4CLRB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 250
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clrB00
4B3IA 3GA0A 3GY0A 4Z9FA 3VZSA 4AICA 4NDNE 1FDWA 2D0IA 2JD2A 3PHGA 4GSKA 3WIEA 4FJ1A 1ZK3A 3TWOA 4BO6A 1I24A 3PJGA 4EDFA 5THQA 2NV6A 2D3TA 4NU6A 3ZN2A 2JD1A 5IF3A 1VM6A 4XQ9A 4AJ1A 4D44A 2BI8A 2GDZA 1YQDA 4O5OA 4BUCA 2Q49A 3NTRA 3IUPA 2J5QA 4J2OA 1NX6A 1BSVA 2EHDA 4BV9A 1PWZA 3GT0A 5B37A 4Y6PA 2B36A 4CMBA 4NFSA 5ENDA 5LDHA 2UYYA 1BW9B 1XA0A 4GH5A 2OFPA 5ILOA 2GD1O 2Q1UA 2AQKA 5JPIA 3JD4A 1UH5A 3QWHA 5EMHA 3N58A 2ZJ1A 3HB4X 1ZXLA 2BRUA 1F8GA 2A4KA 1UR5A 5H82A 3UF0A 1E7WA 3ANLA 2PNFA 2AG8A 4JGBA 3PQEA 4OOEA 3HFGA 1I3NA 2VOEA 3U3XA 4MINA 4DQVA 1NVMB 4E5PA 3NTQA 4G65A 4WLVA 3F6YA 1M76A 4J91A 1P33A 1ZJZA 4EUHA 1JAYA 1XYGA 4DREA 4DMLA 3LC1O 4GVLA 2PD6A 4HP8A 5H83A 1A4IA 2GZ1A 4Z6KA 3A4VA 4LW8A 2X7HA 1YKFA 4HADA 1PJBA 1DC5A 2DFDA 1MLDA 3GZNA 1PZGA 4BNHA 2JFGA 3JD2A 1HXHA 5ER6A 4GI2A 1U8FO 3OA2A 3CPSA 1FDVA 2LDBA 1PGJA 2CDAA 4PZDA 2V7PA 5COQA 4K6CA 5K9ZA 4NK5A 3MWEB 4CM8A 2DU8A 1HZZA 4BNMA 3QY9A 1MXHA 4J9VA 4NU5A 3GH3A 3KETA 1I10A 4CM4A 2EW8A 1H6AA 4KWIA 5JAZA 2HJRA 3HSKA 4O1MA 1P1HA 1NHGA 1LSOA 3AW9A 3DDNA 4ITUA 3K2EA 2ZQZA 3GGGA 3TF5A 3UGKA 1VKOA 1GUFA 4FGSA 2Q3EA 3K96A 4N18A 5BNFA 4U7WA 4CM7A 1Y5RA 2AXQA 1T4BA 4QQRA 1NAHA 3RROA 3GUCA 4QTZA 4C7JA 2B83A 4NK4A 4YAIA 3DMTC 1YBVA 2I3GA 2Z1NA 1H9BA 1G1AA 4CM9D 5L7WA 3I6QA 1P74A 4LCEA 4BHTA 4BB5A 4IGEA 3UKOA 2QHXA 4MDHA 1I01A 2AMFA 1YOVA 4NFHA 2I9PA 2HAEA 1R37A 3D3WA 2V6FA 4JQCA 4ZGWA 2ZTUA 1H0KA 3WMXA 3F5SA 3GVXA 1DOHA 4CLRB 4YJHB 2V6GA 4JNKA 1AHIA 3C8MA 3LT0A 1RWBA 5TT1A 4M49A 1DB3A 2OO5A 3JQBC 3VVBA 3OQ1A 3A1NA 4B3HA 1UDCA 1JAXA 2Z95A 3WGHA 3E6AA 3JTMA 3RQSA 4IPTA 3JYLA 3WYBA 1XU9A 3RJ9A 2QYTA 1BRMA 1F06A 2YFHA 5TQVA 5KJFA 3RCBA 3JQCA 1Z75A 1M67A 1XG5A 3EK2A 3GHYA 3H5RA 3PQFA 4CV1A 3IUSA 4PG6A 2DBQA 3BMQA 5CG1A 4TMFA 2PD3A 4BO7A 3MOGA 4GPD1 3SVTA 1YRLA 1E6EA 1GQQA 3ETGA 5DOVA 1C1XB 2VTEA 1ZMTA 5G0WA 4W4TA 1N9GA 3ZHZA 4CV3A 1N1EA 4DQXA 1PZHA 1X13A 1HDOA 2Q1TA 1P45A 1LNQA 2Q4BA 1HRDA 2ZCVA 1L7EA 2HK9A 2C54A 1E5QA 1H5QA 3LU1A 5JMWA 1KVTA 4BMVA 1XLTA 3GN1A 3AFMA 2ZTMA 4PFJA 4KUEA 3AUAA 3DHNA 3U5TA 5ENVA 2NWQA 8LDHA 4YJGA 4YJHA 3V2GA 1LDGA 3I4FA 1C0PA 2VZ0A 5KJCA 5CEJA 2BGLA 1A27A 2GF2A 1RM0A 2X9NA 3A28A 2AHRA 2R2GA 2HLPA 1GTMA 2IODA 1Q0HA 1OI7A 2PZJA 3NJ4A 3BTSA 3T4XA 1Z74A 2PD4A 2QQ5A 3PGJA 2RH4A 3E82A 4TRRA 1QV6A 5C7IO 3KZVA 1I3KA 1R0SA 1NVGA 4JP2A 5AOVA 4DTIA 3L9XA 3WXBA 2CZCA 5DP2A 1NTOA 1NFQA 2OMEA 5KOIA 3ZWCA 3FSRA 3PEFA 1PZFA 2BLLA 4Z0PA 4E5KA 2B5WA 2J3IA 3FBTA 1BHSA 4BMSA 3V2HA 3OIFA 3ULKA 4CMHA 2AEMA 4IMRA 1C0LA 4HFMA 4BNZA 2DUUA 3WGOA 3JQAB 5A04A 4ALNA 5IZ4A 1T2AA 4BIIA 4E3ZA 2P5UA 1PWXA 2OZPA 3PJFA 4XRGA 2PKQO 1GYPA 2HRZA 2O3UA 1E6UA 2O7SA 3K5PA 4YT8A 1KEWA 3C24A 4MKRA 4XYMA 3SJUA 4ALIA 1UJMA 1T25A 4GX1A 1R6DA 1B8UA 4HFRA 5ITVA 4RPKA 4ZRNA 1UXGA 1YJ8A 4E30A 1CQIA 2YQ5A 1YL7A 3VAZA 3FTPA 4NNJA 3LZ6A 3TRIA 3RU7A 4YJFA 1DHTA 4PZCA 1DXYA 2BH9A 5GZ3A 2VHVA 4B3JA 4NJMA 2CMDA 4B8WA 2NTJA 3ST7A 4UVHA 3GEGA 3PHIA 2B0JA 2Y1FA 4PIVA 4Y8VA 1Y8QA 3WB9A 1NYTA 4AL4A 1K2WA 4RZIA 5TNXA 3ZI0A 5EN4A 2D2IA 4GX5A 1XSEA 5JO9A 5AVOA 3PFFA 4ZRMA 3QV1A 1S6YA 4RVGA 4LVCA 4F46A 1OC4A 1YQGA 4M89A 4UVGA 4OJNA 1V6AA 1IHXA 1D1TA 3GHHA 1LI4A 1VI2A 2CVQA 3FWZA 3JYNA 4XQGA 1XQ1A 1ZZEA 4OKNA 3GC6A 4UEJA 4HWKA 5TF4A 4ONEA 3RKUA 1JW9B 1GYQA 4R1TA 2I65A 3F46A 1ISJA 4CQMA 5TX7A 4S3MA 3GDOA 3Q6IA 3S2FA 4OSOA 3SEFA 1T4DA 1ADFA 1I3LA 4Y6RA 2HMWA 4U5QA 2ILTA 5FYDA 2QZ9A 1LLQA 2JCXA 4FOOA 4DXHA 5B4UA 4W99A 1WXDA 3PJDA 4ZD6A 3HN2A 3ONDA 4RVUA 2PTGA 5DULA 3U09A 5IDYA 2PKRA 4P4NA 1P1KA 4OOFA 2I5PO 1X15A 1HTBA 3BHJA 2EKPA 3RC7A 1DFGA 3F4BA 3RFVA 1KOLA 5L40A 4WGGA 3PYMA 1N9GB 3DAFA 1Q7GA 2WSBA 3IQDB 3Q0EA 3BA1A 3VOSA 1E7RA 2D4AA 4A73A 5EQFA 4XYGA 4D0SA 3ENNA 2Y05A 4FIZA 3G1UA 1LU9A 4EJ0A 1BVRA 2GZ3A 1PL6A 4NBRA 2R00A 3WSWA 2CFCA 2D5AA 2JAPA 4II2A 4JBGA 3RUAA 3FNFA 1SOWA 4AJNA 4I5DA 2C2XA 5F3RA 1E7SA 1NBOA 2XXJA 3VDQA 1IZ0A 1PSDA 3ROQA 1KC1A 1Z7BA 4RCVA 2FZEA 3TQHA 1R15A 3MJ4A 1BMDA 2YJZA 4DBVO 3CUKA 2WJPA 3AI2A 3E03A 2UAGA 3E8XA 1BVUA 2VZ8A 2HUNA 2PFGA 4YEDA 4D3SA 3NDJA 4R68A 4BQRA 1P1JA 3JQDA 1IUKA 1IB6A 1EE2A 2HDHA 3I1JA 2CVZA 4XJTA 4BNGA 2VWPA 1CWUA 2X22A 4CMEC 1K0UA 4XZ3A 3KM0A 1YXMA 1BWSA 1GUYA 2FR8A 1X7DA 1DAPA 4L75A 4G2NA 3IP1A 4Q3BA 1LDEA 3H9JA 4BO3A 1E7YA 3AUUA 4Z0TA 2HJSA 2VRCA 4QXMA 2DTDA 3LSYA 4EUEA 2I3AA 3GDFA 3HG7A 3LDHA 4XA8A 1KETA 4HBGA 1B8VA 4HXYA 4YR9A 1AHHA 4AJEA 4Y6SA 1HL3A 1UZMA 3WQQA 4R5MA 4HX5A 1BXGA 1EFKA 7ADHA 3OJ0A 4ALKA 3RUDA 5DP1A 5JY1A 4BNKA 3BXXA 4NI5A 4KUGA 3E9QA 2I99A 3CKYA 3V1UA 1RYDA 1ZK1A 1JU9A 4XDZA 4YAGA 4QECA 2GR9A 2LDXA 1H6CA 2VYVA 2HK7A 3BHMA 4YJFB 1AXEA 3L6DA 4KUHA 5H81A 2PV7A 1HE4A 1EK5A 3ANNA 1WPQA 3F47A 1SOVA 2QZZA 3GG2A 5A3VA 2PR2A 4R9SA 4NBTA 2VNAA 2YZ7A 4DQUA 4FFLA 4CLEA 3DBLB 2P9EA 3OEYA 5KCZA 2OXIA 2DLDA 5A1TA 3ZNQA 1JLLA 2Y1EA 1Q7BA 1DFIA 1GPJA 1KY5A 3KLMX 3NYWA 1TT7A 1EMDA 3PI7A 1MG0A 5KTKA 4E4YA 3WR5A 2D1YA 4PRKA 3ZW8A 1HYHA 3JD3A 1PU2A 1IULA 5L51A 3W4IA 4YT2A 4JIGA 5FI3A 1S7CA 2H9IA 1GZ6A 3ENKA 3QIVA 1K89A 4CM6A 4MIOA 2FY8A 3D3WB 5TGDA 1IPFA 4R1UA 1SO8A 1ZO8A 1WW8A 4MVJH 1D8AA 2NNLD 2HRBA 4L4XA 4BNUA 1LJ8A 4TZKA 3UH1A 2C82A 4I08A 1E92A 1PTJA 2X0IA 3OQ6A 5I9LA 1LSJA 2P5YA 3C85A 5DCUA 4EJMA 4QFDA 3C7DB 4MKZA 4WK6A 3DXFA 2P91A 3ONEA 4D0RA 3TFQA 5L4LA 3QVTA 3JQ7B 3WGGA 4KDEA 1SMKA 4AJJA 1EK6A 4DC1A 3IIEA 3KO8A 1W6UA 1EZ4A 1C14A 5I7SA 2W4QA 3DOJA 2BFMA 5IDQA 5GZ1A 2D5CA 1B15A 4ILKA 4Z9XA 2W8ZA 3UAGA 2JD0A 3RUHA 3SLKA 1VJ1A 2G1UA 4NR0A 3JQAD 4YT5A 4B4UA 4RV9A 1U7HA 3HADA 2V65A 1TEHA 4BNNA 2C29D 4AG3A 2C59A 1Y9EA 4FSHA 1Q0LA 2Q2QA 5L53A 3LT1A 3QP9A 5COBA 4GAEA 3I9KA 1JA9A 1C1XA 4R54A 1XEAA 5JY6A 3OICA 1IYZA 3Q11A 1E3IA 4I5GA 1HEUA 3UFXA 4KTTE 4ZA2A 4QEDA 3P5SA 1JDJA 2OBYA 3PXXA 4IJVA 2EKQA 1CJCA 1NHWA 5I7VA 5F21A 2ZB8A 1Y6JA 4RPHA 5ICMA 1J49A 2A35A 2BHLA 3LC7O 3EYWA 1LRLA 3AM5A 1JVBA 4DLBA 1R12A 3E18A 2AE1A 3UN1A 4D43A 4A7PA 1E0DA 1H9AA 4GL4A 3T7CA 1QYWA 3UICA 1WAMA 4H15A 4BNXA 2ZYDA 3H8VA 2NU6A 1NFRA 4CMIB 4IDEA 3X2EA 1GEGA 2YHIB 4XYEA 3QVOA 4YB8A 4RF5A 5DN9A 2O2SA 2FSVA 1TI7A 1EUCA 4BVAA 4MP3A 3OJLA 1HYGA 4Q3EA 3WJAA 4CR8A 3WNVA 4J2HA 3HJAA 2CSUA 1T1SA 4QO7A 4JJIA 3WFIA 1AXGA 1TXGA 5G0TA 1H93A 1PQPA 5KJEA 3WYCA 2IZZA 2RH8A 4N5NA 4EI2A 4DVJA 1VSVA 4HUJA 1CERA 2G5CA 4BO2A 3JCZA 5IDWA 3PP8A 3B6ZA 1CRWG 2DPGA 1UP7A 4HKTA 1K6JA 3STHA 5KJ1A 1L7DA 2GN4A 2I67A 3FCOA 1BXKA 2Q50A 5B12A 3GRKA 1DBVO 2DFVA 4I5FA 1F0YA 1P1RA 4AJPA 4DMMA 5JFOA 5C5IA 3VZRA 3Q9UA 5B4TA 1GU7A 1V3VA 1KY4A 4TKLA 4WLFA 4B4VA 2Q1WA 1I2BA 3IJRA 4GLOA 4EZBA 3WDSA 1HF3A 5C37A 1IZ9A 1YL6A 3JD1A 3LLSA 4XQEA 4ID9A 1EVZA 1JTVA 1UAGA 1HT0A 3QSGA 4ND1A 4TKMA 3U4CA 1ONPA 1NQ5A 4D79A 4ZU3A 1U5CA 3Q9NA 4I8XA 5L4SA 3CXRA 3KYCA 4RDIA 1PJSA 1A5ZA 2YYYA 3AY7A 1RYEA 2YV2A 3DAGA 1SEPA 3ZWBA 1T24A 3G79A 3JQGB 5U1PA 5FFFA 3SJ7A 1D3AA 1LLUA 2CY0A 3GR6A 1LQUA 4BKQA 2EP5A 2O4CA 3DTTA 3PZBA 2H6EA 2NQTA 3MEQA 2VRCD 3Q2IA 2PGLA 2IZ0A 3NAQA 3WIDA 1B8PA 3DBVO 1PR3A 3EC7A 3ROKA 4QFCA 4CMJA 1JKJA 2B5VA 3WOHA 1ULSA 4XEHA 4BO5A 1YJQA 3H9EO 2CF6A 3L9WA 1JQBA 3MZ0A 3EW7A 3TNLA 1PJ2A 7MDHA 1T2FA 2WD8A 4WUVA 3RIHA 1C1DA 1C0IA 3WFJA 4PLPA 5JDIC 1U3WA 3F5QA 3I23A 4XX0A 1KVQA 1BG6A 1CYDA 1PJ4A 1VKNA 3DL2A 2D59A 5L4NA 1BXGB 3L07A 1KERA 1ZCJA 1F17A 1QLJA 4A5OA 4CLHA 3GVIA 2DUWA 3PQDA 1NQOA 3ROMA 1LDYA 2QYSA 4M54A 3WQRA 1P0FA 3OIDA 4B79A 1SPXA 2IZ1A 4LISA 5TRTA 1B14A 2JCVA 3GQVA 5IXYA 1YE3A 4IXTA 3KYBA 3HNPA 4Z9YA 2QG4A 1XHLA 4IDCA 3RU9A 1ULUA 2GLXA 3RUCA 4MVJP 3H65A 4P22A 2D8AA 4XB2A 2O2YA 3DB2A 3HDQA 1ENPA 2WEKA 3E9MA 4FFMA 1MC4A 4RO0A 1JVSA 5CDGA 1OMOA 1EVYA 4U6QA 3I9MA 3U62A 3V8BA 3S2GA 3UCEA 3I52A 1X1EA 3RUIA 3JQ7A 1A7AA 5BSFA 1Y81A 4K1LA 3GEMA 2AQIA 2X9VA 2Z5LA 2ZIZA 5FF9A 1I2CA 4L4SA 1A4UA 3LF1A 1TT5A 2TMGA 5T64A 4FR5A 5T8KA 4RDHA 5I8ZA 1E3WB 3I6IA 1CIVA 2AE2A 5F5LA 4CM8B 3ZV6A 4B8ZA 4JBHA 4MIEA 1DJQA 5DNAA 4DGSA 5C7LO 3SBOA 2BFPA 4P8RA 4YAEA 4MVJE 4D41A 3ZU4A 2E49A 4YTEA 4FD3A 5L7YA 3NRCA 2P9CA 4UEOA 3JQ9C 4UREA 5TT0A 4UUOA 4F45A 3LYLA 2X5KO 4FGWA 3AUSA 4KOAA 5KVQA 5JCXA 2WD7A 1VJ0A 3D4OA 4URFA 3W4JA 1VJTA 1A72A 2NU8A 1MG5A 4OH1A 4LK3A 4GX0A 1H6BA 9LDTA 4J0EA 1GEEA 1U4SA 4IZIA 2X0NA 5IAAA 1HSZA 3I9NA 4E5YA 1MGOA 1YB4A 4PN3A 2RCYA 2OOSA 1LDBA 5JO0A 1E1KA 3R3SA 5AQ1A 4PG4A 4CM4B 1LC3A 2RBEA 4FBGA 3WMWA 1XDWA 1ID1A 2OUIA 3KV3O 2P4QA 4U6SA 4GMGA 2Q45A 4AJKA 4E12A 2UUPA 2BI7A 2X86A 1DIGA 3ZGYA 3OHSX 3AI3A 1P0CA 3DOOA 4DUPA 4HFJA 4ESOA 1UP6A 1DLJA 2XPCA 4A0SA 3EUWA 4HFNA 1FDSA 1LLCA 4EUFA 2FWMX 4NMHA 3LC2O 5MDHA 3F1LA 2FN7A 4H3VA 4XWYA 4TRMA 1WMAA 3UW3A 3W6UA 2VUTA 5G4KB 3ADOA 2GSDA 3O4RA 3H9GA 1NPTO 2CDBA 2E6UX 3DBLA 3L6EA 1V35A 3W1VA 4E5NA 3DZGA 1HDYA 4K26A 3OBBA 1DRWA 3AU9A 3OJOA 3PZRA 3GF4A 5A9SA 1WP4A 1R66A 1R4NB 1P31A 4DBZA 3C7AA 2H5LA 3JQ9A 4OL9A 3VH3A 3FNHA 4L9RA 4CLXA 1YDEA 4IBOA 4IDAA 1NXQA 2VRBA 3BMCB 3WJ7A 4TWRA 1PJCA 2CNBA 3FTNA 4NH4A 4UVEA 1LTHR 3HDHA 1P1IA 4CR7A 4W82A 3JQFA 1EVIA 3WWYA 4YQZA 2GN9A 2A94A 4O0LA 1MUUA 4J49A 4NBUA 2X0RA 1H2BA 2NVWA 1I36A 3GFBA 3GFGA 4NZ9A 2XXBA 3H3JA 1C0KA 5JS6A 2DT5A 5LDGA 3TSCA 2NQ8A 4IJWA 1VPDA 5A03A 3PHJA 2QRJA 4ZVVA 1G0OA 2VT3A 2YHUA 3ASUA 1T2DA 3V5NA 1GPDG 2Y0CA 4JX8A 4L4RA 4PLTA 1UDBA 3R3JA 3BTUA 5TJHA 1QR6A 3RC9A 1EEHA 4XYLA 2X4GA 4I5EA 2J8ZA 5FWNA 1NQTA 3KHUA 3ZNNA 1UZLA 3G3EA 3TFOA 4HNGA 3TZHA 2PWZA 5T6BA 1QXSA 4RORA 1N7HA 3S1LA 4EITA 2PH5A 3M1LA 3GVPA 4P4GA 2OL4A 1WZIA 4UUPA 2NUAA 3H5NA 2R6JA 4RF4A 3U4IA 2WDZA 1KIFA 2NACA 4QO8A 4MOWA 4CM5A 2IEBA 3GPDG 1VL0A 4LRSB 3TZQA 1Q0QA 5DBIA 3H9QA 4MVJM 5IZCA 1CEQA 1EBFA 1KYQA 3JQEA 4L0QA 4BV8A 3GMSA 4AVYA 2OP1A 3H7AA 3TZCA 1QYDA 6ADHA 3GRPA 4YWJA 5JXWA 5C7OO 3BMOA 3ITKA 1PX0A 2C2YA 4FS3A 4WLNA 3VKUA 1NWHA 4BKPA 2CF5A 3PLNA 4PVDA 1ML3A 2YFQA 4CM3A 4GMFA 3HE3A 4PLFA 1VL8A 3WTBA 1PQWA 2VHZA 3OM9A 5L9AA 1KVSA 1Q7CA 1ZK4A 4GWKA 3DBHB 2E4AA 4M86A 1DC3A 2B4QA 2FHSA 1NNUA 4CMGA 1EUDA 2GO1A 4E0BA 4Z3DA 2YHIA 2O23A 1DIAA 5EQDA 1UXHA 1I30A 4A2CA 1O89A 4QUKA 4ZICA 3ETDA 3PLRA 3KRTA 4Z0HO 3G0OA 1GZ3A 3S2EA 1GQYA 2DC1A 3K2BA 5BNTA 4G81A 2H1SA 2J6IA 3INTA 3AU8A 4J7XA 3INGA 5BT9A 1X1TA 4I9NA 4Q3NA 5IG2A 3SC6A 3ZWAA 4WPGA 1MFZA 3PRJA 4FFOA 4KP7A 2EV9A 3S8MA 1N7GA 5TS3A 2VCYA 5HTOA 2QX7A 4U0JA 3CMMA 3HFSA 1PGNA 3K9QO 1E77A 3FI9A 3WLEA 2Y1OA 2HU2A 3QQPA 3OJFA 1TA4A 3PVZA 3OEWA 5DBFA 3VTZA 4FFPA 1GUZA 1D7OA 1OFGA 4RVSA 5AXCA 3ZU2A 1G0NA 1T2CA 2QRLA 3I9LA 4PLYA 4Q3AA 3AOGA 2ZB7A 5JMPA 2VHYA 4JN6B 4R3NA 4J9UE 4IY1A 4CQMB 3QVXA 4RVHA 3VH4A 4XD2A 2DTXA 1JKIA 1I0ZA 1NFFA 3GAZA 4FFNA 1H6DA 4L74A 1QMGA 1O9BA 5K0ZA 1ZEMA 1U2DA 1V3UA 2UUOA 3RFTA 4RGBA 1SCUA 4B7UA 3D64A 4RLSA 5T57A 1Z7EA 2EJVA 5F5NA 1X7GA 1OZAA 3NT5A 3KEQA 1HDXA 2AW5A 5A02A 4BO9A 4MVJI 4CM9A 4WASA 1RJWA 4LGVA 3UXYA 2JKVA 2BFOA 1MV8A 3ZHYA 3E5MA 2E82A 2PK3A 4BNWA 1IE3A 3JQGA 3QE3A 4PLVA 3ZHXA 3LLVA 3DWFA 3GDGA 2WMDA 3D7LA 3DOCA 4A10A 4PCVA 4CR6A 2I76A 5JCJD 2EF1A 4GBJA 3P2OA 3IKTA 3HN7A 2PLAA 1KS9A 3ITDA 1NR1A 4NJMB 4J1NA 4C4OA 5HM8A 4FJ2A 3ZV4A 3WYEA 1FDTA 2NU7A 4CQMD 3WS7A 4M8SA 3LK7A 3UUWA 1J6UA 2EXXA 1DC6A 5DZSA 4BNVA 3QHAA 4TQGA 1PS9A 2FR1A 4AFNA 2GNAA 1ZIDA 3L4SO 5A9SB 3U4HA 4TSKA 5BNIA 1MXFA 3TOXA 2O48X 2X0JA 4B4OA 2Y93A 3W4KA 3FWNA 1E3EA 1CQJA 1KC3A 3H5AA 3RBZA 3X2FA 1U8XX 3I83A 1V9LA 5HBRA 3EHEA 3VDRA 3ZZNA 1NM5A 1IL0A 5T8KC 5A9RA 4LRTB 1F14A 1DSSG 5IDXA 1ADBA 2VTDA 2VYNA 4U8GA 2QW8A 5IFLA 2P4HX 4GGOA 2YW9A 4K28A 4GWGA 3NT4A 1T2EA 4E31A 2IE0A 4XQCA 3CH6A 5AYVA 2HMTA 1U2GA 1IPEA 3JYQA 1GADO 2J3HA 3ASVA 3ZHBA 3G49A 3D4PA 3IOYA 3NV9A 3C1TA 1UZNA 2NSDA 1ONNA 1PJ3A 1YONA 1NVTA 2ZTVA 3IJPA 4BO1A 3RC1A 1T1RA 4PG7A 3K92A 1AN9A 4XIYA 4CLDA 4KDFA 1QYCA 2JFHA 2QIOA 4TZTA 4B7XA 1UXIA 3M2PA 3WWZA 4MIYA 1HDGO 2FPPA 2VHXA 1V0JA 4WEOA 4DIFA 3DZKA 3VPHA 1DRVA 1PZEA 5F1OA 2O3JA 4Y9DA 1TB4A 4X54A 1XR3A 3JQFC 3NDIA 1U7TA 1PS8A 3FPLA 5I8WA 4DIBA 4CLRA 4G5HA 4WNIA 3ZDFA 3Q2KA 2FSSA 4CV2A 4J3FA 4YBZA 3RASA 3FNEA 5CG2A 2IYOA 2ZJ0A 4N7RA 4R16A 4YT4A 1RPNA 1Z73A 3S2IA 3GZ4A 3WQSB 2IYPA 2O3SA 4E5MA 3KXDA 4BS9A 2AQHA 1B7GO 3ZNPA 4WCFA 3IDSA 1LEHA 4L73A 4NQZA 5HS6A 1E5LA 1ZSYA 2A9FA 4IJUA 3B20A 3I3OA 1WVGA 5IN5A 4FC7A 3QA9A 4PRLA 3IC5A 1DFHA 3PYXA 1ZXBA 3GK3A 1QSGA 5B1YA 1VSUA 2CDCA 3B1JA 2DBRA 2JAHA 2ZKLA 2ZYGA 2W90A 4J1QA 3H2SA 5HWSA 4XIJA 1B3BA 5TJ9A 4BKOA 1XQ6A 2EIHA 4I9HA 3IS3A 2DM6A 3H9UA 2WYUA 2RAFA 3F4LA 3NT2A 2QRKA 2DPHA 4OMUA 1YS4A 3ON5A 2PY6A 4PLWA 1NPDA 3FBGA 3VH1A 1AGNA 2WWRA 2XAAA 2EG9A 2B4RO 3E9NA 2OHXA 3WGYA 5JDCA 2ET6A 5JYEA 4CUZA 5BSHA 4AJLA 3AK4A 3WTCA 1ISIA 5K6AC 3KVOA 4KQXA 4NBVA 2GYYA 2EJWA 3OIGA 3RWBA 5L7TA 3U0BA 2C07A 4WNCA 4ALMA 4MO2A 4BKRA 1R0LA 4CQLA 4DLLA 3RI3A 3WGIA 1K6IA 1YO6A 3CMCO 3JV7A 5G0UA 4CMKA 1YVEI 3MTGA 5BSGA 4F3YA 4EGFA 3O8QB 2YDYA 4H7PA 2NTVA 3JQ6A 3ADPA 5GY7A 1N92A 4GSLA 3UCFA 4ROSA 3CTMA 1QV7A 4ZQBA 3RBXA 1KEVA 1ZK0A 3JQAA 4AJOA 3B1KA 4R69A 5F1KA 5JE8A 1HE3A 5AXBA 1QORA 4E13A 2HSDA 3QWBA 1E6WA 2J5KA 1KEPA 1GV1A 4PGFA 2ZK7A 5CDUA 2GN6A 2RIRA 1DEHA 4RL6A 3ZH2A 4MP8A 3LQFA 3BMCA 3AM4A 1GR0A 3OFSA 3TPCA 3GZNB 3WGQA 1R4MB 1Y7TA 4AJ2A 5KWEA 1XELA 3D0OA 2DBZA 1MB4A 3TZ6A 4BGVA 1YH3A 3AUTA 3DAPA 3KYDB 1CDOA 4YRAA 8ADHA 4IGFA 3HUDA 4ZJUA 1U3TA 1ZW1A 1WDLA 3IMFA 2PGJA 4YRBA 5ITWA 3L0DA 4PLHA 5CPBA 5JAMA 4J1TA 2E37A 3LT4A 2OBNA 1MC5A 3AI1A 3RBVA 3R6DA 1OC2A 3TN7A 4CUJA 3PDJA 4HV4A 1HZJA 1U4OA 3FRJA 3JD0A 1EBUA 4XJSA 3PWKA 2AA3A 1PGQA 4NJOA 1W0CA 1VL6A 1GCOA 4LVUA 4EW6A 4BGUA 4JLWA 1ISFA 3B1FA 3DZIA 3ZWMA 3DHEA 4WECA 5DDIP 2EWMA 5G0SA 1D4FA 3D5QA 4WLUA 2P2SA 3CZRA 3IP3A 4J16A 4YVFA 1FK8A 1J5PA 2WTBA 5DCYA 2PGDA 2Y1CA 2Y66A 3KBOA 4DPLA 1UXKA 3O8QA 3V1YA 4CODB 4LSWA 1SC6A 4GKVA 1LRKA 3K8ZA 3HZZA 1GY8A 5JSFA 1EQUA 4J0FA 2WD7B 2HO5A 1RM3A 4QSMA 4YJDA 4FB5A 2RHRA 4M55A 3WX0A 3DFZA 3KSZO 3GMDA 4UVDA 4R4JA 5C3MA 3C3XA 1I8TA 5A06A 1GL3A 4WLEA 4CMEA 1J0XO 4D45A 4RF3A 4BO4A 4L76A 3PPIA 4RVFA 5B4VA 1E1NA 2VOJA 1M2WA 3VPSA 2NU9A 2HMUA 5LCXA 1ZKMA 4OXNA 3ZW9A 1Y8RA 4FC6A 3DFUA 3DBHA 4R1NA 1I2ZA 2DQ4A 1LC0A 5G4LA 1YGYA 1P44A 4Q3CA 5A3JA 3FPCA 2B69A 1TT5B 4WOJA 3N74A 1NAIA 4BQPA 4KMSA 4GGPA 1T26A 3DBRA 4FJ0A 3GGPA 4EEZA 3MWDB 3H4VA 5I9MA 3GN2A 4ND5A 1WWKA 4RPJA 4E2ZA 5G0VA 2DKNA 3RFXA 5IZCC 1BDBA 3V2UA 3CIFA 1EUZA 4W9NC 2XOXA 3FNGA 2NADA 5CP8A 2FR0A 4I9UA 1PGPA 3BIOA 1ISHA 1HLPA 3WGZA 3A9WA 3ICCA 1W8DA 3PGXA 4PLGA 4KZPA 3KOUA 5HA5A 1FMCA 2ZCUA 2ZATA 4IJKA 1WDMA 1ENYA 1FJHA 1R4MA 3MJEA 4IINA 4XKJA 5TC4A 1N2SA 4D7AA 1R0KA 2JJYA 1Z82A 2BKAA 2VWHA 3O38A 4JJGA 3AOEC 2VHWA 4GX2A 3E48A 3AM3A 3IAHA 3QRWA 3BMNB 4ZQFA 3PHLA 3DZJA 1LRJA 4JBIA 4J4HA 3UCXA 2O50A 3K31A 3QVSA 2AQ8A 4J4TA 1K3TA 1Y8RB 3U9LA 4CL8A 5IJZA 1XKQA 1O5IA 4FCCA 4GVXA 3RKRA 1H2HA 3GGOA 4XR9A 3HB5X 4BNFA 3DZFA 1NP3A 2ZYAA 4PZEA 3ABIA 1U3VA 4M87A 4XGKA 3C1AA 3QWIA 1A7KA 1YBMA 4ND2A 3ETEA 1DLIA 4Y98A 4J7UA 4ND4A 2BFAA 4YACA 5T5QA 5KJ6A 3DHYA 1U5AA 2EEZA 3MJVA 4ZQGA 4YQYA 4JK3A 1C1DB 4AJIA 1LLDA 4ZN6A 1GYRA 2NTNA 1SBYA 2Q4EA 1GFSA 3DBRB 4NPCA 5AXDA 3L77A 3QVWA 1OOEA 4RF2A 3T4EA 2W2KA 4BNYA 5JDCC 3KEOA 4DWVA 2VQ3A 1EE9A 4OGWA 1MFPA 1A9ZA 2O3QA 4BO0A 3CSDA 2AEFA 3E1KA 4ND3A 4IMPA 3Q3CA 3ZU5A 4RPGA 4Q3DA 3TL3A 3PK0A 1QP8A 1M66A 4RLHA 3WBFA 5BQFA 5I7FA 4MVJA 5FI5A 4MVJD 2WM3A 5L95A 2OORA 2GPTA 5J23A 4LSMA 4IM7A 1KBZA 3G1TA 4E32A 3OF2A 3GNTA 3O26A 3KB6A 4E21A 1DPGA 3AFNA 2XF8A 2JCYA 2OGUA 2CUKA 3JYPA 4MP6A 3KSDO 1BDMA 1C3VA 2Y1DA 1PEDA 3GPIA 1ISGA 4MVJG 1LX6A 2X58A 1ADGA 4D3DA 3NGLA 2W98A 4J6FA 3PHHA 1SEVA 2GASA 4BNTA 5TLSA 1B3RA 2X23A 1Y8QB 2NM0A 2SCUA 2FZWA 4NHEA 4WLOA 1JN0A 3R1IA 1JWBB 5ILGA 1P9LA 2Q46A 4XRRA 4BNLA 1NQAO 4L8VA 1UP4A 3D5TA 4R51A 1PR9A 3L4BC 4YYZA 2NVBA 4N5LA 4IZHA 3P7MA 1E3JA 1MP0A 4DC0A 1EDOA 2X8LA 1GD1O 4IDDA 2V6BA 1PQUA 1HYEA 1O6ZA 1YBAA 2Y67A 4W7HA 1LSUA 3DQPA 1SB9A 1ZUD1 4OKIA 4FOSA 4BB6A 4YPOA 1N5DA 4W7IA 4W9NA 4PG5A 2NVUA 2Y1GA 4TROA 4J4BA 3L6OO 4IQ8A 1CF2O 1FF9A 2PH3A 3OETA 2GN8A 4XGIA 1Q2XA 1X14A 5A5EA 1HKUA 2YV1A 1W4ZA 2G0TA 5CAEA 3OA0A 3BAZA 2A92A 3TOZA 4CPDA 4OHUA 3ORFA 1I32A 3OSUA 2GCGA 4FN4A 5ICSA 1VLLA 3ZWNA 2IEDA 3DR3A 2C5AA 3FN4A 5DCWA 5ER9A 4ZHSA 2Y99A 1GAEO 5TIIA 3OJEA 5KKCA 2BELA 4P4LA 4BMNA 3GNQA 1BGVA 1XIVA 3ONFA 4IDGA 4CMCA 2YDXA 4D3FA 2X9GA 1R16A 3M1AA 1LDMA 4OO3A 3I5MA 3KUXA 3S55A 1E3SA 1Y5MA 1DIBA 1HETA 4XDYA 2EP7A 4E33A 2POQX 1B0AA 3WG9A 5I9NA 1LA2A 4YCAA 4O63O 1ZSNA 3PIDA 1AE1A 3NDRA 2VT2A 2Y68A 1ORRA 1QG6A 5LC1A 2X1HA 3PWZA 3E5RA 5EPOA 3ZWOA 3SX2A 4TVBA 2HKIA 3Q1LA 2DBVO 4P38A 1N1GA 1PL8A 3F1KA 2JL1A 1PJLA 1TVEA 4LMPA 4BOYA 1SAYA 2VYVD 3UHAA 4NG5A 1HWYA 4DRYA 3K30A 2BGKA 3CZMA 4UUMA 4DYVA 5KVCA 2Y0DA 4RZHA 3W8DA 1LUAA 1QRRA 2IXBA 2UDPA 3VPFA 1PL7A 1Z6ZA 4KTVE 3EZLA 4B7CA 2B4TO 1HDRA 3UVEA 1ADCA 1LQTA 3CEAA 1LSSA 3QW2A 2J5RA 1EQ2A 3K73O 3PWSA 2NVUB 3RAJA 4F6CA 3I9JA 4JXKA 2Q1SA 1MA0A 4J7CA 2VYND 1LXCA 4RJTA 3D4NA 5CHEA 2YV3A 1J4AA 1NASA 2HMVA 1ZVMA 3QWAA 5FEUA 5BR7A 3BZUA 4DPKA 3R0IA 4O6VA 4S1VA 2YUTA 5K6AA 4EYEA 3DMTA 2YQ4A 5JCJA 3I9OA 2VNSA 4PG8A 3AOEA 4QX6A 1EVJA 1NWCA 1UXJA 2FOIA 4U0KA 2IXAA 2PKQP 3PFWO 3ZNOA 3MJCA 4YDRA 1A9YA 4J1SA 5GMOA 5U4QA 3H6KA 4XYBA 3HWRA 5EIOA 4IIUA 4M1QA 2GUGA 4Y67A 5A4DA 3NJ8A 5THKA 2I66A 2UVDA 4Q9NA 3WLFA 1XU7A 4E2YA 3BTVA 1ZK2A 3EDMA 3PTZA 3VKVA 5JC8A 2C7GA 1BW9A 4QT0A 5EESA 1U9JA 4EBFA 4IUYA 4K6FA 1DC4A 1TLTA 3FD8A 2VN8A 3NX4A 3FHLA 1ISMA 4YRDA 4CMAA 2J3JA 1JKFA 3RUFA 3IKVA 4IS3A 2X5OA 3BMNA 5G2OA 2W2KB 1R4NA 4W6ZA 1D1SA 5KVVA 3NEPX 4NBWA 1M6HA 4BO8A 1DJNA 4DIOA 1IHYA 4WJZA 5KKAA 1I33A 5HS4A 5JDIA 4WCDA 5DBGA 4XCVA 3P2YA 1RKXA 2EERA 2JFFA 3DTYA 3EAGA 3VH2A 1V3TA 3GOHA 3BMOB 3OMLA 1Q1NA 4WE3A 4JROA 3VTFA 3DZHA 3VHRA 2WYVA 4XGNA 3ZU3A 2FRDA 3MJTA 4R1SA 4A03A 4N54A 3D3EA 4A26A 1K5HA 3PYLA 3VZPA 1IY8A 1LDNA 2RHCA 3LT2A 2OP0A 4TRNA 3VC7A 2FPGA 3BTOA 3ZCXA 5KVSA 2X5JO 4ZQEA 3D1LA 4IDBA 1YB5A 2C20A 3T7EA 2Q99A 2JHGA 4IQ0A 5KIAA 1O94A 2VUUA 3F3SA 4GLLA 4YJGB 5A05A 4DA9A 4LCJA 4BGIA 5KNLA 3PDUA 2NLOA 4JCOA 4EEXA 2FP4A 3UOGA 5JC1A 1HE2A 1UDAA 9LDBA 2TMDA 3ANMA 3HHPA 1WZEA 1V8BA 5DT9A 2O4UX 4YA6A 4TVOA 3M2TA 1HSOA 3A06A 4DPMA 1UUFA 5ADHA 2F1KA 4IIVA 4UEKA 5TSDA 1VRWA 4UAGA 5JBIA 3EY4A 3V1TC 3KTDA 1KVUA 1XWFA 4NIMA 4XB1A 4CJXA 2B37A 4ALJA 3DMYA 3ZV5A 4CQLB 5CEFA 4OAQA 4CL3A 4BNIA 1L1FA 4D42A 4LN1A 4OQYA 2GRAA 1B26A 3WNQA 5JW6A 3INRA 5L3ZA 5EERA 2PZLA 3WGTA 1O0SA 3I4CA 4AJ4A 3GLQA 3VZQA 4E6PA 1AUPA 3RSHA 3U4DA 3PIIA 5DOZA 1YOVB 4PVCA 2C7VA 1GQ2A 4JP3A 4IS2A 1E3WA 3JYOA 5ES3A 5CFZA 2PZKA 5A5FA 3TDKA 3VPGA 2G76A 3JSAA 3F9IA 2IDZA 1M6WA 1YL5A 1VC2A 1B2LA 1KVRA 4YAJA 4XR4A 3SXPA 3OQBA 3MCVA 1QLHA 1M75A 3NKLA 4JJFA 1A71A 1DIRA 3DO5A 1NR7A 3TL2A 1QKIA 3VVCA 4DYDA 1LBEA 4GKBA 5JAIA 3ICPA 3WSVA 5CPFA 3NGXA 3ZWWA 1MX3A 2V6MA 3C7CB 5MGBA 5CEEA 5IXSA 1HLDA 1B16A 1CETA 2BD0A 2G82A 3NTOA 3GUYA 3OH8A 1X0XA 4YAKA 5HRUA 3OECA 2VWGA 4GQAA 3WICA 3W6ZA 2W2LA 2H63A 2VUSA 4ZQHA 1XGKA 1EDZA 2O3TA 3O9ZA 4J43A 5EL0A 3B70A 3KYDA 1ZJYA 2BMAA 1HE5A 1DRUA 2VZ9A 3P19A 2FMUA 1K6XA 3LVFO 3RC2A 1PGOA 4RVDA 4OSPA 3ZWPA 4PLZA 4DLAA 1GV0A 2GGSA 4OQZA 3ROPA 3FR8A 4R01A 3PJEA 1PJTA 1DHRA 2IRWA 2WE7A 4OIMA 2Q2VA 1ZH8A 1U28A 3QWFA 2P68A 1XCBA 3ZWVA 3RUEA 1PS0A 3EZYA 3M6IA 1ARZA 4RQTA 4MJLA 5COAA 1E7QA 3ZWYA 3FF4A 4C7KA 1ZFNA 3G17A 4FDAA 4A27A 1I5RA 1Z45A 4WOKA 3BYZA 3EMKA 2X6TA 4K9DA 1HDCA 2G17A 1RM5A 2Y0EA 3SC4A 2Q2WA 2CVOA 2CD9A 3GEDA 2I6TA 3L4BA 3DONA 3CE6A 1DAOA 4ALLA 4INAA 4O59O 3KYCB 1PJQA 1X0VA 2ZB4A 3BHIA 3ZWXA 4Z3KA 1U3UA 3AY6A 3JQ8A 2F00A 4UUNA 4BNJA 4HY3A 1RM4A 3FR7A 3GVCA 5CDSA 4CLOA 4I1IA 3O03A 3DEYX 5JNLA 2PZMA 2UV8A 3TZKA 5BSEA 2O7QA 2EKLA 2P9GA 1X7HA 1OAAA 2BF7A 5L45A 2W2LD 5G4KA 5T67A 2JHFA 3EGOA 2WYWA 4B4WA 4MPDA 2E48A 4BGEA 2EGHA 1ZBQA 3WBBA 4R41A 1PIWA 2FPIA 1QYXA 3SLGA 1ZEJA 4FFRA 4EJ6A 1ONOA 5F1PA 1YDWA 1BXZA 1JWAB 3A14A 4OXKA 1P77A 4UULA 2J3KA 1E1MA 3TJRA 2B35A 1NPYA 3OP4A 3KLPX 3JQ8B 3HDYA 3GVHA 1UAYA 1DO8A 3GG9A 2GZ2A 1VE9A 2C0CA 3GAFA 3MJSA 4IDFA 2PA3A 2BGMA 1DDOA 3N7UA 4IQGA 5I7EA 2O3RA 1WNTA 5CDTA 5CDYA 4F6LA 3IL2A 2HQ1A 2ZQYA 4H16A 3JQBA 1KEUA 6LDHA 1EFLA 1BTOA 4OYRA 4DL9A 1GCUA 1SB8A 4WCFC 4YXFA 1E3LA 4CUKA 2VWQA 3COSA 4R9RA 5EJ2A 5U9CA 1O95A 3AY3A 2HK8A 5IN4A 1N8KA 1F8FA 1WMBA 3MTJA 1YB1A 3GNSA 1P3DA 3DC2A 2HMSA 3EVTA 4WKGA 4LMRA 2Z1MA 2AG5A 4R5HA 5JYDA 2AEJA 1DIHA 3VPXA 4TRJA 4CMIA 1E1LA 4J90A 2DVMA 4WEQA 4CM1A 3HDJA 1ENOA 1YQXA 1SNYA 1W73A 1YWGO 4CLOB 2EGGA 1F12A 4AJHA 5AXAA 1Y1PA 1ZNQO 5A9TA 4E2XA 1Y9AA 5GZ6A 3BMQB 3KSUA 4HNHA 1I3MA 2YY7A 2ZTLA 4Q39A 2EW2A 2GERA 4II3A 4RPLA 4PLCA 1WDKA 4NFYA 3U49A 3AWDA 3H3FA 4OXYA 2C5EA 5DF1A 1GDHA 4MKXA 1G6KA 1OBFO 1HDZA 1ENZA 4FW8A 4IXWA 5EINA 2DAPA 3DZBA 4KQWA 4UVIA 4BL5A 1FDUA 3HQ4O 2R00C 1QYVA 4WCFB 4R3WA 3K6JA 3RJ5A 5JAQA 1ZSVA 3W8FA 3ZV3A 1E7MA 2DTEA 2HCTA 3QJ5A 3C1OA 3RVDA 1SZJG 3H2ZA 4OM8A 4KWHA 4FPXA 3AJRA 5JLAA 3CINA 3NUGA 1H94A 2WE8A 1P1FA 3MOIA 4CV0A 4D46A 2ZB3A 3LF2A 4BKUA 1U1IA 1ZMOA 1O8CA 4FQ8A 4MVJF 3EVNA 4E2WA 1IOLA 3QLJA 3RD5A 1FXSA 4N5MA 3W8EA 1WLYA 4RQUA 1GZ4A
chains in the Genus database with same CATH superfamily
5BWCA 4LMBA 3GY0A 3NIDB 2PSDA 3B7WA 4W5TA 1DKLA 2BKUA 1P4JA 3WIEA 1VMIA 2QGNA 4FJ1A 3TWOA 3WIBA 1RZ3A 3BWMA 1FP4B 2QL7A 1I24A 5BWNA 5FWXB 2WMOB 4HAUA 2QTVA 4M8LA 2ZRBA 3WWPA 4NE7A 1VCHA 1YR1A 3DMGA 5CYPA 4AUNA 2JD1A 2LW7A 2B61A 3CS3A 4BPBA 4J1TC 1JEQB 4HNUA 1CS0A 1M0TA 2WFLB 4MROA 4C3VA 4AMBA 1HORA 3NTRA 1KOJA 3WKAA 3IUYA 1JLKA 2JAUA 3GT0A 2ZPUA 2ZYRA 2P6NA 4Y6PA 5HBGA 3DCNA 1QP0A 2FN3A 5ALLA 1VKRA 3RV3A 1BW9B 4UJ3A 4HRVA 3I37X 5EFOA 3NBUA 1L6IA 3NFRA 4LY6A 1UJ2A 4F38A 5D2CA 5JPIA 5ULLA 4YMLA 5LQUA 2O1EA 1GGVA 3QWHA 5EMHA 2FPXA 3QEMA 1D0IA 3SD7A 1CY7A 1Q11A 3GUZA 4BMYA 1F7UA 1PHRA 1I7PA 1IDOA 1BMFD 1FSSA 3RTDA 4OQEA 1ZL0A 2FNAA 3IQGX 3RWMB 3PBKA 2W9XA 1FDOA 2BJVA 4JGBA 1JDTA 4JUBA 4EYKA 3N8NA 2BW0A 1N6KA 3DNMA 1W8IA 3VZBA 2VOEA 4JU8A 4RH3A 3DP9A 4MINA 4B40A 1NVMB 4DQVA 4F1WA 1QRSA 3C0KA 1P2BA 1RYFA 1NYLA 1RQNA 3B2NA 1WS6A 3BF7A 4G65A 4QHTA 4R1PA 4RIEA 1M76A 3CRZA 4ZAXA 3OT1A 4EUHA 2ZXFA 5BN5A 1KDYA 2OFWA 5LMUB 3M5DA 1ZHHA 3LC1O 5ALFA 4MYHA 1CG6A 1CUWA 2D2FA 4HAOA 4X94A 5H83A 3W7VA 4URUR 4HADA 2PZFA 3HYTA 3WIVA 2IYYA 3A9RA 2I7CA 5SY4A 2H29A 4PFQA 5EJGA 1XP8A 1A2QA 1DC5A 3R5JA 4H6PA 2HA4A 3NBXX 4WQMA 1MLDA 4IEIA 1V7PC 4TS1A 3ZXXA 2L17A 1PZGA 2BJHA 3KQPA 1HXHA 4NESA 1L4UA 1XZAA 3C3EA 4N9QA 2ZAIA 1U8FO 3OA2A 5KYXB 3CPSA 2FZVA 2LDBA 1PGJA 2B1JA 2W37A 1U8YA 3HXPA 4FEGA 2V7PA 4PZDA 3ZE9A 4C6TA 4NK5A 3MWEB 4R8VA 4NCJA 4MUMA 3TQRA 2GOYA 3DEIA 3ND8A 4CM4A 4RZ2A 5JAZA 1SQ5A 3GBPA 1T2VA 4V3BA 1X94A 1P1HA 3X2SA 3DDNA 1FNBA 4FGKA 4ITUA 1WG8A 3IDOA 5C9ZA 1DKOA 1VKOA 1GUFA 1T0JB 4FGSA 4R8RA 5BNFA 4CM7A 1VDMA 2VJKA 1QC5B 2R7KA 2ZU0C 2QN8A 2ZRAA 3VQTA 3GP5A 2VXCA 1BNCA 2B78A 2YVQA 5BRNA 3QKRB 4C7JA 1Z0SA 3SG0A 4Q66C 2G25A 4MR9A 3E1SA 2I3GA 4OL0A 4UXJA 2BHSA 1OX5A 4URHA 4P31A 2H2AA 1V1MB 2RJOA 4YAFA 2GESA 3OHMA 3G5UA 1Z6AA 3V8EA 3TNYA 4DQDA 4BHTA 1JU4A 1Y33E 4C2BA 2ZZNA 2AMFA 4NFHA 4URYR 1EX9A 1L7VC 1FFBA 3AILA 4JQCA 1DAMA 2ZTUA 4FMCF 3Q8KA 3AVQA 4MW9A 3WNZA 2G9UA 2BFBB 1Z68A 3BUSA 2HQRA 1KSHA 2VR1A 3MSXA 4IGIA 1Z35A 1AHIA 4JNKA 2XMQA 4Q18A 4LDNA 4RY0A 3USCS 5JCOC 4ZWNA 3TYXA 5EHZA 3SOZA 4D80A 3KKQA 3BIXA 4Q34A 3VVBA 1JFFA 1U3CA 1N2XA 1Y1SA 3KZ1E 4EZEA 3EVBA 3UMMA 3Q1KA 1NJ6A 2HDWA 3EZ7A 4IVQA 1IC6A 4UEQA 5B58C 1XU9A 3L6BA 4MYDA 5A4AA 5FTWA 4WZBA 3RJ9A 4YCSA 5HF5A 2G36A 5TQVA 1RXIA 2PFSA 3EK2A 4K05A 3GHYA 3B82A 1VGQA 2FGKA 4JKOA 2IU4A 3SSMA 4DJ5X 4CV1A 4ML3A 1L8QA 3HR8A 4PPFA 4U6NA 5ICFA 3IEMA 2GZSA 3CLSD 1Y80A 1E99A 2GKGA 4HAIA 1JFSA 1EX1A 4GPD1 5IH3A 3ETGA 1GQQA 3ISTA 5J2UA 5G0WA 1XEXB 1ST3A 3OO1A 3QLEA 3A58B 4W4TA 1OFVA 1UC8A 5EKUA 1X13A 3ZE7A 4DJDC 3R09A 1HMYA 2WV7A 1ES9A 1E8NA 4DCTA 4U2CA 4RWZA 2GVNA 3NUQA 2HSEA 4IHJF 4O2BA 4RLQA 3FDFA 1E5QA 3I62A 4FM9A 1G9SA 2FPUA 2NUPB 3REQA 5E6RB 2JGLA 2JIDA 1DE0A 1KZ1A 5FD8A 1BX1A 1FYVA 1ISSA 1S3IA 3TE6A 4CIAA 3UBTA 2I71A 2OQIA 5ENVA 2NWQA 1Z6YA 3HDGA 4M9UA 3QG5A 2I29A 3EBPA 4B80A 3UPTA 3I4FA 1G21E 1C0PA 5JQGF 5JNVA 4UDXX 2JG3A 2P62A 5CEJA 1TC2A 1PT9A 2OXFA 3S8YA 1A27A 3I0ZA 3MJDA 2W2TA 1GPUA 1R00A 5GGXA 2BCJQ 1WCIA 4PIPA 2R2GA 2PX4A 2HLPA 3IEVA 1ODIA 4K3VA 1Q0HA 4B9AA 5A5GA 1YULA 2WTXA 4DANA 3BTSA 2QQ5A 1XFAA 3BORA 4EH1A 1CUVA 3KVVA 2RH4A 2WF8A 1U2QA 5EJIA 5AVKA 1NBMD 3IQHX 2QUIA 2F8TA 4S1TA 3D8NA 4FIDA 4RSGA 4B4DA 3ZW7A 5BORA 4PAQA 5JASA 3BL5A 2GYVA 4HEA1 2O7NA 2CHFA 3ZIAA 3ZOZA 1W581 3HMKA 5AOVA 5I9TA 3L9XA 2D5LA 5FDFA 4P7JA 4N4AA 3VO2A 3QLUC 5DMHA 2AOTB 3PEFA 3W1EA 2GETA 2BJWA 4O2AF 1AKUA 4JI3B 1N6LA 1PZFA 1V5FA 2BLLA 3CCFA 3HCRA 4K0RA 4JBNA 2I87A 1CR1A 2B5WA 4QOEA 1BHSA 4EB8A 3OUTA 5HIAA 3V2HA 1FRNA 4FSDA 1HK7A 3OIFA 4LXIA 3N2KA 1C0LA 1P5RA 4S1WA 5JLJA 2AB0A 2DUUA 1L5QA 2VUIB 3HBNA 1XEWX 2QX4A 4RVNA 3WGOA 4ALNA 3EGCA 3LBFA 5DI3B 4W5RA 4E3ZA 1BX3A 4MW2A 4HX9A 1NQXA 4MW1A 3ZE0B 1ZITA 2PSEA 2R4UA 4C3UA 2HTEA 5L6MB 4XQ0A 2I6SA 2QENA 1WXFA 2GZRA 2JZNA 3K5PA 4A6EA 4PTLA 1O03A 2G5TA 3GLKA 3QPCA 2I78A 3GCWA 5H0IA 4AZ0A 1DTWB 2ES4A 4IZOA 3U3MA 1UQRA 4FVTA 5JZVA 4IV5A 3D31A 5UKDA 1UBMS 1QBKC 5DVZA 4IZ6A 1UXGA 1YJ8A 4NDZA 1CQIA 3THWA 1YL7A 3FTPA 3DLPX 2QPTA 1V43A 4K6MA 3DUFB 1DXYA 4M3NA 2R66A 3UYKA 4NJMA 2CMDA 3ZOKA 2R97A 2QT1A 1Y3DE 3D1JA 1X19A 1MPTA 5DBHX 1H69A 2FK7A 4F9EA 5EHXA 1WUIS 2NO7A 3PHIA 4DWWA 1O97D 4LKOA 3WLAA 2ZJZA 3WMGA 1Y8QA 3CEMA 3B1ZA 1ODKA 3ILSA 3T5BA 1N5RA 1O94C 2M6RA 1OA0A 2R1TA 5TNXA 3AKCA 2R1VA 2VP2A 2YRXA 3C5HA 4I81A 1TAGA 5EN4A 5TQ0B 3ZCQA 1HNXB 3WWEA 4JOBA 4B7AA 2R8OA 3BH6A 3WL5A 1KPGA 1TM1E 1S6YA 2GMWA 1OC4A 1UFQA 2IHUA 4M89A 5ILQA 3H9CA 4OJNA 3O5AA 4U2GA 4G67A 3AESA 4TTJA 1EFVB 3GHHA 4PBTA 3ECSA 4FZ5A 4JZKA 2BFEB 2H7XA 3FWZA 4L78A 3VJLA 4TXLA 4I3HA 1IG3A 3GC6A 3FSEA 2GEJA 2ODWA 4DY4A 1BN7A 1U7XA 5EWMB 4B17A 4K2AA 1ORDA 4L8FA 4CTKA 3KJHA 4ONEA 2ZIWB 3CH4B 2R0QC 1GYQA 1EP9A 1NVFA 4KWTA 2XUAA 2EEPA 4I0WB 5B7PA 2D7DA 2J32A 5LWQA 1ISJA 1W29A 4CQMA 4S3MA 1Y3AA 3S2FA 1H1LB 3BILA 1G8MA 4OSOA 3WLHA 1UDXA 2P4EA 4R2XA 4RQAA 5FTLA 5KSYA 1I3LA 2C00A 2HMWA 2JIOA 2P6UA 2ILTA 1SBNE 4U5QA 3TTTA 1HGXA 4ETWA 2NZXA 2C2BA 3FGNA 4PO1A 1WF3A 2O1WA 1V7CA 2OZLB 4XLLA 4DLZA 1MOZA 3A6JA 5C1DA 1IHUA 3LA6A 4G5YA 1YC5A 3ONDA 3WKCA 3SNKA 2ZROA 2QZSA 4ZT5A 5ITSA 3NO4A 4MDYA 2PKRA 2FJPA 5E6SB 4D9MA 3ILYA 4NG4A 4OOFA 2Z56A 1PKEA 2GB4A 3GQBA 5AM5A 1Q7TA 1L1QA 4ZCLA 1FIUA 1G3QA 1KS2A 4G23A 3S68A 3BHJA 3GFSA 2NUAB 3ENQA 4LXHA 4LBYA 3F4BA 2IYRA 1K8ZB 4WGGA 4Q0MA 1DQRA 1N9GB 2V7GA 4MUKA 4MX8A 4ZV4A 1BIFA 1KYYA 4K8RB 4US2R 2HF7A 2WHYA 2NQ2C 3KC2A 2A5JA 5CH8A 5FUVA 2BISA 1BVRA 2GZ3A 3MFYA 1SQ6A 4RFVA 1F6DA 1ZD5A 5AJTA 3VTAA 4BTVA 4DRXA 1ULTA 1EYZA 2Q3FA 1EJ6A 1QOZA 3HV0A 5FQOA 1YV9A 2CFCA 4J07A 3WSWA 1XZ8A 5EZSA 3SJCA 4JBGA 3OWXA 3FNFA 4BUZA 1SOWA 4QXPA 1XTVA 4BYMA 4FCVA 2AJ8A 4BUJA 3HKBB 1P62B 1XCGB 3FCEA 4CT0A 5FOXA 1Z33A 3EXG2 3KZCA 4TXMA 1IZ0A 5HKKA 3OF3A 2HQOA 3GRFA 4C4ZA 2AZXA 4JR2A 4DB2A 1YF3A 2W42A 1R15A 3MJ4A 1BMDA 1GIAA 4FXOA 1SY7A 3VOAA 2YW2A 4CGYA 4J6EA 2ZREA 3EARA 4RDCA 3NCHA 4JQYA 1KQOA 2UAGA 4OX9Y 1G3RA 1WX1A 1ODFA 2VZ8A 4JVNA 4YEDA 4D3SA 1APBA 3FVQA 1W76A 1DRJA 2K5UA 2JFNA 1Z3CA 1IBLB 3OUUA 2HHHB 4L4ZA 3QVJA 2H3EA 1EE2A 3B78A 5I7WA 4XJTA 4BNGA 4ARCA 1XRJA 3EPLA 2IZ5A 1KAHA 2QRVB 1K0UA 4NXNB 3KM0A 1E96A 3WB1A 5FOTA 1JR2A 1DUIA 1W5FA 1IG0A 3E9DA 1U9IC 4JOCA 4XE5A 3QUTA 4P0QB 1JHXA 4L75A 1JLLB 3HCAA 4G2NA 4X71A 3IP1A 3A1UA 3R44A 1BD4A 4Q3BA 4XOIA 2AJBA 4M1ZA 4XXHA 4OLBA 1KEEA 2XCQA 3FIUA 1JG7A 3QUAA 4BTLA 1AMUA 1CDDA 2HBZA 3LUKA 1BHO1 3QE2A 4YO7A 1U0RA 2HBYA 3LSYA 5K51A 4C78A 2ZIFA 4OJTA 3HG7A 4R8KA 5JXJA 2HWXA 3LDHA 3AR7A 1KETA 4K9KA 4KXVA 4S04A 2PUFA 1R5OA 1KYWA 3OZTA 4N48A 4E08A 4GHWA 2XMZA 4KRXA 4Q5IA 3K7EA 5E1DA 4D9BA 3JPYA 2WAAA 5DKFA 3QU9A 3NHWA 1PYDA 4HX5A 4KN8A 2ZUBA 1L5FA 4BC0A 2HV8A 1VJGA 4FNGA 3T9EA 4AO8A 3LBHA 3TUZC 5IC6A 2IPMA 4JVMA 3ODPA 4EMTA 3T8YA 4D8TA 1JJFA 3E9QA 4Q02A 3CKYA 3EPPA 3O3CA 3GCGA 4YAGA 2GCNA 4QECA 3ANSA 1KMMA 4OI0A 5CM8B 2VYVA 2C1EA 3DV9A 4D9EA 1QHHA 1MB2A 1AXEA 1KH1A 4K9NA 3B7PA 4KUHA 2VNHA 4YUZA 1JKJB 5P21A 4MW6A 1FQJA 1RAIA 2AFRA 6YASA 1SA0A 2NO1A 4LDRA 3VA7A 1GGJA 5GIPE 4TS3A 1HMPA 2DUNA 1OWOA 2H1VA 4QBGB 1SIWA 2PR2A 1DEKA 2GM3A 4R9SA 1H0RA 1YR3A 4KJZA 5IEBA 3O0DA 1Q6ZA 5CH5A 5GM1A 3DVQX 1GQOA 2PS9A 4I55B 3NTUA 3UFBA 1C30A 3OEYA 2PMCA 5KCZA 2ZBFA 2OXIA 1UBRS 2XVZA 1Z8DA 2DLDA 3E8SA 3HCWA 2OR3A 1Q7BA 3U81A 1GPJA 3NYWA 3ESCA 4MB6A 5DBOA 1EMDA 2VZEA 3UB2A 3PI7A 3BXZA 4PYRA 4QWMA 3UTCA 1MG0A 2JGIA 3P26A 4YI3A 1OV4A 3Q7EA 4PRKA 4YJ2B 1DEOA 2B2NA 1JQJC 1KP9A 5L51A 4ZVSA 2QNBA 2PX2A 4YT2A 1CJTC 1LPMA 3E3OA 4JIGA 5FI3A 2FQWA 2XWSA 4X00A 2DFNA 1BVHA 1K89A 3R5TA 4MIOA 3THYB 1RBZA 1SHJA 5CTJA 4L9AA 1O5OA 4R1UA 3QKWA 4BOYA 5DTMA 3PXAA 1WW8A 1KI9A 1ZC3A 4MVJH 4YPFA 4MQLA 2IS6A 3N2KB 1V11B 3ZBQA 2BF4A 5SZHB 3UH1A 2C82A 2WF7A 1PTJA 5AJUA 1CIJA 3OQ6A 3RGWS 3B60A 2P5YA 2VK2A 4PANA 1ULAA 4IVRA 4ZJPA 3IA2A 2P91A 3B9QA 3A9SA 3ONEA 4D0RA 3GNLA 3PL1A 3QVTA 4EYGA 2BBOA 2QTCA 1SMKA 2KLHA 3CUUA 3M34A 2IIVA 3AEXA 3O7MA 1X70A 4HQFA 3T5CA 1O58A 3D3JA 3R9KA 5KNCA 2QR5A 5ANRB 1F2TA 4M8IA 3OZFA 4ZCQA 2ST1A 3DCYA 2Q4DA 3UYLA 5C53B 2ZWOA 2Z5FA 1CR0A 5T4EA 3TGLA 3K1JA 2YZGA 2D5CA 4ZVOA 5L8VA 1CDEA 2BHNA 2W8ZA 3T3DA 3V80A 5CB8A 4KGZA 2JD0A 4WY5A 2ZZMA 4EDHA 4YUWA 2K2WA 3IBCA 4NR0A 5IM4A 2WZBA 5CCDA 2FPKA 1U7HA 4QM7A 3NHMA 2O8VA 2C59A 1QOPB 1CFZA 1I3OA 1KQNA 4BP9A 4ZZ0A 1K9VF 4A1FA 2PRZA 3VOTA 1Q0LA 1JIJA 3SK0A 5M34A 1FVOA 3LT1A 1WMDA 3QP9A 2BYTA 3RREA 3I9KA 4Q4AB 3U13A 4DSNA 1SHTX 3AVVA 2O2EA 3VFDA 2QE6A 3LCMA 4R54A 5D3MA 1U1FA 4M4SA 2YIDA 3NHYA 2XV1A 5KQSA 3T1HB 3A9CA 1YJAA 3Q11A 5K3OA 1E3IA 4KLRA 3WLLA 3LGSA 1IVSA 4OXXA 1KZGB 2VSFA 2EKQA 4EG8A 1B4DA 5F2NA 4X65B 5F21A 1XF1A 3LRTA 5DX0A 2ERXA 3V48A 1IUNA 2DY0A 4RPHA 1R88A 1UMDB 3MF4A 1D8TA 3MPUA 5ENZA 1EFCA 1C3LA 4LC1A 2E0IA 3IV6A 4M99A 3RRBA 3NH9A 4F6RA 1Z5VA 1IRXA 3AM5A 3AHFA 1TFRA 1AZLA 2Z3WA 4DLBA 3MVEA 5LBIA 3UV7A 3E18A 4G07A 3ADBA 3HEAA 3UN1A 2R7NA 1IAVA 4HMOA 5DM4A 1GPNA 5A6VA 5JATA 1LGYA 4PYKA 5LMZA 4NYIR 3UO8B 1PW5A 5E2IA 5IJ9B 4UHJA 1T5HX 1KWGA 1KNXA 1NY6A 3WLNA 2FLKA 3RM3A 4C6SA 5JCZA 3A32A 3JRNA 3L0PA 3X2EA 1MF7A 1S8AA 1CXZA 3OP1A 2FSVA 2LCIA 3G7NA 4K46A 1EUCA 5I7AA 5TR9A 3DL0A 4GXTA 4IJQA 4M37A 5BOVA 3R7DA 2W6MA 5EYPA 3WNVA 4EVRA 3K1ZA 1YR8A 3D43A 1SXHA 2W00A 4PC2A 2FMFA 3MS7A 4O2AA 5CNJA 4TS9A 2F3SA 2Q3CA 1WNFA 4JKIA 5G0TA 5CA0A 3WFIA 4DSAA 1DGQA 4PO9A 4JLDA 5KJEA 3RS0A 1U2TA 2HSJA 4MQEB 2VO1A 4A8JA 5FLYA 2RH8A 2G6BA 4DVJA 1VSVA 1ZIPA 4RIFA 4MYTA 1I4WA 2J0UA 1DZIA 2G5CA 3KUCA 5IDWA 5A0FA 3PP8A 3B6ZA 4BVGA 1CRWG 5BWOA 3COPA 4F06A 4DIEA 3HA3A 1MH9A 2V74B 1ACJA 3STHA 1JFTA 1L7DA 2PV0A 4HB4A 4DV2B 4I2VA 1NT4A 5B12A 1E60A 3ABZA 4I5FA 4AJPA 4E09A 1HNZB 5FR2A 4X7BA 5DYIA 1GU7A 3P9IA 1M9NA 3R74A 4B4VA 3LFUA 4F5ZA 3DTVD 3TZEA 1A5BB 1Z4LA 3AHGA 4NJEB 3IJRA 1OXSC 3QV2A 1KMQA 2F67A 4GLOA 2VPWA 1M5TA 3P9CA 4XI9A 1VXRA 1QX4A 4DLRA 3HY6A 5BUZA 5L3VA 1TAUA 3JD1A 1IMJA 2IDMA 4L50A 2R5WA 4Y7DA 2BEWB 2QR2A 1EVZA 1UZUA 2C7QA 3QSGA 3ADDA 4TKMA 2Y4OA 3FOBA 4K88A 1EGQA 2IV2X 1KQFA 3THWB 3W3ZB 4KQ1A 1P3Y1 3BRQA 2HPAA 4G1VA 1FL9A 1FBNA 5HMMA 3BERA 4UW9A 2I1WA 1RYEA 3HU2A 3T7SA 1Z2AA 1SEPA 1PWEA 1IN5A 1T24A 4RHTA 3JQGB 3VNBA 1GGMA 3K4PA 1DBIA 1S3FA 4MI9A 5EUMA 5DXJA 5EIEA 1LLUA 3UIEA 1T2UA 2C2MA 2PGOA 5D6OA 3ZJTA 4Q4JB 3IUEA 3X43A 1V1JA 2VRCD 4I19A 2ZJFA 2I6XA 4O2LA 3LXUX 1QH0A 4U7PB 2CUZA 1QOQB 4MHSA 4YCDA 1JQ5A 4KAFA 4UM8B 1L4KA 2GWHA 2I7VA 1YZTA 2Z8XA 5JUWA 5A4JA 3ME5A 1MABA 1Q77A 1ZNZA 2ZI6A 4G86A 3N8HA 5KTOA 4ZJYA 1ZGCA 2BKLA 5AJZA 1EFVA 1NULA 2GEFA 2JIPA 1PJ2A 2RHOA 7MDHA 3WGNA 3W2FA 1NJSA 3WGKA 3RIHA 4ZEVA 3K9HA 1C0IA 4PLPA 5JDIC 3TLGA 4HNAB 4F5YA 1KVQA 4JEIA 3DL2A 5KSWB 1NG1A 1RADA 2ZWVA 5TQ0A 1V9CA 3UG7A 3HHEA 2Z09A 4JI5B 3Q3EA 1K7CA 1DXOA 1D4AA 4KXMA 5EE3A 5J5AA 3WYNA 2VTBB 1W1UA 4BJHB 4IDNA 1WCIB 2L2QA 3PQDA 1NQOA 1WL8A 1LDYA 4NY1A 3GEBA 1L7BA 3H1FA 1MO4A 2XE4A 3IEXA 1TL7C 2V6IA 1SPXA 5ERXA 1NUAA 3H3XA 1B14A 2PT5A 4L07A 2VK1A 1DJOA 5IXYA 1KP2A 2X19A 3HNPA 4Z9YA 1ECLA 3A4TA 3V1KA 4KL8S 4PPNA 1W2WB 5KNCH 2AG6A 4IDCA 2GLXA 1XZIA 3LWDA 4G24A 4MVJP 3H65A 5EPUA 4XB2A 3TRKA 5EIXA 3EIQA 4QUAA 4TT3A 5SYAA 1ENPA 1P75A 4FFMA 4MTLA 2BKVA 4D9NA 2ZSHA 5H5JA 3PFNA 1EVYA 5F73A 2MCFA 1K08A 3U62A 3V8BA 2OHJA 3UT5B 3I52A 4HF7A 1LX7A 3JQ7A 3B9PA 1U8CB 2AQIA 3G88A 3GEMA 3Q15C 3H2JA 4H0CA 1TJYA 4KXQA 1I2CA 2DY1A 2WWHA 5ELLA 3HCOA 1M83A 2C0PA 2EQAA 4QFBA 1E3WB 3I6IA 1CIVA 1ZHOA 2Q9AA 1GZSA 1DAIA 5F5LA 4S35A 4LTDA 4WKBA 4B8ZA 4CM8B 4F85A 2VDMB 3DD5A 1B0UA 2GF0A 4PFSA 5CCXA 1DJQA 5LA6A 3ZVMA 1R8XA 1HYQA 2JJ8A 1X39A 3IKLA 4YAEA 1OX4B 4D41A 3BGIA 3ZU4A 3N76A 4XUEA 4TLAA 2F6RA 5JSKA 4R2KA 1AKEA 1P61B 2QM3A 4QOGA 4UREA 16PKA 2PYDA 3A6FA 3A2NA 3MSCA 3QF7A 4UUOA 2BIFA 5BNZA 4F45A 1KDPA 1YU9A 3AL0C 4ZOLB 1K8XB 1E2GA 3IXQA 3KOYA 4FGWA 4KOAA 4Y7CA 1YJXA 5KHOC 1R0CA 1U2DC 2IH2A 1MVNA 1WD5A 2FFHA 2O06A 1EFHA 3BEDA 3CR3C 1VCIA 3D9QX 1KFBB 2IPLA 4IRXA 4N3BA 3RIYA 4HDNA 2UVPA 5TPWA 3KU1A 4J0EA 3T15A 2IUEA 2VSYA 1UM9A 4YY3B 3THSA 5IAAA 3GLFE 5DH9A 2LUOA 4BN0A 3OO0A 4MV6A 1IM8A 1J2JA 4MS1B 3CONA 2XGJA 1M7BA 2OOSA 4NCAA 1PJRA 3AW8A 1E1KA 2H4HA 3K9WA 1Z18A 4KPFC 1LC3A 2BDEA 5LYYA 2IHYA 5MGNA 4YP1A 2I4NA 1KFCB 3Q9LA 3KV3O 3X1WA 4B43A 2R7AA 3IP6A 4BFCA 3CR7A 5IKPA 4V03A 1G6OA 1TTQB 2OZLA 2EATA 2ZS7A 2JBWA 4WXEA 4WRRA 3RANA 3OAAA 4C0XA 1NNI1 3W2IA 2FWNA 2QMQA 3OHSX 1RP7A 4NABA 3C70A 2P7IA 1WV0A 4HDQB 4P5PA 3TFWA 3F9CA 1IY9A 3LLMA 3MPOA 4ESOA 4WFQA 2ZAYA 5JSZB 1JTFA 3DDZX 2XPCA 4Q7EA 4UBJA 5JWOA 3EUWA 2FOXA 1J24A 4HFNA 1LLCA 2OCYC 3K1TA 2FWMX 3ZXSA 5AKGA 2WTUA 5MDHA 2Z6VA 1I7LA 3FI0A 5AVTA 2OCBA 3PT5A 4MCIA 3ADOA 4HWOA 2VEDA 3K8OE 3I76A 3ZIAD 4B3MB 2GZHA 2HEIA 3RARA 5HM6A 1NVKA 3GRYA 3DBLA 3EPRA 1ICEA 5LA6F 1NNEA 3O2NA 4AS1A 1V35A 1L4EA 4MYCA 2VJQA 4OHCA 3STYA 3AP2A 1H9CA 3MW8A 1NP6A 3AR4A 3VAYA 2OESA 3AU9A 2XNDA 3U1VA 1TEXA 2C94A 3VRHA 4FEEA 1LNZA 5BXYA 1JHYA 2Q8PA 4P3KA 4AZVA 2SKEA 2J0SA 4Q9LA 3HBAA 1R66A 4IIBA 1L3IA 3GH1A 3RYIB 2BVNA 4V2UA 2WWVD 4DBZA 5IKMA 5AT1A 4OI1A 1XRPA 3EDRA 4ON9A 3C7AA 4OL9A 4YREA 3FNHA 2OCAA 2UVQA 3LK6A 4IBOA 4UTOA 1W36C 1N5MA 3WJ7A 3WB0A 1PJCA 3QPAA 4UVEA 1X1BA 3IHWA 3PNVA 3GJTA 3JQFA 3LUHA 3PQ3A 4EECA 4Q1DA 4YQZA 2IHNA 2A94A 2PKYX 4Q9HA 3AKYA 2NVWA 3T95A 1GRVA 3FCYA 3GFGA 5FXMA 3TLJA 2A9OA 2DT5A 1BX0A 1NVVR 5LDGA 4I9GA 5IPFA 3I5XA 3F71A 5A03A 4R2MA 1G0OA 1TM5E 2RB5A 2ODQA 3GWZA 4RHCA 1V2HE 3W79A 3U4AA 2VNIA 5C8DA 2RGYA 4QLAA 5JVDF 1XAHA 3ZVLA 3ASUA 2F8LA 3CH7A 4PLTA 4JX8A 5FPKA 2N75A 5FOVA 3E0XA 3JAKA 1ZP6A 5KNCD 3BTUA 3PQ5A 2YXLA 3PD1A 4KQJA 1IBKB 2QD4A 4CKWB 4O4HB 1WHTA 3PFKA 2QM0A 4ZYVA 1O6BA 2BLNA 2J8ZA 3BJMA 4I5EA 4RTPA 1QIIA 1NQTA 1Z5WA 221PA 2YWHA 1GN8A 1K4KA 2H4JA 3PA6A 4C30A 3J81k 1M0SA 3V46A 5EJ9A 2JFPA 2XQJA 1MAUA 2IU6A 2PWZA 3NU1A 5KOHA 2JFVA 1B73A 2VP3A 1UK6A 4TMYA 4P4GA 4YALA 2MSWA 2O59A 4O4IA 1NMSA 4UUPA 2ID7A 1JR3E 3SHQA 2VJNA 1U3FA 4UXIA 5KEIA 3H5NA 5IXJA 3G8YA 3BB1A 1RXSA 3U4IA 3RFUA 1KIFA 2V4ZA 2RAPA 1Z0AA 4QO8A 5IW8A 3WMFA 1UBLS 2P7HA 2I2BA 4P2BA 4AAYA 4B6PA 2IEBA 3PGMA 1VL0A 1GZUA 4Q7KA 4F56A 4PNEA 3RC8A 1M1YB 4L1KA 1CEQA 1KYQA 2GQ0A 2J0VA 4LOLA 5HS4A 3HKBA 2GVDC 1EK0A 2OP1A 1O0CA 3H7AA 1Z62A 3TI9A 1T4CB 3HCBA 4L16A 4YRQA 4URZR 1ULZA 4YWJA 1BROA 2VAXA 1R3UA 1NMXA 4KK3A 4UHHA 4AKIA 3EQ2A 4FS3A 4N8EA 4U7HA 4WLNA 4ARZA 4DR3B 1PCXA 5LP1A 1Q92A 1HQYE 1K3FA 3UFXB 3W2TA 5JBQA 3GUVA 3LTEA 3FMIA 2JLXA 1GTJ1 7ABPA 2TRSB 5HF6A 1GFZA 1PQWA 3QMMA 3WTBA 3OM9A 1YK0A 1TU4A 3CVUA 2VPZA 2QTNA 1ZK4A 3MTQA 4J0GA 3TINA 2E4AA 4LJ4A 2FHSA 1NNUA 3E3AA 4P98A 2W22A 3BSYA 1E2UA 1Y4ZA 2OZKA 5EG5A 4B35A 5CBKA 1UEXC 2HA0A 5U4XA 4DCSA 2IXTA 2Z8YM 1A0OA 1BQ4A 1I30A 3EUFA 4A2CA 1G8PA 2J9GA 5EJ7A 1O89A 2OQ2A 5FWDA 3RHFA 2QTRA 3CV3A 4ZICA 2LP4Y 5KAPA 3PLRA 4MI3A 2OHOA 1GQYA 1UWVA 4AP5A 3OWOA 3SKVA 4G81A 2H92A 2J6IA 3UWMA 1WHTB 4GI5A 3MRTA 3M6UA 2XUPA 4N49A 1SC4A 3F7NA 3SNHA 2DXIA 1KTIA 3JVIA 3R9WA 1ND6A 3GJ3A 2H0RA 3PRJA 4KP7A 1SBQA 4RETA 4JZYA 3TAXA 1D5WA 3UB3A 3W06A 4DJFC 4MW4A 2R25B 1C5KA 5BRAA 2W6QA 4P4SB 2DPXA 5IRCD 3JS5A 3CMMA 1PRYA 2EKDA 4JH0A 5KNDA 2PM8A 3UK2A 3ZCTA 2Q7XA 2UZ1A 1SVIA 4AN4A 4DZZA 1J8VA 3PQ2A 3EGDB 1O4WA 2HU2A 3RYTC 1PR6A 3HSSA 2W71A 1AGYA 1TA4A 3OJFA 1L3BA 3PVZA 3TOCA 2VYFA 3SWWA 4PQYA 4DV7B 5JALA 3OEWA 1AF7A 2G9NA 1XEFA 4TXJA 1A04A 1E98A 3H4IA 3LCUA 1D7OA 4RVSA 1D6JA 3NOVA 1WMSA 4Q3AA 3ZU2A 3EXEB 2JAXA 3UT5A 5JH7F 5DCLA 4H2DA 5DTRA 3LYAA 3IQFA 3L7DA 1MQ9A 3N0TA 1FXWA 2PL1A 4HQOA 2NP7A 2IYXA 3KOZA 4XD2A 2DTXA 4CF3A 1IN8A 1I0ZA 5KQLA 3DDSA 1H6DA 3A4MA 4Q12A 4EIWA 1WSBA 1O9BA 3CNLA 3QI2A 1M8GA 3GYGA 4XCQA 1RAHA 2B1IA 2UUOA 3ESZA 2Z04A 1C41A 3WSTA 1RZRD 2D1TA 4YFVA 3D64A 4J76A 3M7IA 4BVBA 4RLSA 3FFTA 1CYEA 2EJVA 3QI7A 5F5NA 5CAEB 3VBCA 3BEOA 1X7GA 1X7WA 4GEKA 4KW7A 1OZAA 4EGSA 5JANA 5KYWB 1RS0A 1M8JA 4YR7A 4JXZA 4AY3A 1HDXA 1ZW6A 4KAAA 1Z6QA 2AW5A 2ZYIA 4AYTA 1PG2A 1TIKA 4LGVA 4B81A 3MQFA 3ZY5A 1ISRA 1BZYA 2ZSIA 1SXJA 4ZMRA 4M2LA 3UMFA 3Q2OA 3WWDA 1IE3A 5B64A 1OPXA 4ZTBA 3JQGA 1MABB 4PLVA 3LLVA 3D7LA 3DOCA 3HFJA 3BRCA 2H8GA 1D07A 2CXRA 4ZMSA 2VBGA 4OI2A 4GBJA 4XH9B 3PUKA 4N3GA 3ZCVA 1YR2A 3IKTA 4F2PA 3ROTA 1FPMA 1FNMA 1X7YA 2LR0A 4N0MA 3BCSA 3ITDA 4KXNA 5J1SB 3WYEA 1FDTA 1LBSA 3WS7A 4GI1A 2GBLA 1PD0A 2P27A 3L40A 3LK7A 3UUWA 3ZK7A 1J6UA 2L0XA 3TK1A 2AS0A 1C7IA 3CNQS 3QHAA 4KKVA 2AUMA 1WB6A 2FR1A 3RIXA 4YN3A 4DJAA 1MX5A 5AW4A 3LYUA 4BQEA 3VNSA 2V6JA 4HWPA 2I8LA 3L4SO 4TKVA 4I1OA 3KQUA 4E4RA 3ZHSA 3C15C 3LVRE 1JNXX 4BCBA 5KYYA 2Q41A 2H00A 2QE7D 3QX3A 3O84A 1GQSA 3TOXA 3AEYA 1S89A 2Y93A 1IBRA 4R8MA 4I50B 1JHOA 4NCKA 1E3EA 1KC3A 2J67A 3RBZA 1BE6A 3TQCA 2QYHA 3I83A 1ELOA 1NM5A 1X1CA 2VDKB 4Q3LA 2WC1A 2VTDA 4RJ2A 1W6RA 4UBKA 2XECA 5CA0B 2G9ZA 4K2HA 1N6HA 4M46A 1PV2A 4MARA 4HRAA 4BMPB 2R1UA 1W87A 1OIVA 3BGOS 3DXZA 2A0XA 4YRZA 2HMTA 3ZKAA 2F64A 1E1YA 2Z9DA 1A1SA 1JB9A 3COJA 3ZHBA 2UXBB 1HR0B 1JALA 3NV9A 3MTBA 1DADA 2V7BA 1ONNA 1H05A 2ENUA 3EGWA 3OZWA 1DKQA 5JFGA 1X8KA 1A2OA 4BVHA 4UDOA 1AN9A 3CEHA 4Q01A 5B2ZA 1QYCA 2YOGA 1FRZA 4BTEA 4TZTA 4B7XA 2WIJA 4RD2A 4B6FA 2PQ2A 4UBIA 1M1YE 3QELA 1HDGO 3KKOA 5F7XA 1TMGE 1EM6A 1WKCA 3DZKA 3QNMA 4DEVA 3AHDA 3I30X 4ZALA 2X77A 1LPAB 1Z5OA 3VO9A 4CIYA 1XR3A 3JQFC 4HATA 2HPZA 1U7TA 1UMDA 2CLIB 2OO7A 5I8WA 4DIBA 2R96A 1N2EA 4CLRA 3OQIA 5ALSA 3RVLA 3SSNA 1MO2A 4G0UA 1G20B 4J3FA 2ZBEA 1UOQA 4MS4B 4J0CA 5HIKA 5JZ9A 2ZJ0A 1HT2E 4ZVUA 4YS6A 4AYWA 4BXOB 3Q5DA 1RPNA 3WQSB 2GK4A 2SHKA 3TLEA 4BS9A 2Y92A 1B7GO 3F4KA 4MDFA 1FLNA 4L73A 1GZVA 4KMOA 2BP7B 5EZYA 2VF2A 4I14A 1G63A 2A9FA 1OI4A 3CRRA 3HWX1 4C14A 1RJ9B 1DINA 2VDWA 1TAQA 4UQOA 4FC7A 2XY4A 3QA9A 4C06A 4PRLA 2XCLA 1NKTA 3PYXA 5HCUA 5F9FA 3BG5A 3T0IA 1TF2A 1VSUA 4DUGA 4YRPA 2VDJA 2CDCA 3B1JA 2GFHA 2JAHA 1R9JA 2ZKLA 4C4SA 2W4IA 1L5RA 1XQ6A 1A69A 1Z4NA 1T8SA 3IS3A 3B8EA 2REBA 1T35A 1TUEA 4DUZB 5I5GA 2ZSEA 3E7WA 2FG5A 3PUVA 1CB7A 2RI1A 3BRSA 4ZO7A 1NVVQ 1ZJ5A 5HOQA 2DPHA 1PL0A 1L2TA 3WK6A 1ZJWA 4D8WA 2AKAB 3DLBA 2PY6A 4PLWA 1NPDA 5SYMA 1Z8FA 3VH1A 3ZEIA 5EXTA 1HTTA 2OECA 5JDCA 3RSGA 5AVRA 3RTAA 4BFXA 5AH0A 3TOVA 2YH2A 4MLDA 5BSHA 4LZOA 3GW8A 3KEFA 3I4LA 3CVVA 4AJLA 4AZ3B 3AK4A 4JI1B 4YMUA 1NI5A 1ISIA 1MB3A 2PKEA 2G1JA 3DEJA 4DG9A 3B5JA 4EP1A 5K6AC 3T5DA 1II8A 4NJEA 4ZCPA 5L7TA 2O8CB 1E18A 5EMMA 3U0BA 5JWHA 3CIOA 4PZAA 1U4NA 4KPEC 2FSIA 1YHYA 4I4NA 5BN3B 1G21A 1Q21A 1QTRA 4ALMA 3ZGOA 4CQLA 4U9HS 1NW9B 1RPJA 3KXPA 2O2IA 1QO0D 5JSHA 1F8XA 1V39A 1YVEI 2ATIA 1R6TA 2QSJA 4EGFA 5BMVB 1EIZA 1X9GA 4UU7A 1ZBDA 4H7PA 4LWPA 1PYGA 2KPOA 4OP2A 4B82A 4GSLA 1WV1A 2O2GA 3T34A 4LIPD 4WN3A 3JQAA 4BJ6A 5CH3A 1N9ZA 5I47A 1MHPA 1F5SA 5F1KA 5JE8A 1HE3A 2B21A 3ESDA 1SUFA 3F9RA 3HKCB 4DCOA 4E13A 3LMKA 3TSAA 4WBSA 3H42B 1KEPA 3NC0C 5CNKA 4D56A 2ZK7A 3L8CA 3CLRC 4H7EA 3OX3A 4MITA 2BUAA 5F23A 5LQAA 2D13A 2Q3HA 3K0BA 2BFDA 1LNSA 3BMCA 3I2KA 3CJRA 4AJ2A 2MWMA 3H1AA 3P71T 1XELA 3KJNA 4ZYYA 5GJVC 2DG2A 1Z2PX 2ACWA 2DBZA 2ZSUA 1ZDMA 3BDIA 3C3KA 1QCCA 5NLLA 4Q9AA 4YRAA 3C74A 4C0HA 2AI1A 2JDIA 4GRIA 3OFJA 4LRUA 8ADHA 4I1SA 5HRAA 1ZL2A 2AK3A 2EFYA 2I55A 3U4QB 1A9XA 5ITWA 2VF7A 4ITVA 1UPBA 5F76A 4PLHA 5LIRA 4FR0A 3DYBA 1DG1G 4D4KA 1CUUA 1JEDA 2KX7A 1MC5A 4UOEA 4QARA 3TN7A 3PE3A 2HCRA 1U9CA 4QU9A 3JD0A 2Q4RA 2Z8ZA 4XJSA 2HD4A 5FOSA 4CU2A 4NJOA 2PX3A 4LVUA 4FWIB 5CA1F 4G0MA 3PNBA 3VXKA 1O4VA 3DHEA 4JLBA 4OIFA 4R0VA 4WECA 2FXVA 1C8BA 3ETLA 5KYUA 1YMUA 1SVLA 1NUPA 3D5QA 3OCYA 1GRCA 2P2CA 2P2