUYA 2NU7B 3ESDA 3GJRA 3VOBA 1UBNA 2IXFA 4JBLA 2VF8A 4R84A 4RV9A 3NEAA 2VPIA 4NH0A 1XZKA 4P4LA 1CUSA 1IXSB 4BC1A 3Q72A 5J3JA 1KMMA 4IDAA 3N0TA 2WPNA 4CKXA 2DKNA 5C8YF 2BHSA 5EUQB 1RE0A 1SCBA 5CB4F 4OJKA 1X0VA 3MTDA 4TYQA 3OZAA 1A4IA 4OXYA 1XLTC 1XZBA 4M83A 4KH0A 4Y7DA 1DC6A 4ZCSA 2C2YA 3ZJYA 2GDZA 1TJPB 2QMEA 3S6JA 1TLLA 1CXZA 4MHOA 4BJ5A 2TMKA 1GZDA 5KYGA 5CBPA 4YR7A 1KMHB 3GZNB 4G0MA 1EE1A 4HYTA 5BW4A 2VEDA 1JDPA 1VCOA 2ZBEA 3OU6A 1SHZA 3AJEA 3FM9A 2FUEA 1UK7A 4HEA6 2PSDA 1WDMA 1X86B 2OBYA 5CIQA 3D4NA 3F4LA 3OE7D 4KB5A 5BO5A 3EW7A 4UEWA 4YV2A 3VSBA 3NFYA 4J0HA 3UK1A 4TTVA 1F1BA 1JU3A 1QAOA 3IH5A 3MTEA 3N75A 4FLMA 5CCXA 2DEUA 2XWSA 2CDCA 3EG9A 3MW8A 2QTTA 5AUQA 1PR6A 1GAEO 2DHEA 3PNMA 4I9NA 4ZT6A 3KCNA 2IYSA 3I32A 2O2GA 3WMEA 2ZJAA 4EH1A 1CR6A 2IHUA 1ONOA 2IITA 1NJ6A 3K9CA 3S1AB 2EJWA 3TZEA 4AKHA 4PYLA 2R6AA 1ADYA 2V97A 1GFWA 1RT9A 1CZKA 1G9XA 2LDXA 1HGXA 1HT0A 2GEUA 3N0RA 1E7YA 3RRXA 1ZLYA 2BHTA 4JFRA 4BUZA 5L3SB 2V5VA 3A9WA 2HHJA 4WNAB 3U4QA 1X7XB 3CG0A 3KPWA 1N3IA 5CX4A 4JXKA 2OQVA 1V3UA 4G01B 4KV7A 3UHAA 3WGVA 3TNDA 4Y9RA 2O1WA 3CEMA 1AKWA 4MRNA 2NZ2A 2YJNA 4MUBA 1ZINA 1E3MA 1OYVA 4JLOA 3WV5A 4HNUA 4LWPA 1SUAA 4DUPA 3TB4A 4GP6A 1RADA 1Z12A 2D2EA 1V5FA 1X2EA 2VNKA 3CUUA 1ZKMA 3OT1B 3UWSA 4AG3A 1LI7A 1TVEA 1NTRA 3AF4A 2P4QA 2XOEA 1H5NA 1TF5A 3LRTA 2JL1A 4IUBS 5AK4A 5EQFA 4DRYA 4F5YA 4ZTUB 4NX2A 1H0SA 3T7TA 4IMRA 1GQSA 1ORHA 3FMPB 3A27A 4HN4B 5BRAA 1L4EA 1H2HA 1Z0FA 2EJTA 2P4SA 4OBWA 4YXWA 2J0UB 1XZNA 3ETHA 4F4FA 3DVAA 3EYWA 2BP7B 3DZHA 5J2TF 3SIXA 1UR5A 5CVEA 1YV9A 5FQOA 1X1TA 4O4HF 3U7GA 1IXRC 2DULA 2AF3C 3GJYA 1HLDA 4C0LA 3JWHA 1A9ZA 1PFUA 2XY4A 1KTIA 2WJVA 1QIIA 3A4NA 3DYIA 3F3YA 3KQQA 4PLPA 1PQUA 2X0EA 4UPEA 3MT8A 1E58A 1NOJA 4YMTA 3JQGB 4RM2A 1NVDA 5DXJA 3AHHA 2CDNA 1NC3A 1YZGA 2EW8A 1UDWA 3BIOA 1E2IA 4NK4A 2RHDA 3IVGA 3KZ1E 4YRCA 1P18A 3K6SA 1IIBA 3CZ9A 3HB4X 4XI9A 1AQYA 2VF7A 1L7MA 1WPQA 3ZVKA 1MW9X 1P2GA 4LGVA 5DASA 3INNA 1ZK0A 3S2FA 3BVPA 5HTKA 5M7EA 2PZBA 3WA7A 4LRWA 1FFSA 3T7SA 2G70A 4CFYA 1EH5A 2I2WA 1A88A 2B8WA 1UODA 4CU2A 3T9AA 4DLRA 2V6GA 2YV4A 3LUPA 2RD2A 1DX9A 1IC6A 4QFMA 2PUFA 1RAHA 2RHCA 2QMZA 4EGFA 4K03A 1WCWA 1JEOA 5LYYA 4AZVA 1HOTA 2C7GA 1AGYA 4IKEA 3AVXA 3W5AA 3QUQA 3LHFA 1W1WA 5LIRA 4RKQA 4N8SA 4BCDA 5CP8A 1JL3A 4RW0A 2JJ1A 3PI7A 2W4IA 4JX9A 3SMQA 2IYNA 3GFRA 2A67A 1I0ZA 2A92A 4PX3A 4DWVA 5JJBA 2NSHA 5B58T 5BQPA 1M2JA 1V5WA 2JVIA 5TF0A 2UVPA 5ALZA 2QE6A 2ZJ7A 3CZAA 3EDMA 2XGOA 1PL6A 2XUAA 3Q2IA 2NUPA 3CGWA 4P6VF 4AL4A 4AZTA 4L57A 4C03A 5LP6F 3NETA 4ZP1A 2C94A 2CLLB 3TD9A 4N7JA 4S3MA 3MXOA 1V2GA 1MABB 3HYNA 2Z5GA 2VTEA 4ENWA 4CIVA 1O57A 4FIZA 4MO2A 1FLNA 4LHVA 1Y3BE 3LUGA 1Q15A 1BMQA 3A04A 4L4YA 4LOHA 2CEAA 4FVTA 3ZZ1A 3T1TA 2O07A 4BQIA 5DWDA 5FBVB 3MCWA 1GDDA 3FMGA 2Q3DA 3DYVA 1ZA2A 3NDRA 4BJ6A 1JFLA 3Q9SA 2D2XA 1CP2A 1Z8NA 3T52A 3SOPA 1JKXA 1J5EB 3REQA 4D6PA 3QWIA 1TAUA 1O89A 2UZ3A 4D9CA 1H5UA 1W93A 5DGIA 4EMBA 1VJDA 1RQ7A 3HXTA 2HU8A 2QAJA 4LHEA 3B1YA 2WJ6A 2YJ5A 3LUDA 4PTYA 1DG3A 1TM4E 1A76A 3I34X 4RETA 2QPLA 1HL7A 3PGXA 3VNSA 5A7HA 5ADWA 4TTRA 3L4JA 1A98A 4HVLA 3IUPA 1WXIA 5JYCA 4DQUA 2RHBA 4HXGA 3LL7A 3H87A 3K15A 2EKBA 4IV5A 4D0SA 2C4KA 3VHLB 2ZRQA 1DEXA 4XPZA 4JLPA 4M9UA 3QKTA 5D84A 3QXSA 3C6BA 3BRWA 4R7TA 1UOQA 1D6MA 1QNFA 3AZOA 3IE2A 4NYMR 4P4TA 4W99A 3U13A 3WLPA 4MKZA 4L22A 4FFOA 3S1SA 3D6HA 5FLYA 2JFNA 1E3SA 4O5AA 2AUNA 1ENYA 2GJAA 1HEIA 2HXYA 4O2AF 3K0AA 1J2UA 1R64A 3DDSA 4R2KA 1J97A 1FJ2A 4J0KA 1HEUA 1OLXA 3AFOA 1E98A 3MMPA 2A3NA 1I01A 3RKRA 5C5DA 2O19A 5A4DA 2YIVX 1TM1E 2IH4A 1PKXA 3GLUA 3LUKA 4NCHA 4MZXA 1WW2A 3QUSA 4LC0A 1KAHA 4YJ2F 4F9EA 1WEKA 1E5XA 4MWGA 4QM7A 5K3AA 3UG6A 1TE2A 1AVTA 2XJ4A 4UVHA 1MMFB 4AJEA 3NKFA 4HEA1 1RPJA 5IN4A 2VIIA 4LC9A 3HWRA 2ZJFA 1QFXA 1VYTA 2TMYA 3I1FA 5BN5A 4HMPA 5ILQA 1Z35A 3QJ5A 4LE1A 2JCGA 2W2XA 1ZN7A 3FTFA 2KI5A 5IN5A 3G9ZA 3WX0A 4PSKA 3ZZUA 2COEA 2NXCA 2RGEA 5BN4A 3VKHA 4Y18A 2VRCA 3STYA 2X6TA 2QJTA 2FZ5A 1W48A 3B82A 1BX0A 3VZCA 3GJ0A 1IQ0A 1CVIA 3TF5A 3JQ9A 4GL4A 1D4OA 1QE5A 3WAJA 1SRRA 2HDOA 1GO2A 1X1EA 4JZYA 4KWCA 4LUCA 4XKJA 3STHA 3QE3A 4ZCRA 1ULAA 3OECA 3AI7A 1C3OB 2M2IA 3AJAA 1OAAA 3LOPA 1BN7A 1KP2A 4F91B 1M8JA 5E3IA 2BFEA 2G9RA 2WTNA 3KT8A 5ERGB 1IPFA 1UWKA 3GROA 3AR5A 2V98A 3L0ZA 1G4HA 4MW4A 5E6SB 3GRKA 2HT1A 4MRAA 3QEMA 2NUPB 4C22A 4RVFA 1T0IA 2RAFA 3WGUA 3R9XB 1ESCA 5KYNA 2C9MA 1MH1A 1JFTA 1OB5A 2B2NA 3F1LA 4PIPA 1FRZA 2PLWA 4ND2A 2QUBA 1U3GA 1C7ZA 5EP4A 1MKYA 2EWMA 2XF8A 2XXAA 1F2TA 3BRSA 1EEXB 3VTKA 1RQNA 4KYUA 3S5UA 1Z4PX 4R8MA 2R7KA 1Y4UA 2BCGY 4XLZA 3GP5A 1G21B 3QVXA 5BVGA 3IQGX 3KFVA 1Q77A 2QRLA 5LQDA 2CY0A 4CV3A 5DM70 3I8XA 3H2YA 1Z6XA 2YJTD 3HJAA 4RPJA 5CX1A 2G83A 2G9UA 5DTMA 4DRZA 4EG3A 2JHPA 3HB9A 1N5KA 2F9MA 3PUIA 4JL8A 4A2CA 3KPYA 1EUYA 3CVOA 5CFZA 2LR0A 2CVZA 2WFLB 1YHZA 4PHCA 1BIFA 2ONYA 1E9VA 1YL6A 1YSCA 2FOXA 2K5UA 4TL6A 4PSVA 3EZLA 2OK7A 3WLFA 2VN8A 3ZU2A 4IJ5A 1DOAA 5JSYA 3FHLA 4E7OA 2QN2A 5IUJC 2OO5A 1WW3A 3K6JA 2PL1A 5AHXA 2EKLA 1D5CA 4WH0A 3I2JA 4LRYA 4J3NA 4A8PA 1WCIB 4CL2A 4NMWA 3ZNOA 4P92A 4WGFA 2WUVA 4CNBA 2AUMA 1G8FA 3G0IA 1PNOA 1RLTA 4LZPA 4N5IX 4P0PB 3D7SA 3OQBA 4L3OA 3IYLW 3MUNA 2VP2A 4RDIA 5KNBD 3Q6IA 4Q66C 1IN1A 4EJ2A 2VP0A 2CE7A 2FAXA 3LPCA 3TM5A 4ALJA 4NPAA 2PZGA 4MWBA 2PM8A 3DBOB 3KUXA 3QQPA 4LMBA 4LXYA 1VMEA 2GCPA 2ZJOA 3N8HA 5CAEB 3AKZA 4BPBA 3QVMA 2D59A 5FPPA 2VJMA 4CQLB 2J67A 2WVJA 1ISGA 2R1UA 2TS1A 2B7BA 1NDHA 1REQB 1UZUA 1JSLA 1TAQA 5GGXA 5DM0A 2C92A 2IEIA 1C4OA 4CF4A 3BXXA 4PVCA 3TPZA 1JKJB 1TUBA 2CFOA 3DNMA 1QFMA 3LP6A 1GGFA 3OZ7A 5AICA 3ZW8A 2J9GA 3NWJA 2E49A 2SICE 3E7PA 5F3WB 4OMUA 4YXWD 5HQTA 3T1QA 2N1BA 1R4MA 2RHLA 3QA9A 1IQPA 1HFKA 2XKBA 3FWZA 5LQRA 2JW5A 3PQEA 5K8TA 4WZBE 2QW0X 1M54A 3IJ5A 2J33A 3L8YA 4H1VA 5F2KA 2ZZKA 2LXNA 3K0FB 4C7KA 1WAMA 4OHOA 3DMTC 1NC1A 4NARA 5EPOA 3KVNA 2Q4TA 5HJ2A 4X44A 4HMOA 1YB1A 3GEMA 1IM5A 3BIJA 1XJ5A 3W1EA 3QEAZ 1Z28A 2NO0A 2QA5A 4JUIA 3THYA 2OAQ1 2R11A 2CYAA 3SG0A 2DR0A 4B80A 4QWWA 4C6RA 5AVQA 2EX4A 2PS0A 2V1XA 1UPAA 4LXIA 1LBSA 1G64A 3ESBA 3AX6A 3ZPXA 1VC2A 2OWDA 1IPHA 2DSNA 3W3ZB 1TD9A 2I65A 4OQYA 1HE8B 1W8DA 1XF9A 3ZGYA 3QVVA 1Q3KA 1JQAA 1PZGA 3G82C 4V0LA 3REGA 5H4HA 4W7HA 4YV0A 4QEZA 2LE0A 3SJBA 2Z1NA 4UBMA 5KMGB 3JYPA 4LBVA 4HFNA 5KU1A 4EZEA 4QATA 4JEIA 2GM4A 5KEIA 5G0WA 3DAOA 1IBSA 2WJIA 5I7EA 3UXYA 1JQKA 1LD3A 1JHOA 3LGXA 2ZYTX 3U39A 5BR4A 1OAOC 1OLUA 4HB0A 5DHAA 5DJ5A 3EC2A 3T9FA 5CD1A 3RSLA 3OIYA 2LCFA 4M9CA 3ESRA 1LB1B 1KY5A 4BGDA 3DTVB 4C87A 1PG2A 4JB8A 3C4QA 1Z4QA 4WZZA 3TJRA 4ZYYA 1H5QA 2D5BA 1UOPA 2XEXA 3ZBQA 2P7HA 4FSHA 5A6SA 1LLDA 2Z58A 5DRTA 1GIAA 3W06A 1CEYA 1ZC4A 3OJWA 2G77B 1K7FB 3X2SA 5CXXA 3A1SA 5FP0A 1WHTB 1GCUA 1JXOA 1YL7A 3ZVRA 1KHTA 1QCZA 4FGWA 4Z6KA 4ZPJA 2WJZB 1NJ1A 1E5TA 1H2AS 5G3YA 2QTNA 4RL4A 1OF1A 4MWSA 3PK0A 4WNYA 2YJZA 3DWGA 1K3UB 1FS4A 3TNLA 5GIOE 3RRMA 3AHCA 1ZESA 3A1TA 4BKQA 1NXSA 1E0AA 3EW9A 4QPDA 4UXHA 2W71A 1M2EA 3BRWD 1UBUS 1ULUA 1CVLA 1XVUA 4IL5A 5CDTA 4C3UA 5CXUA 10MHA 3GW8A 1WTAA 4GYYA 1M0TA 2O8FB 1HLFA 5ULLA 3QIVA 5GONB 1YMUA 3QP9A 3S2IA 4AP9A 3K4HA 1NJGA 2OHVA 2BGGA 4J2TA 4HWTA 4MUFA 4P7BA 2G08A 5ALSA 3GGOA 5I9LA 1M33A 3LPMA 4KAJA 5DTQA 1EIWA 3B78A 1Z06A 3CW2A 3LPLA 4KNWA 2ZR8A 4Y0NA 3D4IA 1I5RA 4GRDA 4EX7A 2HPZA 5KDDA 1OH6A 1KWKA 5CEEA 1ZOPA 2BFWA 3IMKA 3OZSA 121PA 4CQMD 2O0KA 3UB3A 3UJ3X 1KORA 1RWBA 2Q8NA 4IGFA 1TQ8A 4MNTA 5B6JA 4ZOCA 4MIYA 3TO5A 2VKQA 2WQ7A 1XALA 2VBFA 4QDXA 4JT8A 4RFSB 1M2KA 1QQ5A 1TIPA 1DKQA 2ZSDA 4YC7A 3SXUB 3BULA 2G63A 2C31A 1N8SA 1E2KA 1ZC3A 2WA2A 2Z9BA 2ZPAA 3FGPA 4WN3A 1TQDA 2QG4A 3ZBTA 2JKVA 2GZMA 3CMCO 3DS8A 3FY4A 3PDJA 1Z22A 4O2BB 1ZVVA 4EUFA 3VHXA 1L4BA 3EVGA 1I7SB 3TNYA 4TSKA 3OF5A 1JG7A 2YVAA 1CSEE 3IT3A 3NWBA 5EJ5A 2DWCA 1V39A 4CT5A 4RCZA 4ENTA 2P9EA 1FTYA 3PYXA 4KI0A 1SVLA 5KWSA 5ED0A 1BSVA 2GXUA 3RVOA 1CQJA 4RTKA 4GDFA 3WRYA 4LS3A 1JA9A 2CJFA 2N47A 1YZFA 1J2EA 4RIEA 3OTHA 1T9AA 4EAAA 4OP1A 1ZIXA 4V0RA 3OT1A 3SZGA 1MB0A 3A31A 4CMGA 4GUAA 4B35A 5J23A 1Y8CA 1YE8A 3C3XA 1JDZA 2ARKA 3C7KA 4TZ6A 1KAQA 1M2VB 2W6IA 4E07A 1XJ0A 3R77A 4HLNA 2D54A 4HXEB 1MPXA 2A5GA 3DMFA 3PGKA 4UVEA 1A96A 3EIQA 3E1SA 4FFDA 4WY8A 2WHPB 1MQSA 1YBAA 1Z2NX 5AKJA 1P31A 4C7BA 4OXRA 1EDDA 3EH1A 4WZAB 4G23A 4JSYA 4ZVOA 5L3SA 1LLUA 3EAFA 3HL0A 4YJ3F 1CS4C 2W4QA 2O14A 3RRBA 1N2GA 3CR3C 4QD3A 5FHQA 4AD8A 3DV2A 1UZNA 3PFGA 1ANKA 3E35A 3FYSA 2F3SA 2HUNA 5EZYA 5FNVB 3WK9A 1J8FA 4A8JB 3AVUA 4GSYA 1NVAA 4AJOA 2OGUA 5AKLA 2OGZA 1M1YA 2HRQA 3OCYA 3VYTB 4J9VA 3UMJA 4ZHQA 2IXGA 2I3ZA 4YAWA 3BGIA 3QOXA 5K0FA 1AZLA 3BJZA 2V03A 1OAKA 3VJMA 4FYXA 1X7GA 1OW3B 2Y1OA 3HJRA 3QF7A 5AM4A 3EPLA 3PGLA 3MFYA 2GMWA 3TL2A 4GOMD 2PXCA 1DT5A 2IYUA 3RM3A 1AKQA 1ECPA 3K0KA 4TLDA 3RVNA 4RH0A 1KMNA 1UAYA 2E7ZA 4Q02A 2ZBQA 3CF6R 3TXXA 3UA3A 1YKSA 5I5EA 3IBCA 4C0WA 1EGAA 3RLFA 2W70A 4DIEA 1JEJA 4WDRA 2DWPA 4RV4A 2X76A 4M0CA 1O94C 2HRDA 5ICCA 4WN9B 1T2VA 4OIMA 3K1ZA 2Q3CA 2OAEA 3O5AA 3JQBC 1AGXA 2C4TA 1PGQA 2A0XA 3VDQA 1IY0A 3KETA 2VJOA 2G1JA 4DLYA 1M9NA 2IKSA 1ZVKA 1J24A 1TECE 4GC5A 2GK3A 3TLKA 5CLLA 3INGA 3UMSA 4ZIRB 2PEZA 5C8ZA 2WWXA 3L4BC 4RD1A 1GPMA 4EQ6B 1UKYA 4ON9A 2H4WA 5EIOA 1YC5A 1CZUA 2ZI4A 1JQLB 4BVBA 4DLSA 4KPUB 1NLUA 1X7ZA 3TH5A 4Q12A 2PSEA 3IBGA 5B30A 1M6EX 2AZTA 4EG4A 4X8OA 2IV2X 4QYXA 4BGEA 5C5IA 3C48A 3QPWA 3PXDA 4AU1A 2CSXA 5DT2A 3ZJ4A 1WBDA 1KETA 2P4UA 4XDYA 5AW1A 3BT7A 1LPBB 2I1LA 4L76A 1RPAA 1ZGBA 2VDPB 4G8DA 3K30A 1T1JA 4CTKA 2NUBA 2VYCA 1ZAKA 1Z2OX 1LK0A 4UEJA 1YJXA 3E58A 2PXAA 4Q4JA 3CUKA 1IK4A 3GLHB 4BKOA 5JXHA 2AN5A 1XRLA 4B3HA 1ZMOA 1JVBA 2IYPA 3B6IA 4WESA 3FYHA 1KRXA 5KNCA 2HHCA 1Q17A 3L0PA 5FL7A 3RSFA 2VBGA 1M7HA 2VQ6A 5CLJA 5BSHA 4BO7A 3UYLA 4U2GA 5FA5A 2J45A 2PYIA 4RNCA 2R2AA 3IUSA 4PRYA 1YDHA 4D7AA 4RTNA 3V1YA 1HFEL 4QTYA 3KDAA 2JFOA 4I1PA 1E8MA 1VP9A 1G3UA 3JQEA 5EXXA 4JVNA 4X24A 1E1RA 1C7EA 1PFGA 3BSSA 5GZ1A 4N40A 1RKBA 4FDMA 2V5UA 4KACA 2RGBA 1IOZA 1OKKA 2VOEA 2XIQA 5DDIP 3IVAA 3UEOA 5LMUB 2OG2A 3L46A 4XQ0A 4N12A 2QN1A 2V8BA 1X74A 5IUNC 3TNJA 1AF4A 3HJUA 5EKUA 3AIMA 3PLRA 2ZBPA 4GRAA 1AT1A 4RIFA 3ERCA 3H3XA 3TRIA 4X6XA 1YR7A 2C59A 4O4HB 3USCS 4ENUA 1X1AA 1FFCA 1US8B 1YL5A 4KRFA 3JU3A 3AUKA 4QJBA 3A4YA 3CPEA 1KYVA 1QIGA 3LV8A 3OOHA 4XSHA 3FKQA 1L4YA 1NF9A 3HHPA 4EI2A 3T1YB 1EVKA 5EESA 3MWDA 4TKLA 4LSWA 3VDXA 2WILA 5LL6P 2R85A 1IE3A 1U7HA 2PBLA 3AINA 4GG1A 3A1CA 1JR3D 2DTXA 1KBZA 4R0MA 1UP4A 2C9DA 4TM8A 4YWHA 4A27A 1GKIA 1R5JA 1P2BA 2FVYA 3L7DA 2R8XA 1M8PA 3SXPA 1RBMA 3MJSA 3KHKA 3GGSA 3FF4A 3NBAA 1R3UA 3PFFA 3Q1LA 4BB0A 5KREA 2GS9A 3T1VA 5EL0A 1M5UA 5KSPA 2PL3A 1C3XA 2X86A 2X0IA 1XWWA 4LRQA 4O29A 4MQFB 4RPGA 1B1CA 5BWOA 2RKWA 5AIBA 3WIDA 2X5NA 4J07A 3T3EA 2QF7A 3G2JA 2VPXA 3OX4A 4NBRA 1QOQB 5TNXA 2I6UA 4RK7A 2AMVA 3HJGA 3PX7A 1EHCA 2PQ0A 5LA6F 3GJ6A 4U7GA 3IPXA 3N2GB 4YJ3B 5ITVA 3K05A 1WBBA 3NOQA 3WGTA 1HYHA 5T4FA 3TQSA 5F12A 3IDSA 5KQMA 1PGOA 1KR2A 1UQUA 1GZHB 3DFFA 1UJ2A 3IELA 3N53A 3EX7C 3T0FA 1UDBA 4AUNA 5L53A 2FR8C 4M8LA 4JUBA 4YN3A 5F33A 5IBQA 2WHQA 2QRPA 4ER6A 3JZIA 1RAFA 1SKUA 4YMGA 5JR3A 1EAYA 1G8JA 4YXFA 3MJHA 3L01A 4F06A 4PTLA 2XUOA 1Y5LA 3M0EA 5C0OE 1YQDA 4YHBA 2HH9A 2FN3A 5CEFA 2QY9A 3HC7A 4JQYA 4MI9A 2DWUA 5A62A 3DE0X 4U0KA 5TJ9A 3PBKA 3U09A 4PG6A 3IE1A 4Q7JB 1XPUA 3V7WA 2UYGA 4OQLA 2H8GA 4KZPA 5SY6A 2OC9A 3VO8A 1WD5A 3NVDA 5EIHA 5IFLA 3BD6A 2FFBA 3KLBA 2FQQA 3UXEA 4W1QA 3EMBA 4I99A 3AHFA 3VR5D 1KZYC 1KMIY 2E9SA 2A9JA 3TFWA 4DF3A 3AM1A 2WZBA 2I7TA 3L8GA 4GPD1 2OYSA 1WHSA 4GBED 4UVIA 5L9AA 4BO9A 1NIPA 4UM8B 4U7DA 2GZSA 2PUJA 1ZYUA 4OUKX 5ETJA 3UGQA 1LV7A 2JI9A 4M9XA 3UANA 3ICEA 4YRQA 3NUQA 3S2UA 2RHGB 2XMGA 4FYWA 2Y1WA 2IPAB 5COBA 1PS9A 1CUVA 4UOQA 4RKEA 5KU7A 1OH7A 2Y6VA 5KNDD 2EIXA 3WSTA 2AC2A 2Q27A 4IDPA 4LY3A 1MLDA 1TEVA 2GN6A 2PRJA 3CC8A 4XWAA 1EG2A 1J2YA 4OAPA 2M6KA 5CB4A 4RIIA 4TV8B 1BAPA 1BGWA 4FINA 2Q0HA 3W04A 3DAHA 4N18A 4Q47A 3F78A 1P9RA 1U0OC 4ASUA 1W6UA 4EGAA 4JVMA 1T3GA 1X7YA 3I05A 4GHWA 2FG7C 1WVMA 5L7YA 4DWOA 4JI1B 2VHZA 5JPCA 1G98A 2QQEA 2R1TB 2FW9A 4X84A 1G8PA 1U94A 2I6QA 2VTDA 5AM1A 3ZJTA 1UP7A 1OZAA 1UBKS 3KHSA 3EG5A 3K0FA 5F1PA 5TGZA 4GWGA 1EWQA 2IYYA 2E4VA 1BU8A 3U4DA 3ZZ0A 3FDIA 4BLPA 2KMLA 4HX5A 1GD1O 2C4VA 1F6BA 4GBGA 3MQ4A 2WWFA 3OE4A 1N9GA 1QFYA 2HMSA 2WYOA 3EDOA 3ENWA 3MJDA 4OA8A 4B3JA 1KZHA 4R1TA 3WGYA 2PZLA 4C6SA 3NAZA 2ERYA 5JCZA 4KDCA 5IJAA 1NLFA 1J9ZA 1JP7A 3T7AA 3DW3X 1FYDA 2FMFA 3K9QO 5F21A 4RZHA 4OU5A 4U4AA 3O1HB 3MRVA 4MDYA 5CIYA 1AN0A 4TYYA 4QO8A 4GM4A 2DB3A 2P6OA 2VA9A 3PDCA 2MSLA 1WM1A 3ET5A 1NF2A 1E2BA 3ILHA 4JWTA 1U1FA 3EAGA 1DCMA 1CV2A 4O4LF 5A3SA 4HV4A 1ORIA 4EPXA 1JIUA 3U48A 1NI3A 4UM5A 4C04A 3R8CA 4DWJA 4YQFA 1G8YA 2QP3A 3U49A 3DEYX 1VXRA 2WSYB 3RG8A 2QE7A 4X94A 2WDPA 2WWVD 2C5EA 5TQ2A 5LBUA 4DWWA 2GI4A 4Y2VA 5L7TA 2O6HA 4ABYA 1P29A 2R4QA 4ZU3A 1B8UA 2GERA 3L92A 3OQVA 4YP7A 4AJIA 2Q46A 5DN6D 1E2JA 4QYMA 4HDRA 2F3QA 4C2BA 4IIDA 3OTOB 2I7CA 3WMGA 5JZMA 1KRHA 2AK3A 3AESB 3BXGA 4GEKA 1WP9A 5CYFA 4X90A 4RORA 2V55B 5EPEA 1SELA 2EWWA 3GAAA 3OPMA 1XZHA 1N57A 3LY8A 4P4SA 1OGJA 3VJKA 1H6CA 3EVAA 3GEBA 1S2DA 3CRNA 2I6SA 2HK8A 1K75A 2QTRA 3OZCA 4UNSA 2JJYA 5FL3A 3UH1A 3V00A 1Z5NA 4BAZA 4BHTA 4C30A 1PAUA 3VDMA 1GY8A 1IL0A 1Z5ZA 4B9EA 4PCUA 3RJMA 4YEDA 3DV0B 1IUKA 4U9UA 1MQ8B 3PEFA 1KNQA 1DJPA 3H9EO 3ROZA 1GZ6A 2GVNA 3GEDA 5BQ3A 1GZ4A 1OXMA 1T3LA 3S2ZA 3V42A 4ZFNA 1JPVA 2FMHA 1FUKA 3RYHB 5BYJA 4DADA 3L8FA 5JVDF 4MRVA 1AK1A 5GIPE 1T9KA 3NIDB 2FZWA 3L4EA 4GZLA 1NV9A 1V48A 2IPMA 2Z0MA 3AEQA 1GRCA 3B6KA 3EODA 2Y9PB 1YZQA 2ZYVX 1VHQA 4IKPA 1N36B 1XCJA 4BEVA 1I7PA 4O59O 4A0GA 1SBIA 1OXSC 4F1KA 3OUZA 3CZPA 3IAXA 1N3LA 4A73A 1K27A 1QSGA 5JOQA 3TLBA 3FGZA 4U8GA 5E6SA 1MT0A 2DSTA 2DM6A 3BUSA 5TT1A 1PW5A 3U40A 1C2TA 1G6HA 2B9EA 1YKFA 2WD9A 4KMRA 3FX2A 3LJKA 4MR9A 5K5EA 5BW8A 4GI5A 1Q0SA 3IMCA 3K94A 4NBLA 9ATCA 2VQDA 3NBFA 4DNOA 3FUCA 2C0PA 1A9SA 2OCIA 2QZ9A 1ZMXA 2WM8A 1XK7A 2NACA 3REFA 2XTMA 3V1UA 1JJIA 4LC1A 4R31A 4PSAA 3ESCA 5G40A 2C9ZA 3QBJA 3TIVA 4LF6B 3BAZA 1RAIA 5DN9A 2NTYC 5HR5A 4B34A 3ENQA 3H1PA 1R6AA 1CDZA 1QC5B 1EBUA 2C4UA 2P65A 3EEYA 2GVZC 4UQLA 5KVVA 5LP6A 3BQMB 3RTAA 4IWNA 1F8XA 1YGYA 5KKNB 5ICGA 2V4MA 2K6GA 1Y8RB 5EIBD 4X85A 4MCJA 4MR8B 3W9SA 3DOEA 3HYCA 4PS0A 3CX7A 3E27A 1F51E 2I2DA 4C01A 5C7OO 1B8OA 1F60A 1F7UA 5BV8A 4AZ0B 3ZNQA 3H18A 1VPEA 2B30A 5JG7A 4I55A 1K98A 4MP3A 2HCFA 1MF7A 1Z4IA 2ZT5A 4ICIA 1Z37A 3NS7A 1T6ZA 5ED4A 4F72A 4GMFA 4PE5B 1VIYA 2C58A 2VZEA 3QW2A 3LC0A 3N7UA 3WOHA 4DT1B 3Q3CA 2I22A 2IXAA 4OEHA 4JIGA 3WLNA 3U56A 5FOXA 4ZTZB 4LISA 2MINB 1OI2A 5DEOA 4IJ6A 4EI8A 4YAGA 4LZWA 1MRSA 3V2HA 1DKRA 4LMRA 4WX2B 3CVUA 3NJ4A 5H8WA 4PYJA 2J7PA 3TLGA 1M0SA 2UU9B 2KLBA 2BHLA 2ZI7A 5DGCA 3U4QB 3FHTA 4OQNA 2NV6A 3CU5A 3D64A 1YS1X 3MILA 4P58A 4AJLA 4D8XA 1EWVA 1E9AA 4M3NA 2XUIA 3EUEA 1WCXA 5FL7D 4RZIA 4GLJA 1HZZC 2C7PA 1DEOA 1SXHA 1E2FA 2PWAA 2R8EA 2WJ3A 5LBTA 3R7NA 3W2IA 4O0LA 1GNTA 2ZBGA 5I9MA 4MKIA 3PJFA 4ZEVA 4B6QA 2AG0A 5ALGA 3DE4X 4PBSA 1CQXA 2I6FA 4EX6A 3JZFA 4FBLA 1NW6A 3BK1A 2Q3BA 3KZKA 4H3HB 1O03A 3H5RA 4M9ZA 3DKIA 2JIZA 1X80B 2HPHA 1JMKC 1VKOA 2OPHA 3UAXA 1X38A 3DKRA 4EWLA 3URMA 4UUPA 1B00A 3Q7RA 2OP1A 1K97A 1WXQA 3C39A 1E62A 1XZPA 2BZ1A 2H2IA 2YXBA 3CURA 4URWR 4C1NA 4RL6A 5DW3A 4O1MA 1U5AA 4R8KA 3CX6A 4IXNA 1QNLA 2YNMD 4YK7A 1Q3HA 4H1WA 4D4GA 2JI4A 1IOWA 5K6RA 2WT9A 1JR4A 1NUTA 2ECKA 2WBLC 5DO9A 2HBZA 4K87A 1C9MA 1ZMBA 2RIRA 4U7JA 5DBGA 5KOJB 2CVPA 5D8DA 1J2JA 3CO5A 3D02A 5KTRA 2GXAA 3DQZA 2PX0A 3PIIA 5CLHA 3PD0A 2AD5A 1LV8A 4FQ5A 3TFQA 1YA6A 4P82A 1DTEA 1RXWA 3IUEA 1OBFO 3BIWA 2BFMA 3DTTA 1JLMA 2PMKA 2ZATA 2PFGA 3VR6D 4Y6SA 4MRSA 5K3DA 1H4QA 4F5ZA 1CZOA 4I6JA 3RSSA 1FDWA 3GA0A 5SYNA 1B7GO 1Y3CE 4L0DA 2F8LA 1QQ6A 1FFXA 2WZDA 3KZOA 2J7PD 3FNIA 5A2GA 1RWVA 1L5YA 1LNSA 1YRQA 2IA5A 1KYYA 4YBZA 2BBWA 4I2NA 2YS7A 2Q28A 3TSWA 4RHYA 1VIAA 3NWPA 4O4JF 4JR1A 4JLJA 1HFWA 4P54A 5CXSA 4F71A 3BGOS 3SE7A 4BMYA 5KX5A 4NBTA 1M8KA 1RJGA 4FFBB 3C5VA 4FHEA 2VJBA 2I7DA 1SB9A 1PR0A 2MIIA 3FCYA 4KSBA 1AQIA 3GZJA 3LIIA 1FYEA 4H4CA 1QHFA 2EBWA 3WDSA 3SDZA 2XR1A 3OVMA 4RZXA 1TIKA 2ZRHA 1YOVA 1MO4A 2OTCA 1BW9A 4YP5A 2VNSA 4GH5A 1GXSA 1TM3E 2I7VA 2O52A 2H3EA 3FCEA 1HQYE 1UBFA 2GF2A 2SHKA 2ZSFA 3JASB 4ACBA 2R2GA 4EYGA 5G0VA 4QXMA 6REQB 5ADUS 4Q4AB 2HA4A 1OILA 1AIPA 2ZIAA 3OFJA 3IKVA 1VXOA 2VDLB 4RQAA 2B3DA 2FWRA 3ICVA 3EULA 2R86A 4CRWB 3QEJA 2JGDB 5FPHA 3RAJA 5CB0A 1JA0A 3DLBA 4EOGA 3D7LA 4WA8A 1GKKA 3BSYA 5EKXA 4NCBA 2VWHA 1RAEA 3S0JA 4FXPA 5ECGC 3S2SA 3M34A 5IYZA 1GV0A 5HILA 1SCKA 2ZITA 3KKEA 1HL3A 3CJTA 2IIVA 4AS1A 4NQZA 3N07A 1F5NA 2Z2JA 4PXYA 2JAXA 2FPOA 2I1QA 2A9KA 4R40A 1ZD1A 2C61A 1T10A 2G9ZA 2R8YA 2E5WA 4HUTA 1E1YA 1PV2A 4P7JA 2NZXA 1F0NA 1GG8A 1U6IA 2XA2A 2ZS8A 1OY1A 5KDLA 2Q5OA 4G9BA 3MWYW 4UZFA 1V7PC 3QF4B 4I14A 5F4BA 3DLCA 3A4TA 4PU0A 3RARA 4C5BA 3QVSA 2V7GA 5D6NA 5HZKA 3VR0A 3VRHA 3JVEA 5AW2A 1QU3A 3GUZA 3H2JA 4O63O 2JI7A 2C82A 1I4LD 1WHTA 4EFLA 3LQRA 4PZLA 6LDHA 4YRPA 5DVZA 4BV3A 1NULA 4M98A 5KSWB 2HCRA 3DE7X 3HCEA 1X8XA 3NHMA 4BFYA 4BNNA 2CD9A 3TIGA 3L6OO 4QKQA 2V58A 1QZ3A 2NT4A 1QIDA 3WWEA 1UJ4A 1UIMA 4RPLA 1ADCA 9MHTA 3D3JA 3OIDA 4LQ4A 5KHAA 1FFHA 4Z3DA 1YQ9A 1U0RA 1LF0A 5FBKA 1LSOA 3OPNA 4W9RA 2NP6A 1EJ6A 4YJGB 4ESOA 1OXXK 1SOVA 1THGA 1XZAA 3DZDA 3OEEA 4TZTA 3TLCA 1OIVA 2YXEA 4LXTA 5JLAA 3MOIA 5IF3A 1NUUA 4FOPA 3AXSA 1U9CA 3SQNA 4P53A 1AN9A 3V8VA 2IYQA 3RANA 4R2WA 1C7RA 1PJCA 2H1FA 3BOSA 4P5PA 2JIMA 5AI8A 3K6KA 3SC6A 3S7ZA 3K70C 2H51A 1BEEA 1J6UA 1XU4A 4E15A 3FTDA 4RMIA 5J4YA 3WHPA 1UBGA 2A1UA 5AVWA 3KAPA 4ZWNA 3HRIA 2HX1A 1TZBA 1RXSA 1WDKA 2QQ0A 4M8IA 1T3SA 4PRLA 4QYTA 2Z43A 1SBNE 1NHGA 3ZDXB 1LRLA 3TK1A 4W1PA 1NP6A 3VKWA 3V6MA 2DFNA 1UMDB 3IEIA 1X1BA 1E5VA 1H8HD 1T0PA 4XOUA 2YZ2A 4GW3A 4TROA 3ZTWA 1XMSA 2Q2VA 2VDOB 5DB4A 3MCTA 1W2HA 3A0RB 3EGEA 3S5JA 1ZSVA 4RDCA 2P3QA 2FLVA 4G89A 5AK3A 3T3GA 2VPWA 4JCOA 4NCXA 4K8RB 1PX0A 2JGAA 2DLNA 4YQEA 2XYHA 3UMGA 1WOMA 4CCWA 2X4DA 3U19A 4N5DA 1BDIA 5JSQA 2JIOA 3MCVA 2OVFA 1BHJA 3D9QX 3IX7A 4R2LA 4W5JA 2WJ4A 2WSSA 2P2ZA 2Q99A 3FETA 4ENVA 2GKGA 1QORA 2WHXA 4I5IA 4KPFC 1V6SA 4YJFB 1E7RA 4UNRA 1GL3A 2B1GA 5JV5A 5IKPA 3JAKA 4QE3A 3HUTA 1PJ3A 1NMXA 2AFHE 2R6DA 2W2KB 2WK1A 4N6GA 3DAFA 1JZQA 4B83A 3NDBB 2GD0A 1J2TA 2ZYUX 4Y6LA 2GYUA 4OK6A 3GT0A 5FYQA 1J1IA 5IULC 2W37A 5KHOC 2PT6A 4CEJA 1MNAA 1Z29A 4Z2YA 4I6GA 5L4SA 2ZUSA 1KTVA 1T0HB 2Y76A 3EQ6A 3OM8A 1JB9A 4X66B 5CLGA 3EC7A 2XXJA 7REQA 3DFIA 4GI1A 2PX2A 3P27A 5J1TB 3TIFA 4X00A 3PIDA 5DFAA 1D04A 1XPOA 2YUIA 3WK4A 5B3JA 2X19A 2R00C 5GVSA 2AF4C 2AYYA 2EBHX 4TX1A 4A0QA 3HP1A 3PU6A 2AWOA 5LYJA 1JFSA 3AEXA 2OCYC 5BV7A 1AHIA 1VKNA 1NTOA 3ICPA 1UFVA 1MEOA 1U81A 3MZ0A 3KXKA 1F14A 4TMFA 1L4HA 2BYTA 1RWPA 1RJFA 4LYFA 4OB8A 4CR6A 1D0VA 1FDVA 3E0QA 4CDMA 3M4NA 3MYYA 2QI9F 1RFLA 1A27A 4IIHA 2UZ0A 2Q5QA 2QOEA 3D2LA 4QBIA 4ONEA 1KO4A 2WPDA 1TDJA 2I8LA 3B36A 3SJAA 3ZV3A 4KNYA 1XCMA 2REQB 4NYIQ 3LBIA 1MG0A 3VH1A 1YIDA 1N9KA 3R6WA 4OBBA 4M1WA 1WNTA 4L4ZA 4DCNA 3VBCA 1ZU4A 3ZK7A 5J47A 4H6PA 3ON5A 3ANNA 4NF2A 4NULA 3WMFA 4GECA 4G0XA 2H9AA 1NVXQ 1CU1A 3HGTA 1W30A 1Y8AA 3KKKA 4QEKA 2JARA 4ZI2A 5LNK6 3B5JA 1C3EA 2VPPA 3ZHTA 4K9OA 1T9DA 1G41A 3GBPA 3GOHA 3KP1A 5HF6A 4CN8A 4PR3A 1PK7A 4DA4A 4PO1A 5BUSA 3GL9A 5CH8A 1LBIA 3JQAA 5DOZA 1Z5WA 3GF4A 3N39C 5J5AA 1R27A 3HL4A 4I66A