4CLRA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clrA00
2CSUA 2QG4A 1N5DA 5TT1A 5L4SA 2BKAA 2Y1DA 5CG2A 2P9GA 2ZCVA 5A9TA 3QIVA 5IZCA 2ZB3A 1K3TA 2V6MA 3WGYA 1YOVA 3MTGA 1LEHA 4ROSA 3UN1A 4PG4A 3HFGA 2NU9A 4CLHA 2VRBA 2G1UA 1CIVA 2EERA 3EGOA 3ZHXA 4FC7A 4RDHA 1PZGA 4MINA 9LDTA 1IB6A 1VL6A 3F47A 1Y7TA 4B7UA 3D3WA 3AW9A 2C54A 2VT2A 4CM8A 3OECA 4NFYA 3QWAA 3UICA 4CUJA 5DULA 3AU8A 4AJEA 2UV8A 1LTHR 1K6JA 1I3MA 1PU2A 4L4RA 3PGJA 1R4NA 1GZ6A 3GQVA 5KJEA 4CMIB 4R51A 4XRGA 1UAGA 3JYPA 4ZD6A 3QWIA 1D4FA 2G5CA 5F5LA 3U4DA 3DHEA 3WMXA 2YHIB 5GZ6A 2IYOA 2GERA 1M76A 2VN8A 3LC2O 2PKQO 4JBGA 4MPDA 5H82A 4IS2A 5EIOA 1X14A 4ZN6A 3PYXA 4BKRA 4BNNA 4RLSA 1YDEA 3OQ1A 4IDEA 4OGWA 4W9NC 4YDRA 3BMNA 3EAGA 2WWRA 3C24A 3NT2A 4I5FA 5F1KA 3GNQA 5JAZA 4FDAA 1K6IA 3Q0EA 4MVJG 2CDCA 4E33A 1E6WA 3P7MA 3GPDG 3FNEA 4YJDA 3V8BA 3UCEA 2PNFA 4GGPA 4IXWA 4AJOA 5A5FA 1MC5A 1IYZA 3KYBA 1GU7A 3L4SO 2H6EA 2FPGA 2V6BA 3DFZA 2FR0A 1ZSVA 1E3JA 5DBFA 2CVQA 5G2OA 5IDQA 5ADHA 1MG0A 5KKAA 1GYQA 3JCZA 2PA3A 3FBGA 1A27A 1DRVA 2NV6A 2G76A 1UDBA 4GMFA 5EN4A 4N18A 1HKUA 4Z9XA 2X86A 4IJWA 5CEJA 3KHUA 3GVCA 5EERA 4GAEA 1LJ8A 1Z45A 3V2UA 1ZVMA 3OJLA 5CDUA 5KVSA 4J2HA 1XIVA 4CM7A 4BO4A 1XGKA 2TMDA 1UJMA 2BFMA 3CINA 5CDTA 4ALMA 1DLIA 8LDHA 3KEQA 2EW8A 4ZQEA 4FPXA 2YV2A 4D79A 2ZYDA 4EGFA 2AQKA 3RC1A 4M55A 3LT0A 1A4IA 3WSWA 1YQGA 2B5WA 1YL5A 4IGFA 4D3DA 4RPLA 2HJRA 4O59O 3H5RA 4U7WA 3CZMA 5AOVA 3TN7A 1HDZA 4YRDA 4E2ZA 4K9DA 4RCVA 4FBGA 3LT2A 1AN9A 3TWOA 4LK3A 2HMUA 3E9QA 3KBOA 3NGLA 2D2IA 2OP1A 3FNFA 2B5VA 2JKVA 2B4TO 3PQEA 1R12A 4FFOA 3C1OA 1XHLA 3Q3CA 1KETA 4FR5A 4DC0A 4IDFA 4BMVA 1YE3A 2VTEA 4WUVA 3QJ5A 3OA0A 3HADA 3W1VA 3ZWOA 3K92A 3LVFO 2JD0A 5G0TA 1U8XX 1MC4A 3WGGA 1Q7CA 4DPLA 4WNCA 3E8XA 3JYNA 4WLNA 3L07A 3GGGA 5JPIA 1U1IA 5DOVA 1V3TA 3INTA 1JLLA 1PGQA 4NR0A 2OBYA 1AGNA 5TT0A 3RUDA 4JBHA 2NVBA 3QP9A 3NT5A 5DBGA 1ZMTA 1PJLA 4XGNA 5JO0A 1E1LA 3ON5A 4PG5A 5IDYA 3I23A 3KSUA 2E4AA 3WGHA 3KYDA 4B3JA 1B3RA 2D0IA 2NQTA 2BFAA 3HWRA 1DFIA 3JD4A 1VM6A 3QVSA 2R00A 4HWKA 1WAMA 2OO5A 4NFSA 4Y6RA 2PV7A 2YDXA 1OZAA 2W2LD 3WBFA 3BMNB 4BIIA 1ULUA 1NQ5A 3HDYA 2DM6A 2VYND 3PZBA 4FFRA 4I9HA 3OIDA 1LX6A 1OOEA 2RBEA 2F00A 1IHXA 2I3GA 3UUWA 3E5MA 4XDZA 3VDQA 3GGOA 4BUCA 4D44A 3OJFA 1QV6A 3W8FA 1SC6A 4WCFB 3DFUA 1DO8A 3I4CA 1VC2A 1MFPA 4F6CA 3ANLA 4LCEA 1BHSA 3ULKA 4DREA 4IMPA 1HE3A 4R41A 1CWUA 1YL7A 3BHIA 2WDZA 3PPIA 2BGKA 5DCWA 4XQEA 1LDYA 3QVXA 4XKJA 4BNIA 1P31A 3I3OA 4Z3KA 1EUZA 4I8XA 4NBTA 2ZKLA 5ENDA 2H9IA 3QVOA 1I0ZA 3NDRA 1HETA 2VT3A 1DIHA 1ZK0A 6ADHA 1WWKA 4WE3A 2P9EA 4GMGA 3VHRA 2V6FA 2C20A 5AXCA 1E7QA 1XR3A 3EZYA 5IXYA 3GVPA 3KSDO 5CAEA 3CSDA 3TL3A 2VNAA 3MZ0A 4QEDA 4NI5A 3KEOA 4XR4A 4E0BA 1EVZA 5F3RA 2W98A 3GUYA 3FNGA 5L7WA 4Q3DA 1EVJA 3LQFA 3HDHA 5EL0A 4GQAA 4HKTA 4ALNA 4CL8A 4DQXA 4FFLA 4MVJH 1P33A 1DBVO 3VVCA 1YQDA 4BO5A 4YJHB 3VDRA 1Z82A 4UUNA 5A1TA 5IZ4A 4YCAA 4DYVA 4MKRA 2Y1GA 3MEQA 4EUHA 5KCZA 1YB5A 3KLPX 1YRLA 2NTJA 3D4PA 1I24A 2HMWA 1QRRA 2EV9A 4MVJD 5JBIA 1LQUA 3H2ZA 1B14A 2QQ5A 1LDEA 1ISJA 1E7YA 4YTEA 2FZEA 1YKFA 4NZ9A 5T8KA 2HUNA 4QX6A 4WASA 5TIIA 5FF9A 3PGXA 1P3DA 2PD3A 3RBVA 4BGEA 3NKLA 4CLOB 1BXKA 4XYBA 3ZWXA 5JYEA 3WDSA 4GH5A 3TNLA 1WZIA 1YO6A 3Q2KA 1PS9A 3QW2A 1ZEJA 2AHRA 5COQA 3TPCA 3WGQA 4ZJUA 2DVMA 5BQFA 2P4HX 3IS3A 4EYEA 4PGFA 3G79A 1MG5A 4AFNA 4IMRA 1NPTO 3UH1A 2A4KA 2EEZA 2D1YA 1HDXA 1TXGA 1HL3A 3EDMA 5DN9A 5T64A 5U1PA 2Y66A 2VTDA 4L75A 3F4BA 4GWKA 3AU9A 3H9JA 5IN4A 2PY6A 3PLRA 1ZCJA 1P1HA 5EPOA 2CZCA 1N7GA 4A2CA 1W6UA 1UXIA 1U5CA 1UZNA 4FFNA 1ISIA 1IY8A 2X5JO 4JN6B 1C14A 3BHMA 4J91A 4Z6KA 1EBUA 2GPTA 2HKIA 3GDGA 3N74A 4IJUA 4E5MA 1VJ0A 1PGNA 4GX0A 4TRRA 4E5YA 1LA2A 1C1DA 1ZK4A 4E32A 4U6SA 2D5CA 4Z0HO 3HJAA 3QWFA 2TMGA 3F9IA 2JHGA 3D1LA 4E2XA 3ZHBA 4J4TA 3VH1A 1YS4A 3GUCA 2HLPA 4BNYA 1UAYA 3UCXA 2WJPA 4GVXA 1VRWA 4E2WA 2GUGA 5K6AA 3FF4A 1ONPA 2JFHA 2QRJA 1QXSA 1ENOA 4PN3A 3GEMA 1OMOA 4FSHA 3Q6IA 3PWZA 2G17A 2VZ8A 1U28A 1SZJG 1HE5A 5AXAA 1NVTA 3WOHA 4M54A 4WEQA 2EF1A 2GYYA 3LC1O 1I3KA 2Q3EA 4QUKA 1LSSA 1Z74A 4UREA 2NM0A 4J6FA 4QQRA 4E5NA 1W4ZA 2WSBA 2CF5A 4WEOA 3V1UA 4GLLA 3ZI0A 5EQDA 3WGOA 4ILKA 3V2HA 1X7HA 4P38A 3FBTA 1R4NB 1HDOA 1Z75A 2J3JA 4C7JA 3KXDA 3IJPA 4OH1A 3AFMA 1RYDA 5A9RA 1DSSG 2VUUA 3AY3A 4AL4A 4DBZA 7ADHA 3JQFC 3ZU5A 2HK8A 1XQ6A 4AJIA 1BXGA 3H6KA 1Y8RA 1WXDA 3PJFA 1T4DA 3LU1A 5DCYA 5A9SB 4BNJA 1X1TA 3EHEA 4PRLA 1Z6ZA 4MKZA 2EG9A 3H5NA 1HDCA 3S8MA 1JU9A 4FOSA 2HAEA 1J0XO 4CLRA 5JDCC 4HNGA 4XIJA 4B7CA 1I5RA 2JCXA 4FFMA 1PL6A 1A7KA 2FHSA 5L3ZA 3E18A 5I8ZA 4AJPA 2PLAA 1P77A 3W4KA 1DIBA 2OP0A 3PHIA 4PLVA 5ILGA 3IC5A 2QHXA 3U62A 3ADOA 4OQZA 1A4UA 2FWMX 1DIGA 1W73A 3O26A 2O3QA 2OL4A 4GPD1 3FN4A 4PLZA 6LDHA 2NWQA 1Q0LA 3MJ4A 2VCYA 4TMFA 4RV9A 1Y5MA 2JCYA 4LMPA 1O6ZA 4HX5A 3ETEA 4BHTA 5CDSA 5L45A 3NEPX 5L95A 1K6XA 2R2GA 3GHYA 1E77A 2CDAA 3WFIA 4WOKA 4BNTA 2YZ7A 2DT5A 3I9KA 3DL2A 4W7IA 4TSKA 4JXKA 3HSKA 4RF4A 2QZZA 2C82A 1A72A 4GVLA 4W82A 1EDZA 3V1YA 1RM0A 4IDBA 4CMIA 3VZPA 3L4BA 3INRA 1NFRA 3PVZA 4D42A 1GQYA 1SCUA 4G65A 3GDOA 4QFDA 4CQLA 5JSFA 4RZHA 5I7VA 4XGIA 2JL1A 5IF3A 1M67A 3A28A 4QO7A 2CD9A 3C1AA 3C3XA 1LI4A 5C7IO 3KYDB 4YB8A 4OOFA 4PLGA 1YB1A 2C07A 1BSVA 3MOIA 5EJ2A 1ZW1A 1T4BA 2AW5A 4JJIA 4DTIA 1PR9A 5F21A 3BTVA 4OXKA 4JK3A 4JJGA 1DLJA 4CMEA 4Z0PA 1LSOA 4EJ6A 2QIOA 4E21A 1EQ2A 4LSMA 4MVJM 1B26A 5DNAA 5GZ3A 3RAJA 3ANNA 3KZVA 2BHLA 1LC3A 5B4UA 2CDBA 5EMHA 4HUJA 4ID9A 4KMSA 3ANMA 5H81A 4WJZA 5JAIA 4M1QA 1E7WA 3NAQA 3MJVA 2IYPA 4HFJA 4BGUA 3R1IA 4ONEA 3DMTC 1CETA 3BMQB 2WYUA 4W99A 4WOJA 4CR8A 4YRAA 3C7AA 1X1EA 2QYSA 4E3ZA 3KETA 1C1XB 2HQ1A 2QZ9A 2YUTA 1WMAA 1I30A 5A9SA 2E6UX 4CMAA 4RVDA 1DEHA 5H83A 2B4QA 1KOLA 1I8TA 3BMOA 1ENYA 1E1KA 1O9BA 1W8DA 2EP5A 1DAPA 4G5HA 4A73A 3FWNA 2WMDA 1ID1A 2I65A 3F1LA 1DIRA 3W6UA 1QYXA 2VHZA 4RQTA 5A5EA 4XIYA 3VOSA 2BI7A 2ZJ1A 1NASA 4HP8A 2GNAA 1JA9A 3DZBA 1X7GA 4YQZA 3AI3A 3LZ6A 1ZFNA 1F12A 3H7AA 3DZGA 2GASA 3HDQA 3WNQA 1OAAA 4FJ1A 4QECA 1E3WB 4IUYA 4J49A 4RL6A 2P68A 4LGVA 3K5PA 4RDIA 4NK5A 2NQ8A 2OORA 1BWSA 4W7HA 4YPOA 3DMYA 1E1MA 3H9EO 2FRDA 4MP8A 4DC1A 3VZRA 5CPBA 4DIBA 3DZHA 5G0SA 1U4OA 3Q11A 1HZJA 3VPSA 1NFQA 3GF4A 5KJ6A 2VHWA 2D4AA 1U3WA 3PYLA 3MJCA 4OO3A 4IINA 2Y1CA 1GEEA 1UZLA 1GZ3A 2GZ3A 1YH3A 2PZKA 3BMOB 4E13A 3JQFA 4XCVA 3HN7A 4BB5A 3GG9A 1FDSA 4C4OA 2P2SA 2PD4A 3E82A 2B83A 4R5MA 4ITUA 5JCJD 4B7XA 2IXBA 1BGVA 3C85A 3PFWO 3WQSB 1UXHA 4ALLA 3L4BC 2BGMA 4CMJA 1Y8RB 4YJFA 3GVIA 2HMVA 2Y68A 1P1IA 1F17A 1SB9A 1D1SA 2EKQA 1B3BA 4FS3A 1G6KA 1GD1O 1R66A 3DAFA 3IAHA 4CLXA 2XOXA 1SO8A 4O0LA 1DIAA 3JQ8B 4I5GA 1ZXLA 3O4RA 4AJ2A 2E37A 4BB6A 4INAA 3ASUA 1JKIA 4M49A 3LLVA 3DTYA 1B16A 4F6LA 3RUHA 1VE9A 1IULA 1BRMA 1LSJA 1X15A 4ZRMA 2P5YA 4I9UA 5BR7A 5JXWA 1IOLA 5ENVA 1KVTA 4CQMA 2Z1MA 3ADPA 5LCXA 5TF4A 1YL6A 4BO0A 2CFCA 3AWDA 1F8FA 3QRWA 3ITDA 4D41A 2IZ1A 1R0KA 2DFVA 3KYCA 3RFXA 4G2NA 1IL0A 4JBIA 5TRTA 1ARZA 5I8WA 3RKUA 4DPKA 3TDKA 4A26A 2DLDA 3NUGA 3STHA 3U3XA 1IPEA 4P22A 4E5KA 1XG5A 3RIHA 1Y9AA 3E9MA 2PD6A 4YR9A 2QRLA 1F06A 3B1JA 3P5SA 4BO8A 4CMHA 4XQGA 2G0TA 3PDJA 5AVOA 2GSDA 4XB1A 2FY8A 1GPDG 4HNHA 2AEFA 2AG8A 2HRZA 1E5LA 5A3JA 1CQIA 1TA4A 2C7VA 4CLRB 3CPSA 4BGIA 4YXFA 4DVJA 2C2XA 5TQVA 4R3NA 3PHJA 3M1LA 1K5HA 3B1KA 3RKRA 5BNTA 3AJRA 3NDJA 3ROKA 3H3FA 5HTOA 1M2WA 3HB4X 1LNQA 1EDOA 2WD7B 3GDFA 1FDVA 1D3AA 4BO3A 3OQ6A 3I9NA 2WEKA 4M89A 3M2PA 1SB8A 1N9GB 1CDOA 1K0UA 4Y6SA 3A06A 4IY1A 4NMHA 4W9NA 3K96A 2O2YA 2GGSA 1EUDA 4PLPA 1C0LA 4MVJE 3H9QA 1UZMA 2ZQZA 1ZBQA 2WM3A 4Q3AA 1ZIDA 3EMKA 2EGGA 4FGWA 2CY0A 4U5QA 1T2DA 1Z7BA 4WPGA 3ZWCA 4BNKA 3OEYA 2UYYA 1MB4A 2B0JA 4OMUA 2Q1UA 2NACA 2YFHA 1WDLA 3I6QA 4N5MA 4QSMA 5A03A 4HFRA 2DTXA 5JNLA 3WG9A 3TOXA 2Y0EA 3FI9A 4QO8A 1HZZA 3ZWMA 4EEZA 4L73A 1P44A 3G49A 1YBMA 2W2KA 1BG6A 1UXJA 4E6PA 3DONA 4D7AA 3OIGA 4OHUA 5JDCA 2LDXA 3AOEC 4ZICA 1GUZA 2HRBA 4EI2A 5A05A 1PZHA 1T26A 3P19A 3WGIA 3OJEA 2CNBA 3PWKA 3JQAA 4FGSA 5IZCC 3AI1A 4GX5A 4IDGA 2EGHA 3O03A 4BNXA 1LBEA 4JP3A 2X9VA 1KS9A 2PGLA 2GN6A 3E03A 2JD2A 4CV0A 4GI2A 3DOJA 3IMFA 2ZTLA 2BH9A 2VHVA 5FWNA 5L7TA 3UKOA 1WP4A 2IZZA 1ISGA 3QVWA 2PZLA 5B4TA 1DDOA 2C2YA 3G17A 2EHDA 2YW9A 4YA6A 3WJ7A 1PEDA 1GV0A 2GN8A 3DZIA 3TF5A 4IXTA 4NDNE 2NSDA 5I7EA 5T6BA 3INGA 3ST7A 1YB4A 4DIFA 1ORRA 5I9NA 3FR8A 1PQPA 2GRAA 3C8MA 3JYQA 2W2LA 1DFHA 4N5NA 4X54A 4WKGA 1M6WA 1UP6A 3R3JA 1ZKMA 5THQA 3RFTA 1HDYA 1V9LA 4Y8VA 3AOEA 4YQYA 3UW3A 1XSEA 3K30A 1TEHA 3MJSA 1PJQA 4CUKA 1FDWA 4D43A 1I01A 2VUTA 1YBVA 2Y99A 4MP3A 5U9CA 1XU7A 3RJ5A 3PYMA 1LDNA 5CEEA 1PWXA 1SAYA 4LCJA 4NJMB 5C7OO 2IXAA 5T67A 1O95A 4IZHA 5F1PA 1DC6A 3E6AA 4DL9A 1T1SA 1NVGA 3H4VA 3TZHA 4NJMA 4UVEA 2W8ZA 4KP7A 3JYLA 5JFOA 2X6TA 1S7CA 3SLKA 1BMDA 4YAJA 4YT2A 3RJ9A 3AM5A 1GPJA 5HBRA 3ZWAA 3QWHA 3OIFA 1U3TA 3NJ8A 5TX7A 3D3WB 4R5HA 2JCVA 3LK7A 2VYVD 1PGPA 1NWCA 3BTOA 4MO2A 4KTVE 4F3YA 3GPIA 3OSUA 1N1EA 4WLFA 4Q3CA 3F5SA 3EK2A 2FR8A 3C7CB 2OZPA 4OXNA 3D5TA 5DF1A 1SPXA 3K31A 5A06A 2PKQP 1JVBA 2NADA 1WLYA 2C0CA 1PJ4A 4J1QA 4EUFA 1D7OA 5FEUA 3SC6A 4G81A 5IDXA 1WVGA 5TSDA 2AA3A 3G0OA 5GZ1A 5BNIA 2VHXA 4M87A 4XB2A 1B15A 1LLDA 1RM4A 1R37A 3AUSA 3HZZA 1ISMA 3GZNB 4Z0TA 1NM5A 1HF3A 5L4LA 4RORA 2DBZA 3GOHA 4XR9A 3GRKA 3IDSA 1FF9A 4TQGA 3I4FA 5CEFA 3WX0A 1FXSA 2HK7A 4TVOA 3EC7A 4NBWA 3R6DA 4DMLA 2B4RO 4J90A 3WGZA 3LF2A 4CMKA 2O3UA 3PZRA 5DP2A 1O8CA 2PH3A 2X0NA 2VWHA 1J5PA 1H94A 4PRKA 3WQQA 1B7GO 4DRYA 4BO2A 5TS3A 3H9UA 4IM7A 3PIIA 3BZUA 1R15A 4A27A 2V7PA 1A71A 2PK3A 4CR6A 1R16A 1QMGA 1CEQA 4ALKA 2DKNA 4PVDA 5CP8A 4ZHSA 4YRBA 1FMCA 3A14A 3ETDA 1SEVA 1ZSNA 2EWMA 5DT9A 4BS9A 5AXDA 2A94A 3CIFA 4K6CA 4IBOA 4EITA 4E5PA 4E4YA 5KJ1A 1NQTA 3B1FA 3JYOA 4MVJF 3RUFA 3DAPA 1UP7A 2RH8A 4Q3EA 1BXGB 2NVUB 5HWSA 1ENZA 1HE2A 1MXFA 1UP4A 3DOCA 3IIEA 4CMEC 2EKPA 4IQGA 2Q1WA 4MVJA 1G1AA 3ZWPA 1ONOA 3WNVA 2UUPA 2R00C 2BFPA 2Q45A 1CJCA 4HBGA 4KWHA 2IZ0A 4NNJA 5T5QA 3MWEB 1I3NA 3W8EA 2J3IA 3D3EA 1KEPA 2ZCUA 2DTDA 5MDHA 2BF7A 5A3VA 4DPMA 2AE2A 1Y81A 4J1TA 2E48A 2O23A 3KSZO 3FSRA 2EXXA 2HMTA 4KQXA 1I2BA 3IUPA 1Q0QA 4K1LA 1J49A 1IZ9A 3JD0A 3BMCA 4J4HA 4L8VA 1N7HA 4TWRA 2VZ9A 2JJYA 1JAXA 4OKIA 1H9AA 4S3MA 4CM8B 4OJNA 2ILTA 5A4DA 3VPHA 2R6JA 2POQX 4RJTA 4HXYA 1KVQA 5CPFA 2JHFA 1H93A 1NHWA 2RH4A 3EZLA 1HTBA 1XA0A 3OQBA 5KVQA 3GC6A 1NYTA 1PZFA 4BOYA 5KVVA 4FCCA 3KRTA 1FDUA 2X9NA 4FC6A 5I7SA 4TRJA 4NPCA 2D3TA 4D46A 1QYDA 2CF6A 2ZTMA 3ZV6A 5F5NA 5BNFA 3CUKA 4OQYA 1GZ4A 1QV7A 1M66A 2AMFA 2EP7A 4KTTE 4RF2A 1JWAB 1VSVA 4R1NA 4AJHA 1WDKA 3VH4A 3JQ7A 5B37A 2NTNA 1UH5A 3JTMA 1XELA 3D5QA 2HMSA 4XDYA 2Y0DA 4EJMA 1EEHA 1HE4A 3JQ9A 1OFGA 3SXPA 1E6EA 3K2BA 1H6AA 3ONFA 5G0WA 3TFOA 4LISA 4KOAA 1O0SA 4D45A 3FTNA 4BO1A 5JS6A 3I6IA 3G1UA 2O2SA 1HWYA 3OEWA 2Q1SA 3KM0A 1B2LA 3RBXA 2JFGA 2ZK7A 1X0XA 1ZH8A 5T57A 3UGKA 5DBIA 5F1OA 3QVTA 4YAIA 5KOIA 2DU8A 2PWZA 3ASVA 1ZK2A 3H3JA 2AQ8A 3KO8A 5EQFA 5CHEA 4RVSA 3TOZA 3PHGA 3R0IA 3DBRB 1HLPA 2I66A 5TGDA 1T2EA 1TB4A 3R3SA 4R68A 3U5TA 4KDEA 4DQUA 1RM3A 1JQBA 1C0IA 1PS0A 4WCDA 4BO7A 4YJFB 3C1TA 1YXMA 5IN5A 4CM6A 2Q2WA 1EK6A 5HS6A 4K26A 2YQ4A 4H3VA 4XEHA 5ICMA 5JY6A 1F14A 3U0BA 4BGVA 4BKUA 2O3TA 5KKCA 4WCFC 3JQ6A 2OGUA 1TT7A 3DDNA 3EVTA 2OBNA 3BXXA 1T2CA 4RVGA 1E3EA 3GN2A 2DTEA 2VZ0A 3OJ0A 4C7KA 3ONEA 2JD1A 1HDGO 4YBZA 1QR6A 3IP3A 1IHYA 3F4LA 5L40A 5JW6A 1O94A 2C29D 5JLAA 1E3SA 4RPGA 1EMDA 3NTQA 5MGBA 1E3IA 4GKBA 1CF2O 3M1AA 4B4OA 1T1RA 3T7EA 5KIAA 2BFOA 2RIRA 4LMRA 3ORFA 4XQ9A 1PIWA 3BTUA 1NR1A 2IEDA 1A9ZA 2I5PO 3CXRA 4YWJA 1DFGA 2EW2A 3P2YA 3ZWWA 2VYNA 1SBYA 1ZO8A 3JD2A 3DBHB 4RQUA 3G1TA 1U8FO 3GH3A 3CMCO 1O89A 3ZN2A 1NQOA 2ZYGA 1EQUA 2FOIA 1U7TA 4LRSB 1CERA 1F0YA 1EFKA 1ML3A 1KC3A 1NXQA 4BO6A 4HFMA 3SC4A 2YV3A 2D8AA 4AJKA 2EKLA 1Q7BA 2WD7A 3ICPA 3HHPA 3JQ9C 4L0QA 2FN7A 1G0OA 1HYEA 3ZU3A 4WK6A 4XYGA 1X7DA 5C3MA 4BNZA 3D4NA 4JROA 3RI3A 4HFNA 2FMUA 4FW8A 4YEDA 3GN1A 1JN0A 3RASA 2PFGA 3GK3A 2GZ1A 1LRLA 1JWBB 1PJBA 4OYRA 2C5EA 4FIZA 1PL8A 2VOEA 1ENPA 1LDGA 2Q2VA 3K9QO 4FOOA 2F1KA 4OL9A 4QT0A 2SCUA 3W4JA 3S2FA 3V5NA 3ZWYA 2EJWA 1GUFA 2D59A 3H9GA 1XDWA 3F1KA 2GD1O 3H5AA 3PI7A 3GFBA 1BVRA 2HK9A 3ZNNA 3ZNPA 1NR7A 2Y1OA 4W6ZA 3MTJA 4RZIA 4CM9A 2W4QA 3AUAA 5A04A 3AY7A 1SEPA 3ZWNA 3GNTA 2NVUA 4JX8A 4DGSA 4R1TA 3DHNA 3RBZA 4J3FA 4OSOA 3SJ7A 3A9WA 1WPQA 3DBVO 1ONNA 1PGOA 2B37A 2GZ2A 4NFHA 4MDHA 3WS7A 2NVWA 3RC2A 4O63O 4O1MA 3PJEA 1ADFA 1YWGO 3MOGA 3I9JA 2VUSA 3HE3A 5C5IA 4ZRNA 1LC0A 1QSGA 4JGBA 1RKXA 1DOHA 3JQDA 1NPYA 4BNGA 1MA0A 3JQ7B 1FDTA 4NBVA 1KC1A 3UXYA 1XWFA 4HADA 4J9UE 2B69A 2XAAA 4DA9A 4UUMA 1NAHA 1VKNA 3QLJA 1GQQA 4QFCA 3EW7A 3QSGA 4UVHA 3ZU4A 2VRCA 2C59A 2D5AA 1LUAA 1GADO 1P0CA 3CZRA 4IIUA 3GVXA 4P4LA 3I1JA 1MUUA 1I33A 1EZ4A 3NYWA 3OJOA 4JCOA 4MKXA 4NH4A 3SBOA 4YAKA 2WE7A 3UVEA 1AUPA 4DLAA 3FPCA 5TJ9A 1OBFO 2AXQA 2YJZA 3C7DB 1WMBA 4IIVA 1GR0A 3K2EA 4Q9NA 3BMQA 3CTMA 3NTRA 2Z1NA 3P2OA 1DJQA 4M86A 1GFSA 1XKQA 1DJNA 5KVCA 4AJNA 4Q3NA 2I67A 1GAEO 4BNMA 3O8QB 2X9GA 3HG7A 3JQCA 2HSDA 4EZBA 1J4AA 3T4EA 1JW9B 3JQGB 3VVBA 1I2ZA 3KOUA 4XX0A 5TNXA 1B8UA 1A9YA 4GLOA 1PJTA 3L77A 4BQRA 3ZDFA 1GV1A 4CMCA 3K73O 4A03A 4HV4A 1LLCA 5IFLA 2AEJA 3PJDA 1R0LA 3JV7A 3WTCA 2BI8A 1LLQA 4R1SA 1FJHA 4WLEA 4XJSA 4PLWA 1D8AA 1A5ZA 3TL2A 4F45A 3HB5X 4AG3A 2X5KO 5KJFA 1BDMA 3OICA 1PSDA 1PJSA 3DZFA 1KVSA 1VPDA 2BGLA 1WNTA 4H15A 5L53A 4CQMD 3VTZA 2XXBA 3GA0A 4R4JA 1U2GA 5JAQA 1IPFA 2O3RA 4UULA 4J9VA 1Z7EA 7MDHA 2Q2QA 4PLTA 1G0NA 1ZUD1 3PLNA 2HJSA 3WYEA 4RF5A 1KERA 4ZQBA 4YVFA 3SVTA 1HRDA 1PGJA 3D7LA 4OOEA 1FK8A 3D4OA 1GL3A 2JFFA 2CVZA 3GEDA 4PZDA 2H1SA 2Q4EA 5COAA 3DHYA 3TQHA 4R9SA 2ZB7A 3M2TA 5JYDA 1QYWA 4A5OA 1ZK1A 4BNWA 5K0ZA 3EY4A 4D3SA 2I9PA 1ZXBA 3I83A 4XWYA 3TZKA 1CQJA 1GYRA 4FN4A 3WIDA 1RPNA 3GAZA 1ISHA 5HS4A 2J5KA 4XD2A 3Q9NA 4KUGA 3I5MA 2Y93A 4CV1A 1VJTA 3WQRA 1GYPA 2PZMA 4TKMA 3KB6A 3E5RA 2PH5A 5BSFA 2RAFA 1OC4A 2OFPA 4NK4A 4NBRA 4FJ0A 2DQ4A 3F3SA 4IGEA 4U8GA 1VI2A 1PJCA 3D64A 3DB2A 3UAGA 1NP3A 1JTVA 1DXYA 4DXHA 4I08A 4DYDA 1AXGA 1U9JA 1H2HA 4R1UA 1R4MA 1QLJA 5DCUA 4CM1A 1PL7A 2Z95A 3AI2A 3LDHA 4I5DA 5JCXA 2UUOA 1PWZA 2V6GA 3HUDA 1BW9B 1TI7A 2BLLA 4TROA 5IDWA 4TZTA 2V65A 2ZTUA 3ITKA 3BAZA 3L0DA 3VH3A 1I2CA 3MWDB 1ZJYA 1DAOA 2E49A 4BNHA 4E2YA 2AG5A 3IP1A 1XU9A 3PQDA 4BV9A 1CYDA 2DPHA 3TFQA 3W4IA 3RU7A 3ZW9A 3VTFA 2NNLD 2I6TA 4LW8A 2O50A 5COBA 2FPPA 3GZNA 3ZH2A 2O7SA 2NUAA 4ND5A 1PS8A 2P4QA 1H6BA 2X58A 3DOOA 1LDMA 4PZEA 2XPCA 3FTPA 3O38A 2P9CA 3RC9A 4GX1A 1L1FA 4E31A 4CM4A 5JY1A 2PGJA 4J1SA 3QWBA 4R01A 3GR6A 4CR7A 1E3WA 1YDWA 2B36A 2X5OA 3LSYA 1U3VA 3F5QA 3PTZA 4XJTA 4ESOA 5KNLA 1E1NA 1PQUA 2EIHA 4PIVA 1V8BA 3WJAA 1U2DA 1VLLA 3GAFA 3PDUA 4D0SA 4Z3DA 2CVOA 4BKQA 5BSHA 2Y1EA 1P1RA 1PZEA 1E92A 4EW6A 1HYGA 4YT8A 4R9RA 3JQAB 1I10A 2YFQA 3T7CA 1WW8A 3MCVA 2E82A 5L51A 1X0VA 1O5IA 4UVDA 3ZW8A 4BKOA 2O7QA 3F6YA 3S1LA 4UEJA 4XZ3A 4ND2A 4R16A 1HDRA 4ZVVA 3T4XA 3UCFA 4KDFA 2O4CA 1LRKA 3IKTA 1GDHA 5LDHA 3ICCA 2GN9A 3DZKA 2X0JA 3WR5A 1SOVA 4JQCA 5A02A 5K9ZA 1EUCA 2DFDA 4RVFA 4XYLA 1ADBA 1OC2A 4II2A 5FYDA 1LQTA 1GUYA 3X2FA 3CH6A 5THKA 4M8SA 2IRWA 3PP8A 2FP4A 2QYTA 3VPFA 1YJ8A 1B8PA 4YACA 1P9LA 3RCBA 4BVAA 2IODA 1IUKA 4PZCA 1VKOA 1T24A 1R4MB 3ROQA 1KY4A 3RUEA 4CLDA 5IJZA 3UOGA 1H9BA 4P8RA 4BKPA 3TSCA 4BV8A 1XCBA 3QQPA 5JMPA 3TZQA 5B12A 3B70A 3FCOA 4ALIA 2J8ZA 4B79A 1L7DA 3LF1A 4NG5A 2CUKA 3EYWA 4MVJI 2ZQYA 4LN1A 2HU2A 3DO5A 2X0IA 3H8VA 5G4KB 2C7GA 3V2GA 1NBOA 1Q2XA 3AFNA 3ZHZA 1XYGA 1E5QA 4WNIA 2HCTA 1NHGA 2JAHA 1L7EA 1P0FA 3D0OA 3PK0A 4AJ4A 1BTOA 2IDZA 3V1TC 4EDFA 3JQBA 3WXBA 1YVEI 4PLYA 5ILOA 4CMBA 1P1KA 4NU5A 3U09A 2DBQA 5JO9A 4TKLA 1KEUA 4O6VA 4OSPA 3IL2A 1Q1NA 4K6FA 2PTGA 2NU7A 3GVHA 3WBBA 4N54A 1LSUA 2X7HA 3QHAA 1H6DA 3AK4A 3ZV5A 2VHYA 4ZA2A 3NGXA 4BNFA 2WD8A 1V6AA 1HEUA 3KYCB 4PVCA 2J6IA 3MJTA 2ZB4A 4N5LA 2BELA 1JAYA 1QYCA 1AXEA 1UXGA 2Q46A 5IG2A 4BNVA 3WGTA 1I3LA 2A35A 1PR3A 1Y5RA 4WLOA 1P45A 4GWGA 4I9NA 5ITVA 1S6YA 1UDAA 2FPIA 2O4UX 1YOVB 2Q50A 3Q2IA 3FR7A 1GY8A 1PX0A 1ADCA 3WIEA 1BVUA 1MXHA 2PZJA 3NV9A 4WECA 4BO9A 5BSGA 2GO1A 5L9AA 1EE9A 3GMSA 4NBUA 5DP1A 4NIMA 4XGKA 3DZJA 1TVEA 3NJ4A 3W6ZA 1U5AA 2A92A 3OBBA 1N1GA 4YJGA 2VRCD 2VWGA 4WLVA 4E30A 1V0JA 3GG2A 3IJRA 3RSHA 3ROPA 5GMOA 1E0DA 3FHLA 4H7PA 1HLDA 2EJVA 4CV3A 3GMDA 4XRRA 2RHRA 5TJHA 1JVSA 3U4IA 2YYYA 4TRMA 1LXCA 4GBJA 2YHIA 4F46A 3Q1LA 2FSVA 2LDBA 3LC7O 2O3JA 2AQIA 1HYHA 1DRWA 2DPGA 1KEWA 3OF2A 3OM9A 4UVGA 3DBLB 3NTOA 2X1HA 1Y8QB 4YAGA 1C3VA 1E7MA 3LT4A 1PJ3A 1LDBA 1ZMOA 4OIMA 4DQVA 4FQ8A 4B8WA 3DWFA 1Y1PA 4RF3A 1NWHA 5FI3A 1QLHA 1DRUA 2OOSA 2C5AA 4L76A 3RD5A 4AVYA 2XF8A 5TLSA 2YV1A 4JIGA 1VSUA 3BHJA 2PGDA 1X13A 3L6DA 3WWZA 2G82A 1CRWG 4H16A 4YT5A 4BNUA 4E12A 4EEXA 4URFA 4AJ1A 3BYZA 1DPGA 1RJWA 2I99A 5DDIP 4B3HA 1B0AA 4J7CA 2IE0A 4MIEA 1P74A 4L4SA 2WTBA 4I1IA 2RCYA 2BRUA 3DMTA 3RUIA 3VKUA 1BXZA 3AY6A 4WLUA 4NJOA 4PLHA 5ER6A 5L7YA 5CG1A 4ZU3A 4CL3A 3CEAA 2UDPA 3FWZA 3ENNA 3FPLA 1MFZA 4BQPA 2I3AA 5HRUA 1D1TA 3DC2A 5EESA 4CQLB 4J2OA 4KQWA 2GDZA 3FRJA 4AJJA 1DC3A 3M6IA 1MGOA 5LC1A 1F8GA 2FZWA 3DXFA 1DHRA 2X23A 3DBLA 4IS3A 3E9NA 5IXSA 4GGOA 1PTJA 1T2FA 4NQZA 3FNHA 3UF0A 3JD1A 3VPXA 4UAGA 1IE3A 4RGBA 2X4GA 4YJHA 3QE3A 1P1JA 1Z73A 4RPJA 2NU6A 1N2SA 3TRIA 2IEBA 1KEVA 3EVNA 4WGGA 5CDYA 4FFPA 1KIFA 1ULSA 3U4CA 2GN4A 2Z5LA 4PG6A 4ZQHA 1LLUA 5K6AC 3KLMX 4UEKA 5JDIA 5L4NA 4GKVA 3KVOA 4W4TA 2FSSA 1DC5A 4CQMB 2Y05A 1ADGA 1ZSYA 3MJEA 3OETA 4MOWA 4PLCA 1BW9A 4A0SA 3L6EA 2ZIZA 4A7PA 2AQHA 1LU9A 4Y6PA 4IPTA 1KVRA 2J5RA 3H2SA 4EUEA 3KTDA 3ZZNA 4PG8A 3CE6A 3OA2A 3VZSA 3E48A 3IOYA 2BMAA 2HDHA 5LDGA 5T8KC 4BL5A 1I32A 2QW8A 4MIYA 3RUCA 1XEAA 3GEGA 3WB9A 3PEFA 3WICA 5C7LO 2W2KB 3K6JA 3PIDA 3B20A 4XA8A 3DAGA 1Y8QA 5EINA 5HA5A 4Q3BA 1AE1A 3H65A 3PRJA 4TZKA 4CM4B 2DBVO 3PQFA 4DWVA 3OP4A 5I9LA 1PJ2A 3JSAA 1AHIA 4J7UA 4DIOA 3DQPA 3QA9A 3U49A 2AE1A 4R69A 4B4UA 5IAAA 5JDIC 1RM5A 1YONA 1YJQA 4QXMA 3PXXA 3PHLA 4WCFA 3NRCA 3OMLA 1U7HA 1NTOA 2YQ5A 4GSLA 4YT4A 2PKRA 5U4QA 3ZV3A 3ZCXA 1Y6JA 1J6UA 5ES3A 4NU6A 4II3A 1E3LA 5G4LA 3WMWA 5I7FA 1ZK3A 2O3SA 4B4VA 3WLFA 3AUUA 3CMMA 3S2GA 1NNUA 5CDGA 2AEMA 2BD0A 1PQWA 2J3HA 4UVIA 4ND4A 2NTVA 3RU9A 4KUHA 1NVMB 3K8ZA 1EK5A 4AICA 2Q99A 3Q9UA 1BDBA 3JQGA 1JKFA 1SMKA 2W90A 1WDMA 3PFFA 1T25A 3A4VA 3WTBA 4L74A 4IDAA 3PJGA 3I9OA 4CMGA 1V3UA 4EJ0A 3WYBA 3HQ4O 1U3UA 3VZQA 4IQ0A 2Q49A 3COSA 3RWBA 1W0CA 4JNKA 3TJRA 3GGPA 4MVJP 1QKIA 3EUWA 4CUZA 4RO0A 4CPDA 1WZEA 1JKJA 2GF2A 3L9XA 4TRNA 4ND3A 5B1YA 3SEFA 3VPGA 2O48X 4XYMA 3A1NA 4BMNA 1RWBA 3JQ8A 1EVYA 4OAQA 1GQ2A 3WLEA 5ITWA 1N92A 2VYVA 4DBVO 3ZNOA 3O9ZA 1KY5A 4XYEA 3GY0A 3L6OO 1T2AA 2A9FA 3PWSA 5JCJA 3RFVA 4A10A 2YY7A 4LVCA 4PCVA 4LRTB 1TT5A 3BMCB 4L4XA 1UR5A 1EVIA 3WYCA 5FFFA 4ZQFA 3DEYX 8ADHA 3GLQA 3VAZA 2OUIA 3QY9A 4J7XA 1VL0A 2GLXA 4NHEA 4J0FA 1GCUA 2DUUA 4YJGB 2I76A 1R0SA 1MLDA 3RVDA 2DBRA 3ZWBA 1DB3A 3WFJA 2J3KA 3BIOA 1I36A 4N7RA 4IQ8A 5DOZA 1Q7GA 5DZSA 4DLBA 1VL8A 1C1XA 5HM8A 1H2BA 4Y67A 4ND1A 2VQ3A 3AM4A 4CLEA 5FI5A 3ZWVA 1XQ1A 4CV2A 1M6HA 4U6QA 4B8ZA 4BMSA 2ZYAA 1E7SA 1R6DA 4UEOA 1YBAA 4K28A 3KUXA 2VWPA 5BT9A 3IKVA 2NU8A 3ETGA 4J16A 4TVBA 1UXKA 2ZJ0A 5JAMA 4AJLA 2ZATA 4P4NA 4CM9D 4D3FA 5G0VA 2OMEA 3TZCA 3SLGA 2ET6A 4FJ2A 1QG6A 3W8DA 3VKVA 1SOWA 1N8KA 4Z9YA 3L9WA 1N9GA 3RROA 3S55A 3GFGA 4CODB 4B4WA 4OM8A 2Q1TA 3U9LA 4D0RA 4I5EA 4DUPA 4YYZA 3U4HA 1NFFA 3OFSA 1HSZA 1TT5B 4JJFA 4PFJA 2UVDA 4DMMA 1HXHA 1C1DB 1DC4A 1ZZEA 3S2EA 3AUTA 2VNSA 2ZTVA 4RPHA 3GT0A 2X22A 3WSVA 2DUWA 1GEGA 1NX6A 1E7RA 3HN2A 2ZB8A 3ZV4A 5CFZA 4Y9DA 4JLWA 5G0UA 1QORA 2Y0CA 3I9MA 3JQAD 5KTKA 2P5UA 1C0KA 3O8QA 3NDIA 3LLSA 1KVUA 1OI7A 4PG7A 4HY3A 1YGYA 1ZJZA 4IJKA 5I9MA 3QV1A 5J23A 4CM5A 2XXJA 2DC1A 1MV8A 1SNYA 1HSOA 4Y98A 2QX7A 2RHCA 4L9RA 9LDBA 2UAGA 3SX2A 1ZNQO 3AOGA 5AXBA 5KJCA 4GL4A 4GSKA 1HT0A 4IJVA 1H6CA 4KUEA 3GRPA 5ER9A 2YDYA 3JQEA 1ZEMA 1GTMA 4ZGWA 5AQ1A 3VH2A 3KV3O 3IQDB 1XLTA 4QTZA 2HO5A 3HNPA 1JDJA 1NAIA 4UUOA 3GZ4A 3UHAA 4BNLA 2X0RA 3ENKA 3I9LA 2Y1FA 1Q0HA 3HDJA 3NT4A 3DR3A 5AYVA 1LRJA 3ABIA 2OXIA 3JQBC 3TZ6A 4RPKA 4RVHA 2FR1A 4XQCA 1U4SA 3DBRA 3VC7A 5BSEA 3N58A 1UUFA 1K89A 3I52A 5GY7A 4UUPA 2CMDA 1EE2A 4R3WA 4MP6A 4OXYA 4Z9FA 3JD3A 3OHSX 4LVUA 2NLOA 4J43A 1V35A 5KWEA 2Y67A 3NX4A 2JAPA 4CM3A 4IDDA 4IZIA 4EBFA 4O5OA 1Y9EA 4U0KA 3RQSA 4OKNA 2OHXA 4CLOA 2X8LA 2WE8A 3HFSA 5ICSA 3DTTA 4GX2A 1KYQA 4J0EA 5JC8A 4J1NA 1A7AA 5JMWA 2GR9A 3GHHA 3AM3A 3RUAA 1AHHA 4KWIA 1M75A 2H5LA 3BA1A 1RYEA 3ZU2A 1H5QA 1P1FA 1EBFA 3X2EA 4RLHA 3IUSA 3LYLA 3FD8A 2Q4BA 1B8VA 3ZGYA 3F46A 4U0JA 5G4KA 4RVUA 1E6UA 3GNSA 3WWYA 1EFLA 1MP0A 2J5QA 2P91A 2YHUA 3LT1A 1K2WA 4JP2A 3ZNQA 4PLFA 1ISFA 1YQXA 2PR2A 2GCGA 5JC1A 2VOJA 4CJXA 4ZQGA 3PHHA 5C37A 2B35A 1QYVA 1MX3A 1QP8A 3CKYA 3ONDA 4P4GA 3RC7A 3B6ZA 3BTSA 1UDCA 3SJUA 5B4VA 4B3IA 5JE8A 1DHTA 1GCOA 4KZPA 1IZ0A 1KBZA 2WYWA 3E1KA 3G3EA 1V3VA 4FD3A 4R54A 4YAEA 1H0KA 5TC4A 4FB5A 4S1VA 2DAPA 3ROMA 3N7UA 4LSWA 3DBHA 4IDCA 1TLTA 4MIOA 2QRKA 4ALJA 3OH8A 4Q39A 4J4BA 3UFXA 3ZHYA 2VWQA 4DLLA 2WYVA 1NPDA 1NQAO 3S2IA 2H63A 4MJLA 1VJ1A 1C0PA
chains in the Genus database with same CATH superfamily
4EYKA 1N32B 1IJFA 5TT1A 1Q77A 3DXXA 4CFSA 1OTYA 1T36B 2P90A 3OSZA 5CG2A 1S2IA 2ZCVA 3QIVA 4D8UA 4NPHA 1TPZA 1W581 2ZB3A 1AGRA 4YP1A 2V6MA 3L92A 4EL0A 5EJGA 5IJ0B 4O4IB 1YOVA 3MTGA 1LEHA 3D4BA 1IY9A 1AGPA 2NU9A 3G6KA 4ISBA 4HTFB 2VSQA 1CIVA 1M7GA 2QZPA 3CXUA 2ZB2A 3AKYA 1CG6A 3ZHXA 4RDHA 1H2WA 3N0TA 4MINA 4MWSA 3SC2A 4L50A 1Y7TA 1NR5A 3DMHA 4WNAB 3B1XA 1VG0B 3AW9A 1HFJA 1H2XA 3AUJB 3O4VA 4X60A 2RE8A 3MN1A 1T15A 2GWRA 3KFLA 3E81A 4WOCA 3VBCA 2XMQA 4GEGA 3FIJA 5CFQA 4R1MA 2RGAA 3RVBA 4KE9A 5LU8A 1YR6A 1R4NA 3D2AA 1K6EA 3UMMA 3UPUA 2B8JA 4D5EA 5HZGA 1XZCA 2IIVA 1UKCA 2OV4A 4XRGA 3BQMB 1N5MA 2XUFA 3FB4A 1P4RA 3LYHA 3M49A 3QWIA 1V5GA 3MNFA 2F9FA 3DHEA 5F5LA 3WMXA 3EMBA 2VN8A 3LC2O 2PKQO 3DJYA 3SHVA 4IS2A 3E5HA 1X14A 2JK1A 4LS3A 1W2WB 3P96A 4BNNA 4F4JA 5EJ5A 4W9NC 4QDZA 4YRTA 4ROTA 4WBNA 4P7JA 3NT2A 4ZDIA 3LBYA 1F3OA 3QIAA 4A0FA 3A3NA 1ZINA 4FDAA 4J3JA 4LHZA 4MVYA 2Q6IA 2VS1A 2R60A 4ENRA 1JZQA 2OCIA 3GFFA 1EYZA 3P45A 2PNFA 5G41A 1RMQA 2WWFA 1JG2A 3KYBA 4WBXC 3RG2A 3L4SO 4EKYA 4HLUC 3HXQA 2QJFA 1USKA 3OZDA 4RSGA 2WOJA 3QSYA 1ZSVA 1E3JA 5DBFA 1MG0A 3PL5A 5KKAA 1Z4QA 3EF0A 3HFRA 4RGQA 2JIDA 1L1RA 4I55B 4JBNA 4EGQA 3SQNA 1G2IA 4MYTA 4BRUA 2EGUA 1XROA 3VNVA 4WXMA 3WLHA 2G76A 4FHCA 3S8YA 4IXNA 1HKUA 1F5NA 5CEJA 1A97A 3T9BA 4Y6OA 1Z45A 1X1DA 1ZVMA 2AEEA 4ESHA 1XIVA 3N2EA 5DHTA 1JL3A 1MDBA 1XGKA 3QX3A 1FUIA 3C3WA 4MR8A 2PNJA 4EDHA 1DLIA 4U9HS 4FPXA 5E7JA 4NEQA 4CDNA 1QRDA 3OJXA 4ZVKA 5DMHA 2GEBA 2XB8A 4JOCA 5E7IA 2XA2A 1WB6A 3HXPA 4DABA 4KJXA 2HD4A 3NWOA 3I5XA 4A5SA 3WSWA 3G2JA 3NPAA 2HM7A 2JI6A 1YL5A 1FVXA 1KRHA 2XE8A 3B78A 1GSOA 4X91A 1NC3A 2MYNA 4O59O 3I6ZA 1BFDA 3R41A 4GS5A 3WGMA 2HQSA 3QEKA 3AEQB 4LDNA 2VF7A 4MYRA 1KQFA 2J09A 3AHDA 3AR3A 1UFVA 4Q37A 2D2IA 3L8DA 3I5YA 4XM0A 1FFAA 3FNFA 2WFZA 3QEMA 3AEYA 1GAQA 4GICA 4EKDA 1R00A 1J33A 3A36A 2AWOA 2C0QA 5IARA 4YUYA 4JI4B 4RIIA 2ZREA 1SQ0A 4FR5A 4GR4A 1MHTA 1EHYA 2QJWA 2ZYUX 1E2QA 2FU5C 2Z8XA 3JARB 2WG1A 2PFKA 4RXUA 3R7LA 2XI4A 2VTEA 4U3JB 2JVKA 3DW1X 3OQIA 1TU3A 2ZIXA 1EVKA 1L5YA 1B6SA 1P60A 1A3CA 4QAJA 5BWCA 2C4MA 4LV8B 2NP7A 1Y37A 2PL1A 2VZLA 3C97A 2X19A 3JAWB 4HQKA 3K3PA 1TKBA 3CLHA 4WLNA 3RVKA 1QKKA 1ECGA 1E1YA 3M89A 1C9DB 4UDXX 4HH3C 3UYKA 1XNRB 1NI5A 1V3TA 1JLLA 1SCAA 1YQ9A 4I3FA 4DIUA 2KYRA 1JG6A 3ZDXB 2FVYA 4IWNA 5E1MA 5C4IA 5TT0A 3ZZUA 2NVBA 3QP9A 4AYXA 2AG6A 2NO6A 3PS9A 5DBGA 1ZMTA 3GRUA 3MERA 4J0KA 4IUBS 1VIDA 2GOYA 4KE6A 4JQZA 2EX0A 3P2EA 2ZBQA 1S1MA 3EY9A 2DWUA 5FI0B 3CPJB 3L8FA 3WGHA 3KYDA 4B3JA 1B3RA 3CF0A 2CBXA 4YRPA 4EY8A 2R9VA 5AUPB 1DWOA 1RAFA 2NQTA 4EVSA 3HWRA 5GJCA 3UK1A 3K70D 3AF5A 3F74A 1G3IA 3O94A 3QVSA 4HWKA 1E3DA 1WAMA 4JODA 1UL1X 3ZVMA 2V0CA 4UARA 1K7EB 2YDXA 4V2IA 3G2QA 3T7RA 2W6IA 3EQ9A 3HNOA 1NW7A 5K1ZA 1XF9A 1NQ5A 2OE2A 2P8JA 3AEQA 3WHKA 1I7NA 2Z9BA 2DM6A 2H85A 2KBFA 2Y4NA 4B3XA 3G0HA 1JBQA 1H0SA 1ZD8A 2DY1A 2Y0PA 1OOEA 2Q0QA 1ILWA 4HVLA 2OO3A 3KPWA 1FNCA 5JASA 3I9V1 3VDQA 1XVUA 2ADFA 1C5KA 1MIHA 2PMCA 2XMPA 1JHQA 4IHJB 5DRYA 3VVLA 2VT6A 2RGWA 3OT1A 3W8FA 5HF9A 3MAJA 4WCFB 4TKVB 1DO8A 1XEWX 4X5OA 3HEMA 1KDOA 1OTXA 4BYGA 4F6CA 1RYHA 4UU1A 1SFRA 3I76A 1FFBA 1S0UA 3J7TA 4IMPA 5FBQB 2PYIA 2AXPA 4RJIA 5ELLA 1H23A 4Z7NB 4RTRA 4R41A 2P2CA 1SN7A 4LFBB 3FUTA 3PPIA 3V4VB 3PPYA 3MLBA 3MTQA 5FPSA 1T8SA 3UW1A 3BWEA 2PX8A 3H1GA 4ZZ0A 3QVXA 3HK2A 3I3OA 1R8SA 1VYUA 2H1FA 4C6RA 1TZCA 4I5IA 4YJ3A 2H9IA 2YN2A 4TV9F 1UBFA 1O95D 2OFOA 4EVRA 4JUCA 2IYZA 2QKYA 3NDRA 3UPTA 2PFSA 4RPCA 4X3OA 5A71A 1WWKA 4WE3A 4CU5A 1H1LB 1BYUA 4RFSB 5D2CA 5ECGC 4QXQA 4BFSA 4GMGA 2H7XA 2BR3A 3N2KA 2V6FA 2C20A 3ZK7A 3UMJA 2B0CA 5IXYA 1QTIA 1YAHA 3G5UA 1D0IA 3KSDO 2HA4A 4TTQA 5A6SB 2N75A 4B32A 2OB1A 3H1FA 2P35A 3SF0A 1KA9H 1JYFA 4OB6A 3KEOA 4DDVA 5L7WA 1OFHA 4E0BA 1GAJA 4XPIA 2WU0A 5KUTA 1ANKA 1N2BA 3LQKA 1NBMA 2YJ6A 4Q3DA 3W2FA 5BQ3A 4N47A 4HYQA 3QU5A 2DE0X 2MSEB 4QYTA 4JSTA 4LI0A 4MJ7A 4FFLA 3TRFA 3ADCA 3ESBA 1YQDA 4G41A 3WISA 3QFSA 3IMCA 2GUWA 1M7HA 2HJHA 2XB6A 3AB8A 3PPXA 4KQ6A 5EZYF 5IZ4A 4DA7A 2DUNA 4RS3A 4L8GA 1P72A 4ATNA 1EZZA 4YY3B 3OP1A 3KLPX 3TR0A 2NTJA 3BWCA 3ZZTA 3LVQE 5ESRA 2C5HA 2ZG6A 1FB5A 4A2WA 2BZGA 1U0JA 4EG7A 4ZYVA 2VUIB 4AMBA 1RI2A 3BD9A 2FZEA 3LFHA 2O54A 3VI4B 3M6LA 4H3SA 5BV7A 3OPYA 5A7HA 3U4QB 3QE4A 1JT2A 2QX4A 1P3DA 1XYVA 4LZJA 5IANA 4L8FA 1BXKA 1IK4A 4X71A 4V1CA 5JNUA 5JYEA 4F72A 3TNLA 1JHVA 1JQKA 2C9BA 2QRNA 3E1GA 5EQTA 5ETJA 3UJ3X 4WK0B 3Q2KA 1MHPA 2Q07A 5AJYA 1P5JA 2JKYA 4PNPA 1ZCBA 4NZPA 5AI0A 1YI1A 5SY9A 4ER3A 3N8HA 5IM4A 5BQFA 1H2AS 2X0DA 2JI8A 1TECE 2JEYA 4FS8A 3G79A 5JSUA 3DZ8A 4E09A 4OGLA 3MB5A 4IMRA 2WSIA 1CEEA 4H7HA 1JEOA 2A4KA 3AX6A 1JDSA 4QU0A 3QUTA 1QQTA 1T36A 1YB6A 3K05A 2D1YA 1HDXA 1CUIA 1HL3A 1RRPA 1ZICA 3EDMA 2FYTA 3SDBA 1QTQA 2FRVA 1XCJA 4Q1CA 5DLEA 4NARA 2CC2A 1GCIA 1PP4A 4EQ6A 5EPOA 3IAUA 2Q21A 3DPSA 1GGNA 4X62B 1Z39A 4F12A 1DDIA 5KZMB 1M1YE 3QYAA 1FQKA 4QICA 5IBCA 3BWBA 4JU9A 3KZXA 1FDRA 3UV3A 3BHMA 4WACA 5H5JA 2C9YA 4LZLA 4MUBA 2XCTB 2VJMA 4B5KA 2XB9A 3GDGA 3M82A 3N74A 4IHKA 4NWIA 3PC3A 3W79A 4IJQA 4KPUB 4E5MA 4XSGA 2E2WA 1ECFA 1J2TA 1ZK4A 3SX4A 4O08A 4BLVA 4DT1A 1DC8A 1BH2A 1QZXA 3GA7A 1G2PA 1HV8A 3KKOA 3ZDCA 1C9NA 1QQ5A 4JXZA 3U7IA 4TV9A 1CQPA 3D1LA 4E2XA 5ITSA 4CXMA 4M8IA 4ZYLA 3E61A 4EF4A 4J4TA 1WSDA 1C7JA 1A4XA 2XNCA 2FLWA 4BNYA 1ZJ5A 3TOSA 5EHXA 2WJPA 4GVXA 5EFZA 2RARA 1ONPA 2VL7A 4E3WA 3OBIA 1W4CA 1QXSA 1ENOA 4TMXA 2I0FA 3I61A 3N7AA 1VL5A 2G17A 5L3SA 1M2HA 4P5DA 1WXEA 3U7JA 5HPYB 2YXBA 1I0IA 3MTDA 2QY9A 4PPQA 4EYGA 2GA9A 1KEEA 2EF1A 2GYYA 4BLSA 5BMVF 1I3KA 2Q3EA 2PJDA 3AESB 1DVRA 4LQ4A 1KYZA 1V7PC 4NYMR 5FJIA 4UREA 3U81A 3VU1A 2QT0A 3HSSA 4RV5A 2OM6A 3NIWA 3KZMA 3UK0A 1JMYA 2GD0A 4YP9A 1S8FA 3V1UA 1RBMA 4GLLA 5DHAA 3OCZA 4ZT6A 2KW5A 3ZI0A 3BH0A 5HG0A 3WGOA 2PAAA 4ILKA 3G6WA 5CW2A 4P38A 5ELXA 4WFJA 4YJ2B 3HR8A 2ZWMA 3OY7A 4MUAA 4ZZ3A 4M7OA 4BXOA 2ZXUA 4DKJA 3UMBA 2YFKA 1VTKA 4DLVA 4EF6A 3ZVKA 3PU6A 1MQ8B 2DFNA 1JZTA 3AFMA 4A23A 2DERA 4P86A 2ZPUA 4LJ9A 2CJFA 1DSSG 3NYRA 4ZVNA 4D5GA 2Y6UA 1QJCA 2XZDA 4I3GA 3L6RA 2AC4A 4CVNA 4QGSA 4JOBA 3FPHA 4AJIA 4RZXA 1R9GA 3DV0A 3PJFA 1W48A 1QVAA 5I9BA 5A9SB 2OHFA 4X1IB 3LQ1A 5IFKA 1YIDA 3EUEA 4U7DA 1A76A 5IDVA 1HDCA 4D4MA 1Q0RA 3UXHA 1L9XA 1JU9A 2OQIA 4DNXA 1J0XO 1AK2A 4XVCA 1PFKA 5JDCC 4BKOA 3WYAA 4HNGA 4XIJA 3UV6A 4B7CA 1I5RA 2OZVA 4RH1A 3SR0A 3DWEX 4FFMA 2D5BA 1U8ZA 5CDFE 1O6CA 1A7KA 1Y34E 3E18A 5I8ZA 4AJPA 1POWA 1IM2A 5C8YA 1OR8A 2RAPA 1JMKC 2BSQA 5JANA 2A8YA 4O4LB 3Q7PA 3ORQA 3PHIA 3JASA 2ZTSA 1C2YA 1MZVA 3IC5A 4YFVA 2GM3A 2CL7X 2FWMX 3PDCA 1KRWA 2HSWA 2CFOA 3O26A 2O3QA 2OL4A 3OIYA 3FN4A 2IU0A 5C52B 4HB3A 2JIZA 1G3QA 3D0KA 2VCYA 3INNA 3LUFA 1R9MA 1Y5MA 2QP9X 4TMFA 4C5CA 4CN8A 2ECOA 4HX5A 3ETEA 2WSMA 1RVDA 4TTRA 3H9BA 4DHEA 2R2GA 1EIZA 3TNYA 1E77A 1OAKA 2CDAA 4WOKA 4BNTA 5LLDA 3PFIA 1SVIA 4W7IA 1R9JA 3VO8A 1XVTA 4KH1A 2QZZA 4OHRA 3TW8A 3VISA 1UEJA 5EJFA 1OX5A 3DP7A 3A1EA 1YZGA 3V1YA 2G77B 1R6XA 4F3KA 2REQB 1LH0A 3INRA 2BFFB 1NFRA 3PVZA 4MWTA 3MJFA 4D42A 4RKEA 4TXMA 4QFDA 2E4VA 2QTTA 3BSFA 4CQLA 1K75A 2UYOA 3OPQA 5J1TB 3QXSA 5BSWA 5IF3A 1BMFD 3GLIB 2HBRA 2JB9A 3O95A 1M67A 1GZVA 3VGPA 4QO7A 5EWMA 2H1RA 3C3XA 5B57C 1M83A 3KYDB 1II9A 1MEJA 3MQFA 3P2MA 4YB8A 3BDAA 1R0WA 2PUBA 4GXRA 1GSIA 2C5BA 1AMNA 5EJ2A 2C8KA 5FUBA 2QE7D 1E4YA 1T4BA 1Y98A 2AW5A 2XQJA 4U7PB 4M0LA 1Y4DE 3BTVA 3NG1A 3WZLA 3IDAA 1XOIA 4ISCA 4JJGA 1Y82A 4EG8A 4Z0PA 4LOLA 3ICQB 4YLGA 2IPNA 1LSOA 2MT9A 3LUHA 3VR5A 2QIOA 5IWAB 5DNEA 1Y8AA 3DZCA 4HQOA 2OY0A 1EQ2A 3RNOA 3WNCA 4MVJM 5GTDA 3M34A 4QJBA 4D0LB 1B26A 5DNAA 2QRHA 3TD2A 1KSGA 4FB4A 1Z8DA 1QWOA 3KB1A 1WR8A 1QLWA 1XTIA 4EA7A 2BM8A 4AULA 3TD6A 2WQZA 2H1CA 5KYYA 1Z6GA 3EWAA 4HUJA 1Z8HA 2FKAA 1FYWA 1ZOOA 3ANMA 3C2QA 4ID9A 2NXJA 3FBWA 4WJZA 3TLGB 3THYB 1WOYA 1C41A 5D6NA 3MBKA 4MQEA 1P2TA 2QRMA 3R1IA 5F1YA 4ONEA 4BGUA 3BMQB 4W99A 1FJGB 4WOJA 3LQ4A 3C7AA 3AZOA 2WKQA 3ELDA 2EL7A 4X6LA 4E3ZA 2HQ1A 2JDIA 3O3OB 2QZ9A 5EKTA 4YC7A 5A9SA 1KTIA 1WB5A 4RVDA 1D0SA 2B4QA 1KOLA 3FCCA 1O9BA 2DHEA 4A73A 3EPKA 3P4YA 3BGDA 3M6VA 1HO3A 4MCIA 2I65A 1JLMA 2VBIA 1DIRA 2QRUA 5IULC 4MB2A 1X70A 2UZ1B 3FLBA 1DKLA 1FSGA 4RY0A 1WCYA 2Q2OA 4ZANA 4XIYA 3LPMA 4I99A 3ZCRA 3T3DA 4DCNA 1S2GA 4HP8A 2GNAA 4DXAA 3DZBA 2QPOA 2BIFA 2NSYA 3N2YA 1GTVA 2ZANA 4I1OA 3LZ6A 1XRMA 3DWIA 4LF5B 3EQ8A 2VDLB 4C3UA 3AQ4A 4PX2A 4ECAA 5DXJA 2VSFA 4DMFA 1CY7A 4FJ1A 1QX4A 1SC1A 1SVMA 4IUYA 3DXZA 2QE7A 1TO6A 4M22A 1LBIA 1ZNZA 3K1AB 3O21A 2WAMA 4EHNA 3EQ6A 1GZ5A 2GZSA 3ASYA 4PO8A 5CK4A 2OORA 3W05A 4C04A 5I45A 4LDPA 5P8WA 2IXFA 1P1CA 2FSFA 2ONKA 3RQIA 1KTVA 4MP8A 4JJ8A 4BFLA 4DC1A 4CKCB 3S2UA 5I8PA 3QEBZ 2I71A 2XCRB 4DIBA 3BORA 1NL3A 4OQMA 3V6MA 5G0SA 1U4OA 4BDSA 1G38A 4Y2HA 1YQEA 3UY4A 1FIUA 1O96B 1YE5A 4HMQA 1VKRA 1A5SB 1N2ZA 1ICIA 2IIPA 1BAPA 2OK7A 3T1NA 3VYTB 3LKBA 1KRXA 3PYLA 4OO3A 4TSFA 2OO7A 4H35A 3QVJA 1GEEA 1GZ3A 1DV2A 3I32A 3RHTA 4S24A 5JAPA 1YH3A 2PZKA 3BMOB 4E13A 1I1QB 1I4EB 2M98A 3GLUA 3VOAA 3DULA 4LHEA 4CU2A 2B83A 2I34A 5IK2A 5H4GA 2PE5A 1CQJB 3FFTA 4GPAA 4HVCA 5KYWA 4LDZA 3UG7A 4R8VA 1MAHA 2YOGA 3S68A 4ZYUA 4ALLA 4PYIA 4YS6A 1HL7A 4Q7KA 4DA8A 1PT6A 1SKBA 1Y8RB 2IW1A 2XNJA 3OPXA 4YJFA 4ZYTA 5BYKA 2ORWA 4C78A 4QHYA 4KI7A 2HX1A 4FS3A 5EIBC 5FLEX 4ILEA 5LOVB 4KBGA 4RGVA 4DLSA 2CT8A 3KR9A 3IAHA 2XOXA 5DYIA 1Y8ZA 1NDQA 1W9MA 1T2UA 3RRBA 4EG3A 3LY9A 3UAXA 3Q8XB 2FOXA 3BIJA 3E5NA 1F0KA 4PBRA 1OT5A 3KXLA 5HIMA 3VBEA 1GOTA 2GFHA 4MQ6A 3P0HA 3OZFA 1L2TA 2FPMA 2WWGA 3PDHA 4LDQA 1NXXA 5TPWA 1CS4C 3F2IA 4L5JA 4ZRMA 1RQ2A 2GJAA 3C6KA 4N5IX 4OU4A 5SY6A 1IDOA 5BR7A 4P0QB 2P11A 2QXTA 4CQMA 4NNOA 1VFPA 4EI8A 1XDGA 5JJBA 3QW4B 1KF0A 1J22A 1K08A 5LCXA 4R2JA 3B51X 4FNGA 1M3SA 1T3TA 221PA 2QR3A 2JJ2A 3ITDA 3UGJA 5FTKA 2NN3C 3RFXA 2E3JA 4OLHA 1IL0A 2KMLA 3MWLA 2P62A 5GVSA 1OPXA 4G5FA 2CXSA 3MRSA 2OHOA 3IAAA 5EWLA 1IPEA 3LY5A 4G5SA 2UXDB 4OG2A 1Y9AA 4C05A 4QNNA 5ALXA 2R1TA 2WPDD 4BO8A 4CMHA 5C7YA 3ZYZA 4G85A 2H4XA 4JL8A 5KYTA 1I7QB 2WU3A 3DH0A 3GARA 3UAZA 3RNLA 4BNDB 4D9CA 5J47A 4N3CA 1XWIA 2HHJA 1CRLA 3PXDA 1J0CA 1XEXA 2AEFA 3CNQS 2HRZA 1E5LA 1OVMA 3KPYA 2C7VA 1TUIA 5G02A 4BWGA 1OTHA 1T6BY 1ZLYA 2HY7A 2FZLA 4HRYA 5LD2C 4BVKA 5CT4A 4YXFA 2VDJA 1GRVA 1NXWA 2C2XA 3OO1A 3ECAA 3TSOA 4OL0A 3WI7A 3U19A 5ILOA 3F8WA 3B1KA 4Z49A 5HP4A 1FZTA 2YRFA 3LM8A 3NDJA 5E4TA 3K1AA 3TAHA 2VTVA 3ROKA 1AIPA 1M2WA 3HB4X 3IE2A 1Z2NX 2Q8PA 3Q7RA 3GDFA 4QUDA 2G63A 4F9EA 5I47A 4BO3A 1OX4B 1Z8NA 2WEKA 4TXNA 1OFTA 2B8EA 1SB8A 2HH9A 2WZQA 1KMQA 3PNKA 4NY1A 2LE0A 3CNEA 1KDYA 1CDOA 4UPEA 1K0UA 1JXAA 1RRFA 4W9NA 3B5EA 3K96A 4N65A 1SOUA 2CL0X 3WNBA 4AYWA 1ZDMA 3IBCA 1C0LA 4MVJE 5AKYA 4NECA 2O07A 2JGDB 2ZVJA 3H9QA 1PYOA 2ZQZA 2RGNA 1N2EA 2XOEA 3LTEA 2ZRQA 4MUGA 4PZLA 2W93A 4Q3AA 1TW3A 1W85A 1ZIDA 4FLFA 2J67A 2Q6OA 2OV6A 1G4UR 1FY2A 2FRXA 5ALWA 3EMKA 3SNHA 1SQSA 5TS2A 1NW9B 5AK5A 2EGGA 2P5SA 2QENA 1YDMA 3MINB 3UHPA 2YVQA 1BN7A 1Z7BA 3P9SA 3VX3A 4ENUA 4BNKA 2GCOA 3N0XA 5AUNB 3OEYA 3EWSA 2JZCA 2Q1UA 3H87A 4PNZA 4BNDA 4BX0A 4DF3A 4N5MA 4RLQA 5A03A 1R18A 2DTXA 3G0BA 2QNIA 2ODAA 3HRHA 1QGUA 4EX6A 3L79A 4D8TA 5C3UA 2X3UA 1S2MA 4DCCA 3FI9A 3AHJA 4HQ0A 4KPYA 2W11A 4AXBA 3ZWMA 3SDZA 4CT5A 1P44A 2J9GA 5HJ7A 2IPOA 1CNMA 2C1XA 2W2KA 3EIFA 5EXDA 4DNPA 5A0VA 4YDQA 4FWIB 4E6PA 3RLFA 2G04A 4D7AA 2JLWA 1VIAA 4R2LA 1QHNA 1YJXA 3OIGA 4BUZA 1M5TA 5JDCA 1JIJA 3HVRA 4MJ3A 3VO1A 1M6YA 3WP1B 1QG4A 4UDNA 4MA4A 3TO5A 1MQ9A 1QX3A 2HDWA 3WGIA 3STYA 2JGLA 2R6DA 2IBMA 3DVAA 3RRYA 1C7EA 3PWKA 5IK2D 5IZCC 1M2JA 1AKRA 3DKPA 3AJEA 2EGHA 4Y1RB 3DA8A 4BNXA 2G5GX 4ZTZB 1YMVA 3E03A 1WVIA 4R0VA 4OHCA 4CV0A 2TYSB 2IV3A 3DOJA 1JDVA 2X1LA 2Z2IA 5ECDA 4EHLA 5JJCA 1CS0B 1QP7A 5FWNA 1UZUA 2DEUA 1WP4A 3AMVA 1AS2A 3QPDA 4PYKA 5F3WB 3GRRA 3PRKE 5C1BA 1VB3A 3QLEA 4ZCLA 2EHDA 2YW9A 1U6JA 1PEDA 1TJPB 1JHRA 1RLJA 5K3BA 5CX1A 1KHTA 2AOUB 3WKBA 4D4HA 2QW0X 3A6LA 3DW3X 2GYUA 4IP0A 3OAAD 4IXTA 3CH7A 4NDNE 4BFXA 3ZS8A 1Y80A 3TKAA 3K70C 1KHHA 1TKRA 3ST7A 3MXTA 5I9NA 3VNQA 3HGTA 1PQPA 3C8MA 3Q40A 1VJDA 2W2LA 3JYQA 2WP0A 2H4JA 4RHTA 5JQGB 2QTHA 1H42A 1X8KA 1S7GA 1V9LA 6YASA 3NHAA 3UW3A 1CD5A 1DWPA 5I4BA 2ZRLA 3VX4A 1RRVA 2KBEA 2JBAA 4MV3A 4NKRA 3IP8A 2DHQA 5FOQA 4G0VA 2IUYA 2VDMB 3HYLA 1TZBA 3GCXA 2PL9A 3A6KA 1L7VC 3EF3A 3FKSA 4P33A 3ESQA 2QROA 2V4MA 2YRWA 3FPSA 5FUYA 2Q0HA 2NYUA 1LDNA 2AJLI 4MUXA 3JZMA 5CEEA 1SAYA 1H3FA 1NUSA 1UBCA 4MPJA 4NJMB 4TLLB 1BWQA 5BV2P 3L18A 5C7OO 5T67A 3KKMA 1XZBA 4B3SB 3DEHA 2I2CA 3MMPA 3VMMA 1DC6A 4EG1A 4D9HA 4ZGGA 4NE7A 2V7TA 1OLUB 2V9ZA 1RXCA 4I4LA 4OP1A 1D6NA 2J08A 3TZHA 2PU5A 5CXUA 1SQGA 3F97A 3K6RA 3RVPA 1KZ7B 1P5RA 1PKEA 3II6X 3JYLA 4YMGA 4EB8A 4ND8A 3AR6A 3Q8LA 1RD4A 3MELA 2GAJA 5DBEX 4OCZA 1V1RB 3FA2A 3RJ9A 3ZWAA 2SHKA 4PINA 1FMJA 3OIFA 2C99A 4AAYA 4HEA1 4KQIA 5ERXA 3N53A 1JDBC 3PGKA 5DN6D 2PYDA 3D3WB 5JU6A 3RSSA 2NO0A 2JCVA 3LK7A 3OZRA 2IGBA 1E6CA 3GJ7A 1BDIA 2WA1A 5E6UB 3V8VA 4IOMA 5AK6A 2SKCA 5SZKB 4E7PA 1AO0A 3H19A 1VMAA 3IVRA 3A1CA 3V4ZA 3W6OA 2OXTA 4Q3CA 3TMKA 3UTCA 3ESAA 4COKA 4YAOA 3UKJA 4UZSA 5FTLA 5A06A 1YZKA 2PKQP 1YRYE 2YVLA 5JXIA 2AYYA 1PJ4A 2DH6A 3A9TA 4I14A 4J1QA 4L02A 4O8ZA 3RH0A 1SBIA 4LYJA 4MROA 5EJEA 5FEUA 3S81A 3AUKA 1BU8A 3IQZA 1OLXA 1PK7A 2GTPA 4LAFA 2JBAB 5BNIA 1KNQA 1L5SA 1CRQA 2H59A 3GZNB 4DRZA 1GLGA 1RPZA 3PJRA 3R7WB 4RLFA 3MGKA 4RORA 3RRNA 2O8FB 3EDRA 2X6RA 3AJAA 3B3GA 3IDSA 2F64A 3A2KA 3THRA 2H1LA 3VR4D 4DR4B 2GF0A 1C9KA 3IHWA 3VR5H 3WX0A 2MWMA 3FPGA 2RIPA 5DXFA 1D8TA 3DFFA 5F4ZA 2AOWA 4C03A 4I55F 2FQWA 1UJ5A 1R74A 2UYHA 2Q9CA 3L8MA 4DTCA 3PZRA 2O2EA 2W6OA 2K4MA 3B52X 2B9EA 4GZLA 2PH3A 5ICGA 4U5XA 1Y9DA 4U7GA 5BSRA 4PRKA 1B7GO 3H86A 4OREX 2XCQA 5TS3A 3S8EA 2LNDA 2B30A 3PIIA 1VHJA 3HYSA 5E1OA 1UJBA 1Z4IA 4NG4A 3EVBA 1WEHA 2UU9B 2PANA 1T9ZA 3B5JA 5AVUA 1A71A 1R16A 4IEIA 1X1RA 3H18A 4OY3A 1KH3A 4Y2VA 3QKTA 1KY2A 2XUHA 1Z88A 5AJTA 5JRDS 1GPAA 2Q5CA 1FRQA 2JEOA 3UJ7A 3DVRX 1FMCA 2BSAA 1GPBA 3B9RA 3ETDA 4JKIA 2IOYA 3IODA 4ITRC 5FYQA 2C7BA 4RK7A 5F51A 4F1JA 1JTEA 9ABPA 1ZWLA 3PLAE 4IBOA 1Z2EA 1K1EA 4P31A 1QRUA 3JYOA 5JRZA 4MVJF 4G97A 4XSVA 4YIKA 4Q3EA 3KQLA 3DE1X 1PWHA 1V47A 3NAGA 3NWJA 4CRWB 2G4CA 1UP4A 2C3PA 2MR6A 5EIWA 4CMEC 2EKPA 1IN5A 4YPFA 4IQGA 3UXEA 2CSXA 2Q1WA 3FFBA 4P35A 4EFNA 1Y1SA 1G1AA 5G1PA 3UMRA 3IUBA 4CL2A 3B6IA 2N1BA 1U04A 2XRMA 1ZYUA 2WM2A 2JGMA 4LE2A 1Z6XA 2QU8A 1GRCA 1TZKA 3NXSA 4BVGA 3U7GA 5B5SA 2IZ0A 1ULHA 1Z9BA 2DXIA 2QORA 5E4JA 5T5QA 3MWEB 1F8UA 3ISVA 1WCV1 2BGUA 2ID9A 1E94E 1XAJA 5CGQB 1W1WA 1YULA 1ZGBA 4MITA 3FIUA 5MDHA 4TYMA 2AE2A 5KNDH 3PQ4A 1D2NA 4J1TA 3T8YA 1FX0A 2H5JA 4UEQA 3NBQA 1YU6A 4JI6B 2X3FA 4EY4A 4OA8A 1LVUA 2AN5A 2XKJE 1HQYE 3BMCA 1D1QA 1FP1D 1WULS 4HX9A 1N7HA 4TWRA 5B53A 3O4GA 4M1WA 2VZ9A 1K4MA 1VGRA 3RGWS 3QTTA 2R7LA 4RY9A 5I7WA 4E2WA 1TE2A 3VPHA 3IVMA 3A1UA 4ZVLA 3U4QA 1KVQA 2OYSA 3R75A 1E9FA 2JLYA 1HT2E 5CPFA 3EZLA 1NHWA 2WT8A 4ENSA 1JMVA 3NKFA 2XNHA 5JJIA 4JI8B 3ZZMA 1I3CA 2E5WA 1JHZA 1CY0A 4YONB 3H4IA 1LF5A 3KRTA 3IEXA 1RYFA 3ENVA 2X9NA 4RQBA 3UMFA 2D2FA 4WQMA 4CKXA 5CFNA 1Y4AE 3K20A 4TRJA 5I7SA 4NAUA 1E62A 2P67A 4NPCA 5E1BA 4D46A 2CF6A 1YUNA 2RAVA 3PV0A 4F9GA 2ZTMA 3K4PA 5BNFA 1KJNA 1H3NA 1QV7A 4UM8B 1DUIA 1NRWA 2AMFA 4KTTE 4RF2A 1JWAB 2RI6A 1VSVA 1KKUA 3O8CA 2BCEA 1WDKA 1XD9A 3SR4A 5GAJA 1H4QA 1FYFA 1OHHD 1EAMA 4QATA 2HMSA 2Y0DA 2PWYA 2NG1A 4Z5XA 1DG1G 1EEHA 1AXRA 1LB1B 2XCIA 3NNSA 4HYEA 1ES9A 2IYRA 2V7WA 1PJ8A 2FEPA 3TLGA 4QOGA 1BX1A 2BHTA 5EKXA 3R7FA 2HN9A 5LXTF 4GOLD 1A95A 4BE4A 3FTNA 2YN4A 1NLMA 1D03A 2Q1SA 3B7PA 3MD0A 1LTQA 4GGMX 2R4QA 5IAOA 1XZGA 1IY2A 3TOVA 4GR9A 2V1UA 2YJGA 1X0XA 3FCUB 4RBNA 2ZZKA 2VEDA 5DBIA 5YASA 1CTQA 5ADUS 2FFBA 4IIEA 1RI3A 4X66B 2DU8A 4KGVA 3WAGA 3QFRA 4QOJA 4YDSA 4Q7MB 2XX3A 2ZXEA 2IUUA 5CHEA 4MUFA 3AYZB 3TB6A 4EGJA 5JH7F 4EFLA 4ZO4A 3W5BA 3Q8MA 2ZE5A 1PVDA 2VA8A 1XQWA 4JC5A 1MQSA 1ZBDA 2C4TA 2RC5A 5JD5A 4MMYB 1EFAA 4KL8S 3SE0A 1TB4A 2FLKA 1NZFA 3FI0A 4KXQA 1DJLA 2INGX 1TZMA 2IYSA 1RM3A 2WF9A 3GCWA 2PMEA 1AY0A 2IS2A 2O06A 3C1TA 1XCMA 4OFWA 4YJFB 2JRLA 2Q2WA 4AUEA 4IV0A 2PUFA 2C4WA 4KN6A 3HJRA 1O4VA 1LX7A 4HB4A 4L6IA 3LL4A 4NULA 5FTNA 5JY6A 3K0CA 2AS0A 4Q6BA 3U0BA 4RXTA 4PC7A 2F43B 1L8QA 2OGUA 1OWNA 1EI9A 1OZHA 1TT7A 2G07A 2VQSA 2GBFA 4FKBA 5ALQA 5IYZA 2OBNA 2JLXA 2WUEA 1W1UA 3BXXA 3DVAB 1TDJA 1C3LA 4HTFA 3GN2A 4LNAA 2DTEA 1NRXA 3FJ1A 3OJ0A 5E0KB 3ONEA 3AVWA 2JD1A 4YBZA 4OSEA 3IP3A 1IHYA 2Y2VA 3WGKA 3SC2B 3GRYA 5JW6A 3KZCA 1O94A 3VYRB 1SU8A 3WIBA 1EMDA 5C4GB 2QI9F 3OM0A 4RWEA 1E3IA 1MO3A 3TIXB 1MOZA 1ZRHA 3EXG2 2BM9A 3M1AA 1C9YA 4B4OA 5EJ7A 5LIPA 3HDTA 4MGHA 5SZIA 4MHTA 5JMTA 3Q85A 1P81A 3BL8A 1U2TA 2BFOA 2GVNA 1N3BA 1XFAA 3NM6B 1DCMA 2JGNA 1PIWA 3KV1A 3NV7A 4XQ9A 1RFLA 3O82A 5LQJA 6PFKA 2I5PO 1T6YA 4G3XA 4JI2B 3LX6A 1CF9A 1SHTX 1VLVA 2CLCX 3NIFB 4V1CI 2HU8A 2JVIA 5F78A 1R0RE 3H6HA 2IGTA 3DV2A 3G1TA 2YZMA 1WX1A 1S3IA 3HO6A 4X9XA 1J06A 1O89A 5AJHA 3PPVA 1QH1A 2ZEJA 3OTIA 5HF6A 5AK0A 1COWD 5FNVA 2P9JA 4FFVA 1E4EA 1EFKA 4IRXA 2L82A 3ZIAD 1ML3A 3LP8A 4HFMA 4KJZA 2BHRA 4YCJA 2IHVA 4ETIA 4XQ0A 3MPUA 3EC1A 2BMVA 4YO8A 5K8UA 3MIIA 2DOKA 5TR9A 2FN7A 4F91B 1G0OA 1P62B 4CF3A 4WK6A 1ONSA 3OU7A 4BNZA 4RSMA 3V4RA 4D92A 2WJGA 1CR0A 3RS9A 4DR1B 3FHOA 3RO7A 2I6QA 6AT1A 3HJGA 2AG1A 5BVHB 3BICA 4YEDA 4A8PA 4L95C 3RASA 5LA6A 2DWOA 3EJ6A 4JX9A 3COZA 2HSJA 1VOTA 5JD3A 4HGPA 4DUYB 3FJYA 2VXYA 3GJ3A 1GUBA 3GK3A 3M3HA 4IIJF 4HNAB 2PL3A 1PJBA 3OI7A 3RRJA 3ZHSA 5LP6B 1RWMA 4JJKA 4FIZA 4XGRA 3TDMA 2VOEA 3G0GA 2O1EA 2SCUA 1VPVA 5BW5A 4G67A 4ZC1A 1IZ8A 1XDWA 3JWEA 1N6HA 1PUXA 2Q4RA 3UWOA 3H5AA 3W2TA 5JD4A 5HJ2A 1KWKA 2QBYB 1GILA 1P8JA 1ISPA 3PCXA 4M1SA 3TLZA 4EBBA 1V7CA 2BLNA 2WJVA 2Y1OA 4WY8A 2VTBB 1HMPA 1DAIA 2JCGA 3MQ4A 3MTJA 1OX6A 2W4QA 5DW0A 5A04A 1O6BA 3AY7A 1PR2A 3CX7A 1UKVY 2GS9A 4JX8A 4DGSA 1AT1A 2W6PA 1CUVA 1GWNA 2XMCA 1HC7A 1BE8A 1NVFA 2P1RA 3SJ7A 3DBVO 3SG0A 2ZSJA 1P6UA 1PTKA 1EIWA 2J7KA 3N86A 2A0FA 2WIKA 1MB9A 4Y9UA 3WS7A 2QN6A 4WESA 4IG9A 4HNRA 2WNIA 3OOYA 4EARA 2POCA 1HZZC 5IYZB 1CUHA 4LPSA 3G0IA 1Z47A 4HUQA 4PRZA 3IR6A 3C70A 1LC0A 1Y3CE 2QTGA 2CNDA 2Y0BA 2ACVA 1JPUA 4QXRA 2CV2A 1EJ2A 3JQ7B 4L3OA 4QPPA 2CV1A 4NBVA 3RAPR 4P2GA 1KC1A 5D7BA 3WK9A 3GJ0A 2IX3A 4IR7A 3RADC 4J9UE 1VDZA 4S0XA 4F4UA 2B69A 1VL1A 1XXHB 1XZFA 3HU1A 4O2AF 5KX5F 3QLJA 4QFCA 4BVBA 3ZDDA 1ZIPA 4GPIB 2C59A 3TSZA 2HPAA 3IR5A 1JEJA 3CTPA 1GADO 1P0CA 3VPCA 5E3HA 1L7XA 4ZVMA 2ROQA 1FE8A 4W5OA 2XUQA 4NH4A 4MKXA 5IEBA 4R0MA 3TPZA 4YAKA 1RQRA 2WE7A 3IURA 3UVEA 4DLAA 4HR7A 3CLKA 1JP7A 3RT7A 1QF7A 3BDIA 3BE6A 2OXRA 3R5XA 3C6XA 2A5JA 2JC3A 1RU3A 1WMBA 4IIVA 4MYCA 2OZLA 2F8TA 3Q0IA 3K2EA 5DBHX 2JBHA 3BMQA 3CTMA 4K9SA 1BIFA 1EVEA 5IN4A 3P2OA 4OQQA 2ZULA 1DJNA 3H97A 2VT7A 5EGSA 2I67A 1YK0A 4AZ3B 4Y2XA 4A91A 1XTBA 1Q1BA 2X9GA 3FMGA 3NAMA 3P26A 1QU3A 2DY0A 5D3MB 3JQCA 2I4MA 2JFZA 2ZSAA 4MRRA 2ZSUA 1U8UA 3M6FA 1I2ZA 1NN5A 3HA2A 3KOUA 4XX0A 5ESDA 5HK8A 1B8UA 4NC9A 4FGLA 3T5TA 5ICEA 3H05A 1PJTA 1U80A 3CN9A 3L77A 3CGGA 3ZDFA 4BQRA 2R8OA 4CMCA 1XVAA 2QZJA 3ZG6A 3LXUX 3H4TA 3W3ZB 3CH5A 4RD6A 2BI8A 1A50B 1LLQA 1JIQA 3LQYA 4QTYA 2MMCA 3AIKA 4CEIA 4AG3A 2Q3JA 5F76A 3O2JA 3RYFB 2R47A 3HCRA 1VPDA 1VG9B 1G291 1WNTA 3UHFA 4BVJA 1MPTA 4EB6B 3WIVA 3GA0A 2CKMA 1DXHA 5I3ZA 1ZU5A 5DASA 1ZZGA 2VZEA 1YTUA 3LT5A 1T8RA 1FXWA 2CE7A 2AD5A 3CEHA 4PLTA 4PWZA 3SD7A 2ZJYA 2J7PA 4J03A 3ZE8A 3H5VA 2B1RA 3SVTA 3AEKA 1HRDA 1D5WA 1NLFA 4Y6LA 2QTLA 3HXLA 3VR6A 4OOEA 1JH9A 1VIM