4CMBA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmbA00
3W6ZA 5GZ1A 4GKVA 3WSWA 5KJ6A 3ULKA 1QP8A 4Z6KA 5G0SA 4FS3A 1E0DA 1M75A 4RQTA 4IIVA 5B4TA 1P3DA 3QV1A 4D45A 1D1SA 5IAAA 2W2LD 3WGHA 5G0UA 3SJ7A 5DBIA 1U3WA 5LCXA 2XXBA 3HG7A 2G5CA 3QW2A 3GQVA 3RUEA 5ITWA 3PPIA 5KIAA 3JD3A 4GMGA 1GUYA 5EL0A 1UDBA 1O5IA 3HE3A 4FFOA 1ONNA 4YPOA 4JX8A 4XQ9A 2UV8A 5A05A 3RKUA 3I6IA 3PIIA 3WGIA 2ILTA 2JL1A 2R6JA 1QLHA 1X14A 4DLAA 4R1UA 1ENYA 4Q9NA 5L40A 3PEFA 2WD7B 2YHIB 3ZHZA 3FR7A 1B8VA 3H65A 1OI7A 4MP8A 5T8KA 2J5RA 3TQHA 5A02A 1Y9EA 5T5QA 1EMDA 5BSHA 3G1UA 4NBRA 5A3JA 1ZIDA 1PS8A 3PHLA 3C24A 4R5HA 4CV0A 3AW9A 2DUUA 5DBFA 4NBTA 4CM7A 3BTUA 1ZNQO 4CM8A 4E2ZA 5A3VA 1NVGA 4A26A 4BKOA 2CFCA 5L3ZA 3DHNA 4RPGA 1U4OA 4RJTA 3M2PA 2HSDA 2Q49A 1HSOA 3RUFA 1DFGA 1JU9A 4MVJA 5I7VA 1I01A 2AE1A 5JNLA 1WDMA 3EAGA 1DIRA 3WGTA 1OC4A 3QY9A 5JXWA 3RC9A 5IZCA 1BMDA 4BKQA 3FF4A 3OBBA 1UDAA 5KCZA 2BGLA 3F5SA 2NQ8A 3RWBA 5EPOA 3MJVA 2GRAA 2GPTA 4N18A 4J9VA 4XCVA 5FI5A 1M66A 2VRCD 3K30A 4BNMA 3C1TA 1NQAO 2PKQO 3GDFA 4PG8A 4BNFA 1KS9A 2FZEA 2EP5A 4UREA 3TN7A 4E5KA 4HNHA 2PV7A 3D0OA 5F5LA 3WBFA 4UVHA 2AEFA 3HDQA 3UCEA 3TDKA 1DO8A 4R1NA 5THQA 4XQCA 1JKFA 1YOVA 1O0SA 3KTDA 1R0SA 4RVUA 4IDFA 3LC1O 5ILGA 1E1MA 3U9LA 4HFRA 4BO3A 2VQ3A 5U4QA 3I9JA 2JAPA 1QYXA 3NTQA 3N7UA 4Q3AA 2CNBA 2FY8A 4J2HA 1PJTA 4ND1A 4TKMA 1MUUA 5CAEA 4MINA 2E6UX 4U8GA 3RUHA 4J4HA 3MOIA 3ZV3A 2P9CA 5BT9A 1GUFA 2Y67A 1PWZA 5I9LA 4E5PA 2C54A 3CINA 3SC4A 1R66A 3OJEA 5JDCA 1R12A 3RBVA 1YXMA 4XGIA 2D4AA 4ND5A 1DAPA 1PU2A 4INAA 4AJKA 3WMXA 1ISMA 1BVUA 1H6DA 2EKLA 4O6VA 1B3BA 2CDCA 1N7GA 4P4NA 3BHJA 2HMUA 2Y1EA 1HKUA 4JIGA 4L8VA 3QVTA 4JROA 3DL2A 3ZWXA 1UXKA 4BNXA 1R6DA 4YCAA 1KVSA 4OQYA 1RJWA 3GOHA 4XB1A 3FHLA 3Q6IA 4I5DA 2QZ9A 1E6EA 2X6TA 3HNPA 2G0TA 1EVJA 2HK9A 3K31A 1F12A 2FZWA 3NT5A 3PQEA 1C14A 4RF5A 4P8RA 4BHTA 1VL0A 4Q3DA 4OMUA 3ANMA 4CMIA 5A06A 5COQA 4FFNA 5BSFA 1NHWA 1ZO8A 2ZATA 3PFFA 4GI2A 5TC4A 2X5OA 1LDEA 4WKGA 3DZIA 2G76A 3TWOA 1SOWA 4NJOA 4U0KA 4JP2A 3SEFA 3F4BA 2ZYDA 2RHCA 2C7VA 1NWCA 4YXFA 1V3UA 3MJCA 3F1LA 2OOSA 2CF6A 5L53A 2FN7A 1DIGA 3JQGB 1QYDA 3OQBA 1LLCA 2AHRA 2I5PO 4MO2A 4FB5A 2RCYA 4BVAA 3AU9A 3B1JA 3KXDA 1X0XA 5JS6A 1AGNA 2Y1GA 1DLJA 1GEGA 3KHUA 2PZMA 4CQMD 3RIHA 4F3YA 2PFGA 3O26A 2DFVA 3WYCA 4YJFA 1WW8A 2PLAA 1XWFA 3AOEC 2X0RA 1HDCA 3EVNA 2XAAA 4RQUA 3EUWA 1AUPA 3ZU3A 3ZNPA 1ONPA 4HP8A 5CPBA 4YJHA 4CMHA 2Q1WA 1NBOA 9LDBA 2BKAA 4M55A 1R4NB 3L4BC 3OA0A 2AEJA 4BNJA 5KKCA 2VUSA 1X1TA 4DWVA 5IDWA 4DREA 1KY5A 4PLPA 1T25A 2O2SA 1ZFNA 1UXJA 1P1FA 5EJ2A 1JAYA 2ZTUA 1OZAA 4EJ0A 2GN9A 2Y0DA 3I3OA 4BNUA 5L45A 4YAEA 4DMLA 5JAIA 4FDAA 4PZDA 4AJEA 2YV3A 1D8AA 4RF3A 1Y8QB 1FDUA 3JD4A 4RL6A 5TLSA 3DXFA 3H5NA 2VTDA 2X0NA 3UAGA 5AQ1A 2I65A 4Z0TA 3H2ZA 4PLWA 4QEDA 3W8FA 1EK6A 4GSKA 4E2YA 4BNWA 1A9ZA 4J1SA 4YJDA 2YYYA 4TVOA 2DPHA 2WE8A 3QVXA 4IS3A 1DIHA 5B1YA 4XA8A 2NVUA 4PRKA 2J6IA 1PZHA 3JQBC 1BGVA 1B15A 1A7KA 4CR8A 5I9MA 3CMCO 5KVCA 2BD0A 2X5JO 4CLOA 5F1KA 4PLGA 4BNKA 4FFPA 2B4QA 3AJRA 4Z0PA 3FPLA 4LRTB 1NYTA 4K9DA 3KSUA 4D3SA 1PL7A 5KVQA 3G79A 1ZSVA 1HYEA 1HWYA 1ENZA 4E33A 5G0WA 4ALKA 1YB1A 4KTTE 1B2LA 3ZWAA 6ADHA 5JW6A 3PDUA 5DNAA 1XDWA 3DHYA 4J90A 2VT2A 3UFXA 4UULA 4PVDA 1ULSA 5JMPA 1ZZEA 4GX2A 4E21A 5EINA 3DZKA 4H16A 4WLVA 1PJSA 1QORA 4AJ2A 2QYSA 4E0BA 4TMFA 4DLBA 1GPJA 3PWKA 3ZWMA 1ZCJA 1HDXA 1PJCA 3R3JA 3FBTA 5COAA 3INTA 4K6CA 5HA5A 4ZGWA 3NJ8A 1JVSA 4W4TA 2C59A 4YRBA 4L4XA 5G0VA 3ONDA 5ES3A 4A7PA 5AXCA 1DFHA 1VL8A 2D5AA 2J3JA 2G82A 3AM5A 1Q0LA 4FC6A 4CM9A 4GH5A 1YS4A 4LN1A 3GH3A 4EW6A 2VYND 4I5EA 1T2CA 1Q1NA 1IHYA 1H0KA 4NZ9A 4CV2A 5CEJA 4D3FA 1YDEA 2DKNA 2O3TA 1BWSA 4P4LA 4JJGA 1H2BA 2QX7A 4R1TA 2FPPA 3B1KA 3AY7A 3JV7A 3DMYA 5JYEA 2DQ4A 2Q99A 2C5AA 4IQ0A 3ANLA 3UHAA 3P2OA 1NPDA 2EJVA 4IXWA 4XDYA 4TROA 3GVCA 5IG2A 5IDQA 3D3WB 3DDNA 1PR3A 3IUSA 1LDMA 2PR2A 4ZQFA 4J7CA 4OSOA 2VYVA 1T4BA 1QRRA 1F14A 2PZLA 4GPD1 4E5MA 2NWQA 2FRDA 2GCGA 5AXBA 2VYNA 3DQPA 1JA9A 2A9FA 1M2WA 1Z75A 1P0FA 5BQFA 4Y98A 4CMIB 4YA6A 1GTMA 5HM8A 2HKIA 1NASA 3JSAA 2WWRA 2HJSA 4E4YA 4NU5A 2BELA 3W4IA 5JDIA 2X22A 3P7MA 3INGA 3AOEA 1PZFA 1HZZA 3FWZA 1D4FA 3HDYA 2C2YA 3TPCA 3FRJA 1SB8A 1CDOA 5B4UA 2VUTA 4QTZA 3DBLA 3I9KA 4U7WA 5K6AA 2I67A 2B35A 4GMFA 1B8PA 1LBEA 3I9NA 1WDLA 4GBJA 3A14A 3DMTA 1UP4A 3UCFA 3VTFA 1U7TA 4D3DA 3WJ7A 3M1AA 3I4FA 1HE5A 3E03A 1GQYA 2NACA 3JYQA 3EMKA 3LSYA 4XJSA 3G0OA 3TZKA 3BTSA 1AN9A 1Z7EA 4DPMA 2W90A 4YDRA 5CDUA 3ZGYA 4YT5A 3FR8A 3KSZO 3R0IA 4WGGA 1TI7A 3BMOB 5KJCA 1KETA 3MTJA 2VWPA 3FN4A 5G2OA 3WGYA 3BMQA 3C1AA 1ZMOA 1UZNA 2C0CA 1CRWG 4L4SA 4MVJG 1MX3A 2DC1A 3E5RA 3WOHA 1SAYA 4YTEA 5A04A 3GUYA 4F45A 2LDXA 4QFDA 4AICA 1N5DA 3F9IA 4RPKA 1U5AA 4AJJA 1EUZA 4CL3A 2VN8A 2YZ7A 1VKOA 2JCXA 2UAGA 3U4CA 1Q7BA 4J3FA 2DPGA 2ET6A 2PK3A 4NBVA 1A27A 4M86A 4BO1A 3LF2A 4Z9XA 1C1XA 2HMSA 1F8GA 1DSSG 3JD2A 3RUDA 4WOJA 4ROSA 4Q3CA 3H9EO 2JFGA 4PG5A 4K26A 3GGGA 2PNFA 3DO5A 2OBYA 4JJIA 4BO6A 3BZUA 3DBLB 2X0IA 4RVFA 3GA0A 1I5RA 3HZZA 4JBGA 4B7UA 2HJRA 1P1HA 2WYUA 3IJPA 4ZA2A 4J4BA 4IMRA 1MC5A 5JY1A 1K6IA 4WEQA 5B37A 2UDPA 4DIOA 1YO6A 1GADO 1O9BA 1OBFO 1Y7TA 1Y8RB 1X1EA 1XEAA 4B3JA 4LMPA 4IM7A 4EZBA 4W82A 2Z1NA 3DZFA 4KUEA 1PL6A 3AM3A 1GZ4A 2FSSA 2AQKA 2V6FA 4DVJA 3ZWOA 4JP3A 3ENNA 5BNIA 1L7EA 5H83A 2ZB7A 3IMFA 3SVTA 1U4SA 1P74A 4LVUA 2AW5A 2EWMA 2P68A 3VH3A 5MDHA 3PYLA 1E3LA 4WECA 3RUAA 1LDGA 5IDXA 5IN4A 3PJFA 3KV3O 1I32A 1UXIA 2WE7A 4GVXA 5JPIA 3ROPA 5F21A 3RFTA 3D7LA 3KYDA 1GQ2A 2JFFA 1NPTO 1DAOA 3X2EA 4IY1A 1X0VA 3FCOA 4R4JA 1P33A 2WD7A 4E2XA 2WD8A 1C0KA 4QO7A 3K2EA 4D7AA 1DHTA 1HETA 1LRKA 2FR1A 2PA3A 2VTEA 1EBFA 4FFMA 4IBOA 5L4NA 2OO5A 1C0LA 2DFDA 2EGGA 2YHUA 4CLHA 4RVDA 4UUPA 1VL6A 5C3MA 2HMVA 1MFPA 3OETA 1DFIA 2Q1UA 3RAJA 1QSGA 4XR4A 2B5VA 4ZQHA 3TOXA 1P9LA 3PK0A 1Y81A 3NUGA 1XCBA 1E92A 3RI3A 5DOVA 5JY6A 3AUAA 3ZWWA 3V2UA 4BO0A 3WNQA 4BGIA 1PJQA 1JQBA 4YACA 4GLOA 5JC8A 1GD1O 4K28A 4D46A 2FPGA 5JC1A 1UAGA 3PVZA 2F00A 5BNFA 4EJMA 5KNLA 5C7IO 3NJ4A 4J91A 1B8UA 1KERA 3WIDA 2POQX 3V2GA 4QO8A 1IZ0A 4R9RA 1EBUA 2GDZA 4NU6A 4YR9A 1RYDA 3MWDB 5DCUA 2HCTA 3OF2A 3PFWO 3ETEA 4CMGA 2J5QA 4ZQEA 2QZZA 3KO8A 1SO8A 3MZ0A 3GT0A 3RKRA 4BNGA 3RCBA 1ENPA 3PJDA 3JQAB 3ZWPA 4CQMA 5AYVA 4CM8B 3QWIA 2GO1A 3LVFO 1HF3A 4J0FA 1SCUA 4CMBA 1GUZA 1T2FA 3U4IA 4RV9A 2V6GA 2VZ9A 1JWAB 2ZTLA 4BV8A 1ZK3A 5MGBA 1PZEA 2FR8A 1CJCA 3D5TA 2GN6A 1E1LA 4R3NA 5F1PA 3OIDA 4AJHA 5BR7A 4OL9A 3QVSA 1E7YA 2PD4A 3KYCB 1IB6A 4J0EA 4LCEA 4BV9A 1K2WA 1PJ3A 3ZNOA 1T1RA 1R15A 3DBRB 1LQUA 2OUIA 5DULA 1E7QA 5A9SB 4DLLA 4FJ1A 3GAFA 3ST7A 3OHSX 3ENKA 3OA2A 2NNLD 1LU9A 1K3TA 1ULUA 1Y1PA 1QR6A 4YT4A 3SBOA 3TL3A 1LLQA 1DDOA 1NFRA 3PZBA 4FIZA 4RPJA 4KZPA 1PGNA 4GGOA 2AXQA 4KP7A 4UUNA 3HFGA 2UUOA 3ZW8A 3MWEB 1XKQA 4B3IA 5DOZA 4YT8A 4WLUA 3MOGA 4OXYA 1EVYA 3DONA 2C2XA 3KEOA 3QWHA 1P1KA 3VVCA 4J9UE 4JBHA 5AXAA 4BO5A 1HSZA 1JTVA 7MDHA 2ZTVA 2AQIA 3ASUA 3P2YA 3TF5A 4U5QA 4DQVA 4UVGA 1UZMA 1VSVA 4GVLA 3WQRA 2J3IA 4BNZA 3SX2A 3FNEA 2GLXA 3Q9NA 2WDZA 2CMDA 2O3SA 1XLTA 2OZPA 5CEFA 1WDKA 3ROQA 4DMMA 1E3WA 1PR9A 4HADA 4BQPA 2X8LA 1HXHA 3JQ8B 1F0YA 4FR5A 4WOKA 5A5EA 5JCJD 3VOSA 3VH2A 2WMDA 3DOJA 3S8MA 3O9ZA 3RUIA 3SLKA 4OXKA 1ADGA 2BRUA 5DP2A 5EQFA 3OJ0A 3MTGA 2EW2A 2JD0A 2HMTA 4ALJA 3DZBA 4WASA 3IP3A 3CXRA 1PWXA 4I8XA 2HU2A 2QW8A 2AG8A 3SXPA 4BNVA 1V6AA 4YJFB 1IOLA 4FQ8A 2WJPA 4RPHA 3GMSA 3DFZA 2FOIA 2ZTMA 4I5FA 3ROKA 2P91A 2Q45A 4YAIA 3JQ7A 1JVBA 3CZMA 5T6BA 3ZU4A 1O94A 5AOVA 3ZWCA 1B14A 4S1VA 3COSA 4D44A 4W7HA 2D5CA 3PJGA 3QWBA 1DXYA 9LDTA 4LVCA 3GZ4A 3JQBA 3T4EA 2O48X 3OP4A 4BB5A 1VI2A 4YQYA 4OOEA 4L9RA 3WDSA 1E6UA 1B26A 1I33A 5HWSA 3H8VA 1E3IA 4G81A 4NMHA 2PGJA 1HYHA 5T57A 2BI8A 2ZCUA 1VPDA 1KVTA 3GEDA 1RWBA 2X7HA 2ZYAA 4OSPA 5F5NA 3IAHA 5DDIP 3BTVA 3V1TC 3HADA 4TZKA 1H6AA 1LI4A 5HRUA 2IYPA 4C4OA 5JAMA 1I2CA 2O3RA 4Y8VA 2DBRA 1FDTA 3CIFA 4FBGA 1P1JA 4AG3A 2QQ5A 3BMCA 1FXSA 3IKTA 4UEOA 1ISGA 1KEWA 3DAPA 3GNQA 3RC2A 1E7WA 3KRTA 1PS0A 2FWMX 1ZMTA 4GQAA 2NUAA 1WPQA 1K0UA 5EN4A 3U3XA 1HDYA 4A03A 3GRKA 1HDOA 2Y68A 1S6YA 3WWZA 5I7SA 1GDHA 1RM5A 3KYBA 3C3XA 4FSHA 5CG2A 3F6YA 1M6WA 2NQTA 3L4BA 4MVJP 2F1KA 1H9AA 1A72A 3LT2A 3CKYA 5HBRA 4IMPA 1Q7GA 1YBAA 2E82A 1K6JA 1J49A 3E9QA 3WR5A 1PQWA 2GNAA 1AXGA 3GZNB 4MVJM 1I8TA 3PQFA 4PZCA 1L1FA 4D0RA 3A06A 4CM1A 2G1UA 5A1TA 1E3SA 4BUCA 4O59O 2IXBA 4G2NA 4IDDA 5G4KA 3ZHYA 3KSDO 5DN9A 3DFUA 4IJVA 2ZCVA 2VOJA 3UXYA 4JN6B 3FNFA 2ZIZA 1EE9A 1RM3A 4NK5A 4BKUA 5U9CA 1SNYA 3JYLA 1GZ3A 3DZHA 4N5MA 3GZNA 1ZK2A 1DC4A 2D59A 2ZB8A 4L0QA 3VPSA 3BMOA 1J4AA 4OIMA 2ZQZA 2O3QA 1GPDG 1QYWA 3UOGA 3T7CA 2RAFA 3VC7A 4RVGA 1HEUA 2NTJA 2VHVA 3QQPA 2Y0CA 5EIOA 1DHRA 4FOOA 1A4UA 2CVZA 3HDHA 4Y9DA 4DXHA 4TQGA 2BHLA 3ETGA 4QT0A 5TSDA 1P44A 2VNSA 2AMFA 4RDHA 3Q3CA 4PCVA 2DT5A 1H94A 1XHLA 4PLVA 3SLGA 4FFRA 1PL8A 4H7PA 1FMCA 4CQLB 4I9UA 3TZCA 4E6PA 3GDGA 3A1NA 3E9NA 4FJ0A 1EDZA 2PH5A 4KDFA 3TOZA 1J0XO 1LTHR 3VH1A 4AJNA 2GZ2A 2JKVA 1HTBA 3IKVA 1I36A 1FJHA 3BHIA 2UYYA 5ADHA 4CODB 3KM0A 1K6XA 2BF7A 3I52A 3KBOA 3TSCA 4BNNA 1HE3A 5TIIA 5K6AC 1S7CA 3RD5A 1HE4A 3CPSA 4CPDA 4CM4B 5K0ZA 1LDYA 1BW9A 3I83A 1YGYA 1CYDA 1BVRA 3WIEA 4CQLA 1AXEA 4CR6A 1R0LA 3NRCA 2IZ1A 2X1HA 2CF5A 3IIEA 2AE2A 1H9BA 4WE3A 1HDZA 3QA9A 4YVFA 1T26A 1LSUA 4GX0A 2OHXA 1LA2A 1GV1A 3AK4A 4EITA 5A4DA 4HY3A 3VZPA 1FDSA 1NVTA 1DIBA 2GN8A 3VKVA 3RJ5A 4P38A 5LC1A 4Q39A 2BFOA 2QRJA 4WLOA 2TMDA 2BFMA 3QJ5A 1V9LA 4PLZA 4YB8A 1HLPA 2UVDA 1ZXBA 4GWKA 2QRKA 1BDBA 2R2GA 1H6CA 3UH1A 3TFOA 4PG6A 3NT4A 4GAEA 1EUCA 1V3VA 4MDHA 1LXCA 5K9ZA 4U6QA 4JJFA 3K73O 1ZW1A 4Z3KA 3EZYA 3UVEA 2PH3A 4RVSA 1E1KA 3TRIA 2EEZA 1QV6A 3C8MA 3ORFA 2VT3A 4GKBA 3EW7A 5I8ZA 3WTCA 5J23A 2RHRA 1G1AA 3HN7A 3L9XA 3IL2A 4HX5A 4F6LA 4MKZA 2W2KA 4LRSB 2Y99A 4NJMB 1PX0A 1W73A 4YBZA 1AE1A 1O89A 3FBGA 2B4RO 1WZEA 3W4JA 1GV0A 3F3SA 3E9MA 3IC5A 2GUGA 1ID1A 4RF2A 4R51A 3ZU5A 5CEEA 1W0CA 3OJOA 1CQIA 2NVBA 4NFYA 1I2ZA 4KQXA 1P1IA 2ZJ1A 3OQ1A 1VKNA 1DRUA 1YRLA 2QYTA 4CLRA 5B12A 4L75A 5C37A 3JQ6A 4DQXA 4QECA 3OICA 3Q1LA 4GX5A 1F8FA 1GL3A 2CUKA 3KUXA 2VWGA 4IDAA 1Q0HA 1CQJA 2W98A 4IJKA 1K89A 1XELA 4FC7A 4NBWA 3SJUA 2FMUA 3LK7A 2VYVD 3GHHA 4JNKA 5I7FA 2ZYGA 2X9GA 3O8QA 5L95A 4YEDA 2B0JA 5DZSA 1YE3A 4XIJA 2H5LA 3C7CB 4MIYA 4DYDA 4XIYA 4L4RA 3FNGA 4PN3A 4OH1A 2OP1A 1PJBA 3N58A 4DA9A 1OOEA 2C82A 2E4AA 1N92A 3RASA 1E7MA 3DHEA 1ADFA 3NDJA 1YONA 1GZ6A 3U49A 3K2BA 4IDCA 4PVCA 1Y5MA 2C7GA 1PIWA 2XXJA 1PJ4A 2X0JA 2VWQA 4PLHA 3DAFA 2PY6A 3MCVA 2CD9A 2NTVA 3ZV6A 4J43A 2RIRA 1LEHA 2ZB3A 3IS3A 3VPXA 2Q4EA 4XRGA 8LDHA 5ICMA 1PS9A 4BQRA 2FR0A 4A27A 5EQDA 4KUGA 4D43A 5GZ3A 2YHIA 1C0IA 2EV9A 2NV6A 3ZDFA 3U5TA 3CEAA 2NM0A 5CHEA 3LDHA 3VZSA 3OIGA 2Q4BA 1I3LA 4ZHSA 4ALIA 1UP7A 3JQDA 2A92A 4DGSA 3EK2A 4IQGA 3PHHA 4B4WA 2EG9A 3TJRA 3PDJA 4NNJA 1QLJA 5I7EA 1A9YA 4HKTA 3VHRA 1LLUA 3IDSA 1ENOA 3WFJA 1PGPA 3X2FA 1SC6A 5DT9A 4BL5A 3EC7A 1PQPA 3ITDA 1KEUA 3ADOA 1K5HA 3R3SA 3AOGA 3NTOA 1R4MA 4WPGA 5JE8A 3WB9A 1TVEA 2CVOA 5JSFA 5TJHA 2XF8A 4FN4A 1MB4A 2P2SA 2JAHA 5C5IA 4B8WA 1Z74A 1U8XX 1D7OA 4OKNA 4HUJA 4RGBA 5JMWA 4AJOA 1E5LA 1CERA 5TT0A 3WMWA 3RVDA 4KWHA 4CLEA 2NU6A 3PYXA 3WICA 4DIBA 3G1TA 4YRDA 4LISA 5A9TA 2H1SA 1DC3A 2RH8A 5ILOA 3PP8A 3GAZA 2IZZA 1L7DA 3AUUA 4Y67A 4CMEA 3I23A 1YJQA 5A9SA 3Q9UA 2YY7A 3L07A 3BA1A 2H63A 5ER9A 4EBFA 3TL2A 5KVSA 3BYZA 4DRYA 3U09A 3I9LA 4O0LA 1NQOA 1IYZA 2O3UA 4LMRA 2BGMA 1ZXLA 4PLTA 4BNHA 1C1XB 1VE9A 2GR9A 2GGSA 4KQWA 1P0CA 3QVWA 5FEUA 1SBYA 2EHDA 1Q2XA 1XSEA 2C5EA 3OQ6A 4CUKA 1V3TA 4IQ8A 4M87A 1KBZA 4PG7A 1ZK4A 4YJHB 4N5LA 3VDRA 4QX6A 4WCDA 5TGDA 1R4NA 3VVBA 3F47A 4BMNA 1YL7A 1TT7A 1UUFA 2V7PA 3EYWA 3KYCA 5U1PA 2JD1A 5T8KC 3HQ4O 1FDWA 2UUPA 1LLDA 4CUJA 2DBVO 1N9GA 3WQSB 3GC6A 1LC0A 1ARZA 4WLNA 4Y6PA 1WVGA 2EKQA 4HBGA 1WWKA 2AA3A 2GZ1A 3PXXA 1SOVA 3N74A 4XYBA 1NHGA 4M54A 2VHYA 1MG0A 2IEBA 3NTRA 1G0OA 3EGOA 1DBVO 3STHA 4N7RA 4R5MA 1EEHA 1YB5A 3GLQA 4OKIA 1N1GA 2YFHA 3WYEA 2H6EA 2OXIA 1ONOA 3UICA 2PTGA 3ZWYA 4QXMA 5A5FA 1WP4A 4XD2A 1ZEJA 1DIAA 1JKJA 4NBUA 5DCYA 4BGEA 2JHGA 1FF9A 4YAGA 4II3A 1SMKA 4M89A 4DBZA 2O3JA 4J4TA 4ILKA 5TJ9A 1U7HA 2DM6A 3W1VA 1XQ1A 1XG5A 3S55A 4FW8A 2JCYA 3AU8A 3NGLA 1TLTA 4N54A 4WNIA 2HUNA 4NFSA 5TNXA 4E2WA 3E6AA 3KVOA 3W6UA 3IJRA 3WGOA 3TNLA 4MVJF 3FPCA 3WFIA 1DRWA 1VJ1A 3ZHBA 3ZNQA 2Q2QA 5TS3A 3V5NA 5AVOA 1ZVMA 3DBRA 2OFPA 4BOYA 3INRA 3PWZA 4IS2A 2FHSA 4KWIA 3WS7A 1ZJYA 4XJTA 3RROA 2V6MA 1H6BA 4ESOA 5JCXA 5JDIC 1KIFA 3EHEA 5KWEA 3L77A 2Q46A 4S3MA 4P22A 5TX7A 3V1UA 1EQ2A 4Q3NA 5G4KB 2QG4A 3RUCA 1X7HA 1NP3A 1M6HA 1T2DA 1YQXA 3PLNA 4AJ1A 4XQEA 4E5YA 4NR0A 5L4LA 4HXYA 1U1IA 1R0KA 5ER6A 5TQVA 4YAKA 3FNHA 1I3NA 1EDOA 5FI3A 1PGJA 4GLLA 4FD3A 2Q1TA 3AY6A 4EUHA 4EYEA 3VPHA 5DCWA 1NR7A 1KEPA 5CP8A 4E32A 3F46A 2O2YA 3W8DA 3GN2A 1NAIA 2HLPA 3RBZA 4LSWA 4IXTA 3NX4A 3OEYA 2JJYA 2ZKLA 4RDIA 1Y8QA 3WGGA 2Z5LA 2G17A 5L51A 3RBXA 2DVMA 2B83A 2R00C 5TRTA 3WLEA 1EE2A 1Y6JA 5CFZA 1HDRA 2WYWA 1PGOA 3QRWA 4UVEA 1ZJZA 1F17A 3H9GA 4RLHA 4BO9A 1I30A 2I3AA 3MJ4A 3VTZA 3B20A 2OGUA 4BNLA 3BTOA 1LDBA 2Q2WA 2QHXA 1LRJA 4Y6RA 1XGKA 1KEVA 1ZBQA 2GD1O 4ZQBA 1OC2A 5TF4A 1UAYA 4LGVA 4OJNA 3RU9A 1YKFA 3EZLA 2V6BA 1ISFA 3G49A 4MIOA 1GAEO 3HSKA 4W99A 3D4PA 4ZRMA 2DTDA 3B1FA 4MPDA 1N8KA 3AFMA 4WLFA 4KTVE 4ITUA 3AI1A 2IYOA 2I99A 2QRLA 1I3KA 4DQUA 3D3EA 5JCJA 1GYQA 3H5AA 4HFMA 3W4KA 5KJFA 2PD3A 3JD0A 4W6ZA 5IXSA 3FWNA 4AFNA 2EIHA 1SZJG 4MOWA 4LSMA 4X54A 1TB4A 1CIVA 1JAXA 1E6WA 2HMWA 4CM9D 2IEDA 3GG2A 4BO7A 3RQSA 5EERA 3AFNA 4G5HA 1BXGA 3WSVA 3LZ6A 3AUSA 4Z9YA 4DIFA 4TSKA 1P1RA 1T1SA 2BLLA 4Q3BA 4MP3A 1LJ8A 2BH9A 2OORA 4L73A 3E1KA 4CJXA 4DPKA 3GFBA 3OSUA 4UUOA 3L6DA 3JCZA 1GY8A 4K1LA 3PWSA 4B3HA 2X5KO 1JDJA 4ZICA 4OM8A 3LU1A 2X86A 1EFLA 4XWYA 3ZNNA 2B5WA 4IZIA 2YW9A 4R9SA 4XRRA 1KVRA 1KY4A 3ETDA 3OEWA 3I9MA 4B4UA 3K6JA 4CM5A 2A94A 5I8WA 3U0BA 4YT2A 4I5GA 3PZRA 2Y0EA 4NK4A 2CY0A 5DF1A 4TVBA 2XOXA 3RU7A 3S2IA 1B0AA 4DL9A 4NFHA 1E3JA 4O63O 3NGXA 2DTXA 4CM3A 4BGVA 3BMNA 5KKAA 5JDCC 3M1LA 2Q3EA 1PQUA 3H2SA 5JO0A 4IINA 4MJLA 1C0PA 2PGLA 3QWAA 3JYNA 3VH4A 1MXFA 3GR6A 4RPLA 4J1QA 3LT4A 3NT2A 5CDGA 2C07A 3AY3A 3K92A 4WCFA 3FTPA 1P45A 1PSDA 2FSVA 1QYCA 1N1EA 1ZK0A 1HYGA 4IDEA 2WSBA 1J5PA 4XYMA 4D42A 2LDBA 4ID9A 4UAGA 1XR3A 4JCOA 5F3RA 3ZWBA 2GSDA 4MIEA 4R3WA 4AL4A 3H7AA 5BSGA 4R16A 3JQFC 3MJEA 3E48A 3VKUA 3KETA 2GERA 3C7AA 4MP6A 3UN1A 2TMGA 3JYPA 4IGFA 3OMLA 2GASA 1MP0A 3LT1A 1DOHA 1Z7BA 2X4GA 2X23A 4MKRA 2PD6A 1R16A 3LYLA 4YRAA 3GNSA 1AHHA 4WCFB 1VM6A 2EJWA 2AG5A 1ADBA 1ZSYA 3DEYX 2B37A 3JQAA 1P31A 1QMGA 5KTKA 4CR7A 3H6KA 4EGFA 1LNQA 2OMEA 3QVOA 3JTMA 2PWZA 1BG6A 2GF2A 4URFA 4XZ3A 3WGZA 2R00A 4CL8A 1HZJA 1F06A 1Y9AA 5EMHA 3WG9A 4ZVVA 3D1LA 4E3ZA 4RO0A 4NIMA 3ZI0A 3ZU2A 5GY7A 3UKOA 4I9HA 2X58A 4P4GA 3AWDA 2NTNA 4KMSA 1NQ5A 3EVTA 3ZWVA 4TZTA 4A0SA 4RCVA 1ADCA 1W4ZA 1E3EA 1Y8RA 3L4SO 4OYRA 3GK3A 1J6UA 3NKLA 5KOIA 4NQZA 4IPTA 4D79A 3ICPA 3RFVA 3ZN2A 1IZ9A 2E37A 4B79A 4UEKA 4BNYA 2Y93A 4YJGA 1BDMA 3V2HA 3GMDA 1EVZA 3TZ6A 4QFCA 3L6EA 1VSUA 4L74A 1ZSNA 3PTZA 3B70A 1UDCA 1D3AA 3H4VA 1X15A 2CDBA 1O95A 4NJMA 5CDTA 5JBIA 1QV7A 3KEQA 5KJ1A 1WNTA 4EEXA 1NXQA 3GVHA 1E7SA 3E8XA 1GYRA 4RVHA 2NU8A 2PGDA 5HS6A 2D8AA 3S2EA 3H3FA 4AJLA 5C7OO 3F5QA 1QG6A 1I2BA 4J7UA 1ZUD1 1U5CA 4XGNA 4JK3A 4FGWA 2EP7A 1WAMA 1ZH8A 3B6ZA 3O8QB 3AM4A 3KYDB 2HDHA 5ITVA 3QHAA 3ASVA 4AVYA 1T4DA 1GCOA 4Q3EA 1T2AA 3ZV4A 4BMSA 2B69A 4BO4A 3E5MA 3HDJA 4ALNA 2EXXA 1YBVA 1DB3A 3FTNA 4XYGA 4E13A 5IJZA 5G4LA 1N7HA 4BO8A 1GEEA 2DBQA 3BIOA 4PZEA 4C7JA 3G17A 4F6CA 2GN4A 1B16A 3WGQA 1U3TA 3DZJA 4C7KA 4CUZA 3GPDG 2DTEA 1Z73A 4CQMB 4CV1A 3D4NA 4D41A 4ZJUA 3MJTA 2YV2A 3K96A 4Y6SA 1E7RA 1U3VA 1FK8A 3P5SA 4OO3A 4E12A 3GVPA 3RC7A 3BMQB 1TT5A 4IJUA 2X9NA 2EW8A 5HS4A 3QWFA 3ZH2A 1VJTA 3FSRA 2BI7A 3ZV5A 5GZ6A 3LF1A 4FJ2A 1NTOA 1BSVA 2W2LA 2P9GA 1V8BA 1R4MB 2VZ8A 2A35A 1NPYA 5COBA 2J3KA 1SEVA 2J5KA 4KOAA 3V1YA 4WUVA 3DAGA 1LSJA 1PGQA 2Z95A 3VZQA 3IOYA 7ADHA 3DR3A 2WTBA 3OECA 3PLRA 3RFXA 1UR5A 1DC5A 2IE0A 2PZKA 2YV1A 2Y1CA 4XEHA 5ENVA 5IXYA 5JFOA 4IDGA 2NVWA 3GVIA 3IUPA 3K9QO 2VOEA 1SB9A 4WCFC 2AQ8A 2P4QA 3OFSA 4M1QA 1RM0A 3DBHB 1XU9A 2GZ3A 3HWRA 2WEKA 5G0TA 4J1TA 1KOLA 3BMCB 3GEMA 5JYDA 4EJ6A 4CMEC 4DC1A 1NWHA 3GDOA 4B7CA 2I76A 3KLPX 4CMJA 1U8FO 1GFSA 2YDXA 1A4IA 5IF3A 4WEOA 3ADPA 4ZQGA 3K8ZA 3IQDB 3WX0A 3E82A 4WK6A 1RPNA 3QSGA 3ICCA 1U3UA 1ZKMA 3GUCA 4UVDA 5JLAA 1O8CA 1W8DA 2Y1DA 2OBNA 4GL4A 1T2EA 4TRMA 4BKPA 1PTJA 1TT5B 4Z0HO 2YQ5A 4PRLA 2Y1FA 4ALLA 2I66A 2VZ0A 3HB5X 5F1OA 5BNTA 1JWBB 1PZGA 1KYQA 1NX6A 1YB4A 3WLFA 1N9GB 5IDYA 4WJZA 2YUTA 4YAJA 1KC1A 1U9JA 3LC2O 3TFQA 2JD2A 3BAZA 5GMOA 4CM6A 5I9NA 1ORRA 3OM9A 4ND3A 1LSOA 1OAAA 4AJIA 3OJFA 4MVJD 1WMBA 1OMOA 2E49A 2OL4A 3LLSA 2D0IA 4HNGA 3KOUA 1VC2A 1HRDA 1KC3A 2DAPA 3JQ7B 4IDBA 2YDYA 2NADA 4RORA 4DPLA 1A71A 3KZVA 4XX0A 2I3GA 3F1KA 3DBHA 3AI2A 1BXKA 3F4LA 4RZIA 4CLDA 2B4TO 2Z1MA 3UUWA 4PGFA 4ZU3A 2AEMA 1YL5A 3MJSA 5FYDA 3Q2KA 3Q0EA 4E31A 1JN0A 3EDMA 1HE2A 1LDNA 4I1IA 1EVIA 4MVJE 1A5ZA 2V65A 3DOCA 1UXHA 4PLYA 1KVQA 3CTMA 4XB2A 3WNVA 4F46A 4XGKA 1NAHA 3NDRA 4CMAA 1NNUA 1M67A 1O6ZA 3AUTA 3GGPA 3PHGA 4MVJI 2O50A 1SEPA 3OJLA 1H5QA 4B4VA 1XQ6A 4J6FA 3ONEA 5ICSA 1I10A 1DJQA 1MLDA 1LRLA 2ZJ0A 3DMTC 4DBVO 5IZCC 3NDIA 1GQQA 4IUYA 4ZD6A 4B7XA 1PEDA 2B36A 3GRPA 5KJEA 4DUPA 4N5NA 2NSDA 2VCYA 1AHIA 3PJEA 3VPFA 1E5QA 2YJZA 2P5UA 4OGWA 4M49A 2AQHA 2QIOA 2NVUB 2EF1A 4HFNA 2PKRA 3GHYA 1NR1A 1KVUA 3PI7A 5AXDA 4TRNA 4E30A 2BMAA 2I6TA 1Z6ZA 2O7SA 3RC1A 3HJAA 3OH8A 3PIDA 4LCJA 4ND2A 1IL0A 1R37A 1MC4A 3ZCXA 5A9RA 4JQCA 1CWUA 3DC2A 2IDZA 1IPFA 1H93A 1EFKA 4DC0A 3JQ9A 1GR0A 2D2IA 4J1NA 3PHIA 4LK3A 4QSMA 1HLDA 1V0JA 2GYYA 1G6KA 1T24A 4Z3DA 3H3JA 1N2SA 3PGXA 4LW8A 3I4CA 1UZLA 3I6QA 4II2A 3A28A 2CVQA 4A73A 4RZHA 2P9EA 3GN1A 1I3MA 2E48A 3R1IA 1Z82A 3DOOA 3WYBA 4DTIA 1LX6A 1ISIA 4W7IA 1TEHA 3FD8A 4EI2A 1HL3A 4ZRNA 3RJ9A 4JGBA 4KDEA 5T67A 1X7DA 1PJ2A 1E77A 1BTOA 5L7TA 2Q2VA 2P5YA 1U2GA 1C1DA 3PHJA 4EUFA 3HUDA 3M2TA 4EUEA 3JQCA 3PRJA 1MA0A 3PGJA 4WLEA 5IN5A 3GEGA 3BMNB 2ZB4A 3ZWNA 1X13A 2IODA 4R41A 4TKLA 4I08A 1V35A 1D1TA 1IPEA 2Y66A 3H5RA 4XDZA 3VPGA 1E3WB 3U62A 3QP9A 4NHEA 2H9IA 3JQGA 2DBZA 4FFLA 8ADHA 4AJPA 5JAQA 4UUMA 4A10A 1I0ZA 3CH6A 2VWHA 1YQGA 3Q2IA 5KVVA 3JD1A 1MGOA 3CSDA 5B4VA 4JLWA 4U0JA 1NFFA 4EDFA 2J8ZA 4A2CA 1NQTA 4OQZA 4D0SA 2VRBA 3JQ9C 4OHUA 4ONEA 2HRBA 1BXGB 4G65A 4CM4A 4NH4A 1EZ4A 3JQ8A 4AJ4A 1GYPA 2VHZA 5DBGA 2W8ZA 4XKJA 3AI3A 2ZQYA 1E1NA 6LDHA 1ZK1A 1C1DB 2VRCA 2EERA 5THKA 3WBBA 1RM4A 3PQDA 2PKQP 1Z45A 2VNAA 1EK5A 1YVEI 1EUDA 4IJWA 3L6OO 3P19A 2OP0A 2CDAA 2DU8A 2HK7A 3UGKA 2O4CA 1CF2O 3HN2A 3T7EA 1IUKA 2X9VA 1U2DA 1YDWA 1YH3A 1XYGA 3ITKA 3LC7O 5BSEA 1B3RA 3I1JA 3TZHA 4A5OA 4BB6A 2P4HX 3NYWA 1VJ0A 4WNCA 4OOFA 3PYMA 3O38A 4NDNE 3SC6A 3H9JA 1QYVA 1VRWA 1TA4A 1WMAA 3A9WA 2FPIA 1Q0QA 3OIFA 4J49A 3WQQA 1LC3A 4NI5A 1M76A 3LLVA 4OAQA 3BXXA 3KLMX 3DB2A 3W8EA 2HO5A 3GG9A 4UVIA 3D5QA 4E5NA 3ABIA 4YQZA 4J16A 3GVXA 3S2GA 2JCVA 3NV9A 3UW3A 5L7WA 1DRVA 3FI9A 1Y5RA 4B8ZA 2JFHA 1MG5A 3GFGA 4TRRA 1CETA 1BW9B 2D1YA 3C7DB 4IGEA 3ZW9A 3Q11A 3ROMA 5FWNA 3DWFA 5JAZA 4PG4A 5LDHA 2HRZA 5CG1A 3GNTA 4HFJA 4TRJA 4H3VA 4CMCA 1MV8A 3MEQA 1MFZA 3E18A 3GY0A 3ZZNA 1JLLA 3GF4A 5TT1A 1VLLA 3CMMA 4BGUA 3I9OA 4ALMA 5L7YA 1HT0A 1NM5A 2VUUA 4XQGA 1QKIA 5HTOA 1ZEMA 4RLSA 3R6DA 3O03A 4CLOB 4BS9A 4M8SA 1IE3A 2Q50A 3S2FA 1SPXA 2C29D 1QXSA 3CUKA 3GPIA 5T64A 3WWYA 2XPCA 3WXBA 4FOSA 4L76A 1HDGO 2ZK7A 5H81A 3VZRA 3ZHXA 4BKRA 1UH5A 3C85A 2IRWA 3K5PA 4PIVA 3ONFA 1NFQA 3LT0A 2O7QA 3L0DA 4QUKA 4R69A 4CLXA 3T4XA 1Q7CA 2EGHA 4R01A 1G0NA 2PZJA 2Y1OA 1NVMB 3NAQA 1DEHA 4HV4A 4NPCA 1DC6A 3CE6A 4FPXA 1BHSA 4QQRA 3ANNA 4R68A 1YWGO 1RYEA 1GU7A 1YQDA 1IULA 1XIVA 2DUWA 5FFFA 5IFLA 1DLIA 2BGKA 2O4UX 3LQFA 4PLFA 1FDVA 3DTTA 4XYEA 3NEPX 4I9NA 4U6SA 4CMKA 1I24A 3BHMA 4W9NC 1JW9B 3VDQA 4O1MA 2Q1SA 2FP4A 1IHXA 1W6UA 1YOVB 5CDSA 2RH4A 4XYLA 1UP6A 4MVJH 5ENDA 4DYVA 3UF0A 1ISHA 2HQ1A 3DBVO 3U4HA 4BO2A 4R1SA 2W2KB 4OXNA 5L9AA 1P77A 3KB6A 2IXAA 5EESA 2I9PA 3JYOA 3H9QA 1LSSA 3QLJA 4RF4A 1B7GO 1H2HA 1WXDA 3V8BA 3JQFA 5A03A 4MKXA 3RSHA 3H9UA 4TWRA 5L4SA 3IP1A 3HHPA 3JQEA 2O23A 1DPGA 5IZ4A 1ML3A 3UCXA 1DJNA 5DP1A 4BNIA 4XR9A 4J7XA 2VHWA 4Z9FA 4JBIA 3ON5A 4ND4A 4YJGB 2WM3A 4YWJA 3WJAA 1TXGA 4CLRB 3D3WA 5FF9A 1CEQA 1YJ8A 1WZIA 2DLDA 5C7LO 2IZ0A 3O4RA 1UXGA 2JHFA 3M6IA 5H82A 4BMVA 1GCUA 2YQ4A 1XU7A 4B4OA 2BFAA 4J2OA 4BNTA 1ISJA 4O5OA 5CPFA 3VAZA 4ZN6A 2A4KA 2J3HA 3D64A 3QIVA 4NG5A 3L9WA 1IY8A 3U4DA 3EY4A 3DZGA 4YYZA 3G3EA 2VHXA 4CV3A 2Y05A 4EEZA 1XA0A 1PJLA 2CSUA 1MXHA 2NLOA 4GWGA 2D3TA 4H15A 1BXZA 4FCCA 1OFGA 5JO9A 2RBEA 2NU7A 3D4OA 4IIUA 3JQAD 2HAEA 1LUAA 2C20A 2HK8A 4HWKA 1UJMA 4KUHA 2CZCA 5CDYA 4GSLA 4R54A 3TZQA 3QE3A 4BIIA 4W9NA 4JXKA 3HB4X 4GGPA 4K6FA 2W4QA 4PLCA 1EQUA 1U28A 3WTBA 1LQTA 4GX1A 3DTYA 3C1OA 3CZRA 4FGSA 2YFQA 1C3VA 1BRMA 1X7GA 2SCUA 3A4VA 3S1LA 4UEJA 2EKPA 1WLYA 4PFJA 2BFPA 1A7AA 2NU9A 1JKIA 5LDGA 1YBMA 1RKXA 4IZHA 1YL6A 3I5MA 2WYVA 3GGOA 3HFSA
chains in the Genus database with same CATH superfamily
1RXUA 1CJUC 4WZBE 3W6ZA 4IJQA 1FNCA 5KJ6A 2I3DA 4RJKA 4KXFB 5G0SA 4HYEA 1E0DA 3KJGA 4RQTA 4KIUA 3CKLA 3ZY5A 4EEKA 3HYLA 3AF0A 4DKXA 3DNPA 1HI9A 2GJ4A 2L69A 2QUJA 4R83A 2CXUA 3MM4A 4HVTA 5ALMA 2BGJA 3BD8A 1M8KA 2J7KA 5G0UA 5DBIA 2MMGA 2XXBA 5CLHA 2IGTA 3QW2A 2CHVA 1HBJA 3RUEA 5ITWA 1HLFA 5T41A 1RJGA 4L2IA 1E9FA 3P52A 4JT8A 4PXAA 2RHDA 1PVDA 5C8DA 1UDBA 5ALUA 3DF7A 1ONNA 2UV8A 5IC6A 3EGDA 4EUSA 5LQUA 1K2VN 3WGIA 1ISPA 2R6JA 1E1RA 2AEEA 1P4RA 1KJYA 1FP4A 2H18A 4X7BA 4IAOA 4OJYA 3EC2A 4TQAA 1U04A 1B8VA 2F1IA 2GBPA 3FR7A 3H65A 4D9CA 1JQDA 2JFQA 3I0MA 4L8GA 5E8RA 3ZGXA 3DR5A 1A8IA 1YQEA 1U5BA 3WGUA 4C07A 4ZPJA 2YWXA 4KHZA 1XO1A 4NYMR 1II8A 3UTCA 3VX3A 3DTNA 1OREA 4PYNA 3PEVA 4J0HA 1NZDA 3K70B 3KFXA 4NCAA 3BTUA 5T4FA 4ZAYA 4CM8A 4MV1A 2ZRIA 5KX5F 3OPVA 4A26A 3ZUPA 3NRJA 3RREA 1BYIA 2JGIA 3DYBA 2YH2A 2QENA 3QFSA 4AURA 3M2PA 1PDOA 4AMYA 5HF9A 1NBAA 4W5OA 1DFGA 1PR0A 1KAEA 1F0NA 1ZJ5A 3DFFA 3CM0A 1V5EA 5IBRA 5I7VA 1I01A 1B74A 2XUHA 3CVJA 5KSPA 4BE4A 3EGXB 1WDMA 4JQOA 2WWXA 1DIRA 1OC4A 1VE7A 3QY9A 2HZ7A 1KDTA 1MB3A 2OM2A 2R96A 4BKQA 5EEHA 4UTPA 1E2IA 2OO5C 5EJFA 3F5SA 4QUBA 5EPOA 4HB2A 1UPBA 1CS4C 1A5SB 1WHTB 3E70C 4JXZA 2QE7A 8ATCA 4PE5B 1GNVA 2FHPA 5JXWA 2VRCD 3E9RA 2C58A 2QL5A 1NQAO 5FFNA 3GDFA 4AUMA 4B0PA 4LHEA 4K6GA 4PY2A 1TYAE 1ZCBA 5KCMA 1KS9A 2N1BA 4NG4A 3K7EA 2EP5A 4PTYA 1OX4B 4Y6LA 5F5LA 3HDQA 1JU3A 3EE6A 2FSIA 1H65A 1JKFA 5GONA 2PMEA 5K51A 2G09A 3LC1O 3GH1A 4OQLA 1NVAA 2FWAA 1OWOA 2HSGA 4C30A 4JBLA 1NSTA 5DNYB 2QN7A 2Y9PB 3NTQA 1V1MA 3H4TA 1Z8DA 4HEHA 4I55F 4KXXA 4QLAA 5EWJA 1QIHA 3STTA 5I48A 1IK4A 1MUUA 4TKMA 3THXA 2PJRA 2CJFA 5J3JA 4RVNA 3MXOA 3AERA 2QJRA 4TKUA 4U8GA 4BGDA 3ANTA 1H42A 3AEQA 3MOIA 3QZUA 2A9VA 3SJBA 5A5VA 3ICQB 1GUFA 3SYKA 2Z98A 3COWA 3NWEA 1XVLA 2BJVA 1RR6A 3IBTA 1HORA 1XEXA 4HLQB 1KFJB 1R66A 3SC4A 3NHAA 3U5ZB 1TKAA 2HFJA 5EJ4A 1YXMA 1OPRA 4Q9LA 2LGJA 4URYR 2HI0A 4HLUA 4H7JA 1ICIA 4AJKA 1SUPA 3UJ9A 3WMXA 1FU8A 2VPWA 2CJYA 4PV7A 3BJEA 2O0LA 2CDCA 4LRQA 5JEEA 4JIGA 2Y1EA 4O3MA 2EQBA 1UKYA 2FQWA 3DL2A 2AFIB 5IC4A 3LRTA 4YCAA 4NATA 4P3OA 1KVSA 3DEJA 1KWGA 2WB2A 3AIIA 3T5MA 3VOTA 4HUTA 2E4ZA 2QM7A 3UB4A 2O2CA 3Q6IA 3U4QA 4JJ7A 4HXEB 3CJRA 1RXYA 3T99A 1E6EA 3ZEAA 3QNUA 1TECE 1PR2A 2HK9A 2UYQA 4U7FA 3LV8A 4G26A 1P5JA 3M1YA 3NT5A 2LV8A 3HH8A 4G0PA 4G56A 1QF6A 1C14A 5G1OA 3PDWA 1B23P 3HB7A 4KIWA 3HXKA 2UZIR 2F62A 3AEUA 1OV4A 2DSTA 5A06A 1JZTA 2VDJA 5BSFA 4GOOD 2ODNA 5F77A 2Y6UA 5IEBA 2WWFA 4PYQA 4WKGA 5ANRB 3TAUA 4V0SA 3IUBA 4UNSA 3ZV7A 3TWOA 3VDMA 4AF8A 3BA6A 4I6GA 1SOWA 4CEHA 1DNPA 3GJYA 5FBLB 2CLFB 4RH0A 3CR7A 4RULA 2RARA 5KWSA 4U0KA 3TXXA 4YI3A 3QLUC 1OXUA 3A1TA 4L6IA 2BHNA 4ZO9A 2AKAB 4QC2A 4TTSA 3SDBA 4ZCRA 4M21A 3BDVA 3GFTA 4D9KA 1OYOA 2OOSA 2HIAA 2J4CA 5GJVC 1DIGA 1SXJD 3JQGB 2A9PA 4KBGA 5BMVF 2FLVA 4HWOA 2AHRA 2JLWA 4FB5A 3AETA 5TV2A 1RKBA 1BJKA 1RJFA 2MR5A 2YWJA 1AUVA 5H16A 5M3BA 3ZDYB 4B31A 4HNSA 2PUDA 4C7VA 1Q44A 1DUVG 3D8TA 4OJQA 1TUIA 5DBEX 1GL9B 1ZESA 1OBOA 1LD3A 2X0KA 4BASA 4G4SP 4C0HA 3PFCA 3OE5A 3I32A 3WMFA 1A97A 2PFGA 2XTMA 4ZOCA 4F60A 1JHUA 2KMLA 3E7XA 4LHSA 1V25A 2OG2A 1LI7A 5CGQB 2YVAA 1WW8A 1P2UA 1Y4UA 2PLAA 2Q0QA 3MGBA 1XWFA 1KZYC 4M1EA 4WZBA 5CX1B 5CA1F 2X0RA 3RB8A 3QXJA 3EVNA 1YB6A 4RGQA 3U31A 2QGFA 2R4UA 3L8DA 1E2JA 1Y33E 2HWYA 1AUPA 4DJ5X 2NU8B 1IDOA 2PA0A 1WUIS 3VUFA 3EA0A 4JI3B 3FYCA 4B3TB 1J8YF 1N8NA 1ONPA 3L7JA 3QU5A 3F5MA 5CPBA 5AD1A 1SKMA 2W2XA 3AEUB 4M55A 2XCQA 1R4NB 4IJ5A 3KD3A 3VYSB 3I5YA 4DWVA 1L8AA 1BHJA 4DREA 1KY5A 2XB6A 4R1QA 1T25A 2O2SA 1UBMS 1ZFNA 2QTLA 2V9ZA 2L82A 3HB1A 1NZJA 4FR2A 4N5DA 4QHYA 3ZXYA 5HJEA 1OZAA 2NNWB 5JBNA 4HUQA 3D0KA 1C7FA 2GN9A 1LPSA 1LBTA 3I3OA 2HH9A 3ZK9A 1PQYA 4DMLA 5JISA 5F9MA 2SHKA 2ZRCA 2ZWOA 2PGXA 2Y76A 1AKNA 3LKVA 4PZDA 2G1KA 1DC8A 3DOEA 4AJEA 4F3NA 1BC5A 1E8NA 4ZO4A 4G8JA 3FDFA 3IEVA 2ANCA 3F7OA 4GLJA 2ZYTX 4RL6A 1Z4KA 2NPFA 2OEPA 1D9ZA 2VTDA 3DXFA 1VLVA 2I65A 3R3VA 5AQ1A 3ADCA 4LY9A 3BRWA 4FONA 3KJEA 2CL5A 4LC1A 4PLWA 5EEGA 1ES9A 3EVDA 1FEZA 4J1SA 1WHSA 2QD1A 2R1VB 2YYYA 3M6MD 3TD2A 4MO9A 2UYHA 2JGKA 4TL9A 2A58A 1LBHA 2VT6A 5DH9A 4C05A 4XA8A 1O97D 3KU1A 4E1AA 1PZHA 2FFJA 1BGVA 3ZVLA 4A0HA 4BX9A 1B15A 4X93A 1ZXXA 3CWCA 3WGMA 5AI5A 4F1WA 1T5OA 5TARA 3TZLA 3OT1A 4MRNA 4P98A 4CCYB 4CLOA 2IPXA 3WLOA 4I1PA 2P3LA 4FFPA 1AX9A 3VTAA 4G0VA 1VPEA 2GK3A 4LRTB 2N47A 2G9QA 3QVLA 4K9DA 1NLMA 3KSUA 5EXDA 3DGFC 3ZZUA 1Z5VA 1MRNA 4MSUA 3L1HA 2VI5A 1JSZA 3CEMA 3E3MA 1SVOA 1ENZA 4MB0A 1G42A 1JU4A 1LCIA 2CHUA 1CQIB 4DBLE 5EJ8A 2EFDB 1B2LA 1KNQA 5JW6A 4B6PA 3HO8A 3EAFA 2ZRFA 1XDWA 2QS9A 2QTNA 2VT2A 4EY5A 1SC4A 4MI3A 5J2TF 2QBYA 4MARA 4UULA 2XMCA 3FPSA 4PO1A 1UT5A 1U2DC 2DJIA 4FFBB 4TYPA 3ZVNA 2VATA 2NUTA 1CFZA 5EINA 4E21A 2GXAA 3IQHX 2ZIFA 3GRRA 4O4LA 4UM8B 1T3GA 5F2EA 4M1MA 3ZZ0A 5AVZA 3O31A 4ACAA 1HE1C 2JLQA 4E0BA 2R8PA 4MRPA 4DLBA 4EB3A 3OTQA 1NXPA 3PWKA 3QKSA 5A2QA 3JRNA 1U6JA 3KJXA 5CVCA 3K70D 2UZ3A 3JALB 4G0ZA 4ZGWA 5HZKA 3DUFB 4Q9KA 5YASA 4GO1A 4A7PA 4PM4A 5ETJA 3I8OA 1DFHA 3W2IA 5JUWA 3HBFA 3N2GB 1GT91 3QYFA 2G82A 4FC6A 4LN1A 2DCMA 2Q1XA 1LS1A 2VYND 5EE9A 2CMGA 4I5EA 3WIUA 1IHYA 2HQOA 4NZ9A 4IV5A 2XQFA 3VNBA 4LECA 1VHJA 3PUJA 1YDEA 5KDLA 1QB8A 2YV4A 2DKNA 4JLBA 1AMOA 2O3TA 3LRXA 3ODPA 4QU5A 2V45A 2W93A 4F86A 2IOQA 2H7VA 3LCUA 1L0BA 4ZI5A 3ZY4A 1W87A 4LJSA 2FP3A 3C45A 1BX1A 3DMYA 2GXSA 2Q99A 2W0SA 4D81A 3UHAA 3P2KA 1NPDA 4P35A 3CVWA 3HXMA 2EJVA 3SZGA 4EENA 1QDUA 4XDYA 2XD9A 2I4NA 1EB8A 4JLUA 1UEXC 1PR3A 3IUSA 2C95A 1LDMA 2RH5A 3NBKA 1WSWA 1X3LA 2DCUA 1H2RS 3NTVA 4IFBA 3FHCB 4DQ0A 5DU2A 1T1EA 1VYTA 1XWWA 1UBHS 1VDZA 2WAOA 2NWQA 1PT8A 2FRDA 2ZLBA 4JOBA 4QWMA 5AXBA 3W7VA 4BVJA 3L8MA 4HMPA 5AM1A 3ITNA 1NF8A 2GYUA 2VQSA 3QE0A 4Z8YA 1AQUA 3WLAA 3JSAA 1RLIA 3VI4B 1JJBA 3LWZA 4QKQA 1N8SA 1QF9A 4M1YA 1A0OA 1M2KA 1VMEA 5JDIA 3RSLA 3H5TA 3INGA 3P7MA 1PZFA 1HZZA 3E9YA 3FWZA 1LPNA 3G2QA 5MFZA 4OB7A 1G17A 3W3AD 3P0RA 1EI9A 4M7RA 5CTJA 2OAGA 4YN3A 1M0TA 1HEIA 4EG0A 1L1RA 5EQJB 3DG9A 2DE0X 2X2FA 3G8CA 1IMOA 2P9QA 4U7WA 3LOQA 5K6AA 1A8UA 1LBEA 5F73A 3GFRA 4KOEC 5JSZA 1ND6A 4X94A 1M1UA 3FIUA 2AN1A 3IIKA 5A0FA 4XE5A 1HE5A 2GN0A 1UBNA 1VL5A 1BCRA 1YZHA 4I1SA 1OWMA 3MPOA 1JS1X 1Z7EA 4OAOA 4CXMA 5CDUA 2P27A 1TCCA 4YT5A 3ZGYA 3KSZO 1RI4A 3R0IA 5EHIA 2CYAA 4DEYA 4NV0A 3DTVD 1H4VB 1QC5A 3RS0A 5I9IA 3V4ZA 4AMUA 5G2OA 3WGYA 3BMQA 3GMIA 1ZMOA 1JPJA 4YROA 3KUUA 2C0CA 2YWRA 2CBXA 1CRWG 1IC6A 1X8LA 3I2KA 4FYMA 4NP6A 2WFMA 2XCTB 2C94A 2JK1A 4C7BA 4N48A 4YTEA 4WZBB 5CX1A 3SHVA 4F45A 2XT6A 1ZQ1A 1DEKA 2YS6A 4XOUA 3DEIA 1CLUA 3SQNA 1EUZA 1O9GA 2ZDHA 4AJJA 2I3ZA 3U4CA 5EJ6A 4BVLA 4Q21A 1RHMA 1P81A 2I4MA 2P5SA 4NBVA 5CA0B 2NN3C 1N7JA 4TM8A 3ZWKA 5KNCD 2OM6A 4FHCA 4Z9XA 4N6GA 5AM4A 5BWNA 1O5TA 4CKXA 1SQ6A 1RRFA 2KE5A 4KR7A 3EYAA 4QDZA 3IT2A 1GTRA 4Q3CA 5SICE 2YX1A 4ZOLB 2B9EA 4RZQA 2PNFA 4TTPA 3BILA 2E1RA 3GP5A 3J81A 1DAEA 1NULA 3IMKA 4LPKA 1KRHA 5B6JA 1KI6A 3RVKA 4BO6A 5KHLB 3N70A 2AMLA 3D7KA 4NYIR 2X0IA 4G5GA 5B55A 5HSGA 5JNRA 3ELWA 2Q29A 4LGCA 3VI3B 2G4LA 1RBMA 4JBGA 3B7WA 1WVMA 4DMKA 1CP2A 1EFVA 1EJ2A 1Z17A 1OBHA 3IJPA 4IMRA 4J4BA 4N49A 4XARA 4ZA2A 4IVRA 1USUA 4WEQA 4XDGA 3U80A 4JI7B 4JQSA 4DIOA 1HMPA 1RBZA 1T2UA 1GADO 3HA7A 1OBFO 4H1UA 3RK0A 2CB0A 5BV0A 5KAMA 1XEAA 1EXWA 5DHAA 3WK6A 3K71B 5JADA 1JHDA 4IM7A 4NECA 4XVUA 4UAVA 3DZFA 1SKAA 4L4ZA 3AM3A 5E3HA 2AQKA 1CUIA 2YMMA 1F2VA 1GA4A 3IH5A 3H6HA 3T4PA 2PUAA 1BROA 1DT3A 4DNOA 1U5BB 3F2VA 4QBFA 1I7QB 4H17A 5P21A 1L7NA 5H83A 1FTWA 4BUZA 3T3OA 3N0TA 3PEWA 3UEOA 2BF4A 3A37A 4LVUA 3KAPA 1ST2A 4EFLA 4JVNA 2P68A 5MDHA 3PYLA 1E3LA 3RUAA 3V7NA 1QO9A 1IJBA 4KFRA 4OKSA 3ZIUA 2PCLA 1G55A 4RIIA 2H06A 3IVMA 3THWA 4GP9A 4Q1CA 2YC2C 1FRFS 2J31A 1ODIA 3ECCA 3UJCA 3W5CA 2A5YB 2OZKA 3EPHA 2VP2A 3GRAA 3EWIA 1NPTO 2VDWA 1DAOA 1FSGA 3LKDA 2WIAA 4G4IA 5HUJA 1W7AA 1KBOA 2ZYVX 4IY1A 4BVAA 3UPDA 1AK1A 1RLUA 3FCOA 2GO7A 4G1VA 3IEXA 4R4JA 3VR5A 3S70A 4ZOQI 1ZJJA 1YDMA 1O6FA 3EAQA 3K0FA 3T94A 3E58A 1QHHA 1DHTA 3HSYA 2FZVA 3LGSA 4P3PA 2VTEA 3TIIA 4ZK6A 5L4NA 3RV3A 4CZ2A 1M0WA 1Z4QA 2FZ5A 3SZOA 5CVDA 2DFDA 4JUAA 3T3MB 4EY8A 2O5EA 2YHUA 3RPEA 4V39A 1V9CA 4LOAA 3UKDA 5IM4F 3KKKA 3NNNA 4OFWA 2ZVDA 1DFIA 4FKBA 3RAJA 2IYZA 2VC2B 2J4FA 2B5VA 3IUNA 2I2BA 3H2BA 3LQRA 3OKPA 5D5PA 2E1PA 4QYXA 5EHQA 5FUYA 3L4JA 4JYBA 2IVZA 2FTKE 3DF9A 3NUGA 4A2WA 3AYZB 3KT0A 1MV5A 3EVZA 4GM4A 3GJ8A 1PLKA 1ZH4A 4GNKA 3RI3A 1Y1QA 1STOA 4BO0A 4MUGA 4ZCTA 5KINB 1VPTA 3VJRA 3EZNA 1CPYA 1EWRA 1GD1O 3FHJA 4R0VA 4X24A 5JVDA 2COKA 1H0SA 4A9AA 1LY1A 5BW6B 1Y1RA 1I7LA 1WB4A 1UAGA 4FHZA 3V42A 1GR1A 3A4IA 5BNFA 4EJMA 2CV1A 1FYWA 2P35A 4J91A 2BEUA 1NBEA 1KERA 3H13A 3RSSA 3WIDA 1JFFA 4C4ZA 2POQX 2B2NA 3TMKA 1GGJA 2F4NA 4X1KA 1IZ0A 3HCRA 4GM1A 1IBLB 1REQB 4I8DA 1Q6YA 4QBGB 1ZN2A 2KJQA 1YDGA 1OIXA 1TPYA 3E2MA 3P2EA 3SFVA 4LX0A 2R7NA 3TW0A 4D9IA 1V8DA 5DE3A 3BDIA 3OF2A 4I50F 3PFWO 3ABSB 4CMGA 2J5QA 1CZOA 3AVOA 1H0HA 3K2IA 4EL0A 1PZXA 2Z2YA 2QD3A 1QHHB 3FDZA 1DDIA 4RKQA 3KDAA 3MZ0A 2OCKA 4H59A 5CW2A 4H0NA 3NBMA 3RCBA 3UV6A 1GPLA 3JQAB 3IAM1 3P2JA 4CQMA 1RBYA 5AYVA 3DLTA 1T8TA 5E6SB 3AM1A 1HF3A 3P97A 4CMBA 4DQDA 1TUBA 5CH8A 2B94A 1ST3A 4RV9A 5K05A 3K5WA 4M1KA 4PXSA 2CL6X 2IA5A 3MD0A 1T6XA 2H1HA 2CXNA 1G21B 1XDZA 2FR8A 1CJCA 4JFRA 2GN6A 3D8SA 5F1PA 5HKKD 3SVLA 1YDFA 1TQ8A 2HADA 4W9RA 5BR7A 2V5AA 5LMZA 3OJCA 3I9FA 3QVSA 2GK7A 3KYCB 1PT9A 2JJ1A 2UUBB 3FTQA 3QNMA 1AB5A 3C3YA 4J0EA 1FP6A 1K2WA 1KJWA 3PRKE 2EYQA 4NFLA 5EZ6B 3ZNOA 1P0PA 1KJIA 1QVWA 1YDHA 2PRKA 3GAFA 3LNTA 2XKJE 1BH2A 2ZSDA 2I54A 1Y89A 1Y1PA 4L08A 1YIDA 1QR6A 3R9WA 2WU8A 4LJ4A 1A8QA 4DUZB 4R6WA 3NHKA 2XCRB 3MRSA 1LLQA 1DDOA 5K8UA 5AKHA 1Z3CA 3WE7A 3DLBA 3WDMA 3VR2A 2YOFA 4DCSA 5KYKA 5I7OA 1EHIA 1QANA 2UUOA 2YRWA 3ZW8A 1NIPA 4NY1A 2WV9A 3EFEA 4B3IA 4DJAA 3V97A 3UG7A 3JS5A 4OQQA 3NIFB 2XYHA 2ZOSA 2C2XA 3KEOA 1HYBA 1Z5PA 1K75A 3BCSA 4C78A 1L5RA 4JBHA 3HXLA 3JWJA 3FOZA 2ZTVA 3GA5A 3ASUA 3HR8A 5DVZA 5DM70 1XD9A 2W2TA 1UT6A 5CD9A 5DEOA 4DQVA 4UVGA 3BIJA 3UMJA 3V3TA 4PHCA 3WQRA 4BNZA 2XR1A 4FFBA 3SX2A 4A0GA 1P2GA 3Q9NA 2CMDA 2O3SA 3B7PA 3IP7A 3SIPA 3HM9A 1BS1A 1T5TA 1E3WA 3VO2A 4DMMA 1DKUA 3BJZA 1HXHA 4G5SA 3S68A 1H66A 1D2EA 2WWYA 1M2VB 2C1ZA 4DNQA 1KI6B 3VOSA 1E2EA 4HEJA 5FRDA 1I9CA 1QGDA 3W6PA 4LJ8A 2WMDA 1YZNA 4HDMB 3O9ZA 2OESA 1DCKA 5A4IS 2GDJA 1AQNA 5CM2Z 4OXKA 4B2IA 1IN7A 3U17A 3OJ0A 4F84A 3MTGA 2EW2A 4EPXA 2JD0A 2IYWA 4RHXA 3DZBA 3FVQA 4J1TC 2UXBB 3P71T 3CXRA 4X6YA 3QLTA 4GEGA 5GM2A 2C2ZA 1WU7A 5E9AA 4FIDA 3WGJA 3KR1A 1JG1A 3CLRD 2J0QA 1FQOA 2WJPA 1CVLA 5JRJA 4LBYA 4M0EA 1Z62A 4I5FA 3AEYA 4IIHA 3UPUA 2IIVA 2V7QA 4NOKA 1FQJA 1EHCA 1TK9A 3L06A 1IDN1 4BFCA 9MHTA 2QRNA 1XCJA 2P79A 2WKWA 3PJGA 1WHSB 2R1VA 3A9UA 5JZOA 3CVYA 1VHQA 4KREA 3IQEA 2BM1A 3GZ4A 2FWJA 3T4EA 3L8EA 1THTA 2XZTA 3GO4A 3HP7A 2FN8A 3OP4A 4BFSA 3LLMA 4D96A 2WUEA 1R8JA 1GUDA 1O77A 4I1OA 4L9RA 1E6UA 2RGBA 3TPZA 3WDSA 1SUBA 3HVHA 2PUHA 3V4RA 1AQYA 1PFUA 4M0DA 2VH5R 3O6VA 3FUVA 5TQ2A 2YWBA 2AFVA 2BI8A 2ZCUA 1VPDA 4QTXA 2X7HA 4OP1A 1V2HE 4OSPA 5F5NA 2OBXA 4GPTA 2CXTA 2EZ4A 1CP3A 3HCWA 4MTLA 4DRXB 3I5XA 5C1IA 1K4KA 3TQTA 3GLFB 4CRWB 1RJEA 3BMXA 4TZKA 3TKLA 2NMVA 4B45A 4Z7NB 5IAEA 4FM9A 2IUUA 3TLGA 1QK3A 2WTAA 1M1XB 3ORQA 4EFDA 3TG2A 2C78A 2YW2A 4GKKB 3WOVA 1C8VB 1L7AA 3R5KA 1CRZA 1FXSA 1GQRA 4LNUB 2CMFA 1U2TA 1ECFA 4KAJA 2BCGY 1CUCA 4QJIA 4UU0A 5DWVA 4DUGD 1E7WA 4HH1A 4GQAA 1ZMTA 3EA4A 3R76A 2H1IA 1WPQA 1DAGA 2VVTA 1RI5A 1XPUA 3PBKA 2GBIA 5CUQA 1HDYA 4XTCS 4A03A 4CGZA 5SYAA 1HDOA 2Y68A 3EFOA 4ENWA 3Q3HA 2F64A 5I7SA 1GDHA 4OFBA 3HJNA 3C3XA 3RVMA 1M6WA 3THYB 2NQTA 2PXHA 1H9AA 2GT1A 2VF7A 2EL9A 3PHCA 2LIVA 2LIPA 2JI8A 4G24A 2Y1XA 1W2HA 3EEFA 4MICA 1HH4A 3E9QA 4MV9A 4NABA 4QYMA 3LA6A 3KQYA 3TXYA 1PQWA 1AXGA 1V41E 2YZNA 3TRHA 2WZDA 3FCUB 4UD2A 4XSHA 3PQFA 1L1FA 1L2TA 4LQ4A 1BA3A 2EWWA 1Z33A 5JNTA 2ON6A 5HX7A 4DDTA 2O2ZA 2LKCA 4K05A 5J58A 5C0OE 3ZE0B 1XCMA 4YCMA 1XTRA 2IXBA 3MRVA 4JI1B 2A0FA 4IDDA 1P9RA 4ISBA 5G4KA 3ZHYA 5DSXA 3O2QB 3BWMA 4IJVA 3ZHCA 1CJMA 1KOJA 4LZOA 2FQQA 2VOJA 5IAOA 2IYRA 4DKJA 2GTHA 3K15A 1BKDR 1EK2A 1NI3A 1TJPB 3VX4A 1SIBE 4NK5A 3DZHA 4M0FA 1MEOA 3EG9A 4YRCA 4RLFA 5B7PA 1UC4B 3GZNA 2ST1A 2D59A 1I4DD 4V0QA 4A6DA 1NJ5A 3JALA 2FSHA 4LYYA 1AY0A 2YRXA 1JQKA 1KFBB 1W85B 3OZ7A 4RS3A 3T7CA 3VC7A 5C5CA 5L6MB 2BHRA 4XFKA 3QQPA 2W8BB 1DHRA 4MUJA 1A8HA 1O8BA 1A4UA 1DKPA 2GBCA 2M6LA 2Y2VA 1KQNA 2RGWA 4DXHA 4BQNA 5KNDH 4LG1A 1E58A 2PLRA 2J7PD 2MHCA 2DQYA 3ETGA 3IVCA 4K9MA 3SK0A 3UT5B 1P44A 2NW6A 3FMFA 2FZKA 3ORYA 4EO7A 2B1RA 2P65A 2Q1YA 5EXSA 4OXXA 4P9NA 3WGLA 1P9WA 4Q7LA 3MLEA 3I2JA 4H77A 4P4TA 4QYTA 5KI6A 2QAGA 1FMCA 4CQLB 1NRIA 4I9UA 4KQFA 1C0EA 1PF7E 2IHYA 3AJ8A 4MX8A 4E6PA 3A1NA 3W0LB 4CEIA 4FJ0A 1KIAA 2OBLA 3EBOA 4NS1A 4MJ3A 1J0XO 3IR6A 1Q5PA 3VH1A 4Q3KA 3STYA 4A91A 1HTBA 4QJ5A 1D6SA 2D8MA 1I36A 3BHIA 1KK0A 2XDQB 5JECA 2CXSA 3KM0A 1K6XA 4Y0AA 3BJRA 3DNMA 3TSCA 1XZQA 3LUPA 4TMXA 2ZT8A 3ENVA 3HBNA 3UFBA 1S7CA 4H1WA 1U9IC 3ZJUA 1EVKA 1C7RA 1KPIA 1LDYA 4KO8A 3TE7A 3ZCQA 4KPEC 2BDEA 1ODJA 1BVRA 1CYDA 1L7XA 3F3MA 1Y1LA 1ZJ4A 4CQLA 5G3YA 2EC5A 1BMQA 1M7HA 1R0LA 1XQ9A 4YCNA 3IIEA 1CQWA 3F8SA 3ESYA 3AHGA 1H9BA 3FVWA 1T26A 3SC3A 4EW3A 3DMRA 2CFSA 2DWCA 2OHXA 5DK4A 2Z8YM 5A4DA 5HVNA 1XJ5A 2XNDA 3AZPA 5IBQA 4P31A 5LU9A 1DIBA 3VKVA 3RJ5A 2IS6A 1NLZA 2W70A 4P38A 1WB6A 2I7XA 4Y1FA 4WBNF 1U31A 4YV0A 2G1JA 1YK1A 2A0XA 3FPJA 4TLDA 2Z6QA 1ZUNB 1QE3A 2PWPA 3EZ9A 3SIWA 5K01A 1WUKS 2QRKA 2R2GA 5ESXA 1UIMA 1H6CA 2GD0A 3QOFA 1ZOIA 4YWHA 1GVHA 5DFAA 1EUCA 2UZ0A 1DG9A 1P18A 4M76B 1V7CA 5TY0A 2HF2A 2I03A 4UHHA 5K9ZA 3CVUA 5FX2A 2PJUA 3UVEA 4C43A 2QR3A 1E1KA 1TM1E 2B1QA 4NOMA 3QLVC 4EGSA 3ORFA 1GQOA 2VT3A 3WTCA 3EW7A 5J23A 1IOZA 2P67A 4KR3A 4UUAA 3HN7A 5LUBA 3HFJA 3L9XA 3DKKA 3PE6A 4HX5A 3Q7SA 2HQBA 4F6LA 4LRSB 2YNMA 4LWZA 5DTJA 4CCSA 1SU4A 4Y9SA 1OZGA 3IUYA 3L8CA 2BKUA 3X43A 3B1XA 3MAAC 4BAUA 4DLZA 1RZRA 2CZQA 1UT8A 3E9MA 5B7GA 4IUBS 3GFQA 3WI7A 1RAEA 121PA 1ID1A 4RF2A 1W0CA 4GOKA 2XNJA 3OJOA 1CQIA 3BFXA 2QRVB 1H1LB 4O4IA 3CR3C 4B6EA 5DHUA 1Q95A 2VCHA 3E4CA 3OPNA 3WFZA 4CLRA 5JNUA 3NYIA 2EQ5A 5AIAA 2CVFA 1TCBA 4QECA 4UUQA 5CLGA 4CIYA 1WETA 1E0AA 2OCDA 2Y3IA 1GCAA 2K2QB 4EVRA 2W98A 4US1R 1W46A 4IJKA 4LTDA 2ZUDA 4ERNA 4LY0A 2DMRA 1K89A 1WCWA 1YZFA 3FDJA 1TF7A 1S3FA 2FMUA 1Z0SA 2W6OA 2BFFB 2VYVD 3LK7A 2KS6A 3MLBA 3QVGA 4D4MA 3EQ8A 4OB6A 5I7FA 1OI4A 3VNQA 3RH0A 1BGWA 1Z12A 2HHJA 5DZSA 1NIJA 2BZGA 2O20A 3IVRA 5HFNA 5TGTA 1YE3A 2H5LA 3M6AA 1W5AA 3L7YA 1XVUA 2WT8A 3NATA 1I4OA 5BYBA 5IVIA 2ZVJA 3TIXB 3MJRA 3IV6A 3R23A 4GI3A 4XIYA 4ON9A 3ER8A 3D3KA 4ZCLA 1HTTA 5HK9A 3HVUA 4PN3A 1DQZA 1YR2A 1PJBA 1T4CA 2DR3A 2OP1A 5EVCA 3RASA 1FJXA 1O03A 4HPWA 2AJLI 3RJMA 1YONA 1GZ6A 4EMSA 2PKXA 4MW5A 4PVCA 1PIWA 3S27A 4LJAA 1HFWA 2G4CA 3LQKA 4BTVA 2REBA 3CIOA 3PPWA 1Z4OA 3CO5A 3DAFA 1KTIA 2ZRPA 2DR2A 4HZUB 5LM3A 3FGNA 3HCCA 1IXZA 4EY3A 1APBA 2C88A 4Q4HB 4FFWA 1XEXB 2OFOA 5EKXA 4EY4A 2AOUB 3KKQA 4MUMA 1BHQ1 4XRGA 2Q4EA 4NULA 2QVZX 3KLBA 1PS9A 4BQRA 2FR0A 4FKZA 4A27A 1U3GA 5M34A 4KUGA 1PN3A 2YHIA 2D4HA 2NV6A 1EB9A 3ZDFA 5KOYA 5HHTA 2NM0A 2H3EA 3CV3A 3M7IA 4JKOA 1I3LA 1PNQA 1MW9X 4ZHSA 1JHRA 2OCYC 1UP7A 3ESRA 4RTKA 1KZGB 5FBVB 4UFOA 5B2ZA 2A1TS 4AZVA 5H1YA 3FX2A 1V1RA 3UJ6A 1H2AS 4GGMX 2C3MA 2JIOA 1VECA 4IQGA 2W00A 1QFMA 2JLCA 3IQGX 2DRIA 3IQIX 2SKEA 4HQFA 4ITVA 5FADA 4NNJA 2HHAA 1M2FA 5I7EA 2A9RA 3KQLA 1LLUA 1JLSA 4I36A 1ENOA 2CZGA 2XHZA 3SMVA 1BD3A 1LPOA 3X2FA 5LD2B 1TJNA 1M34A 1SC6A 1TKRA 3EC7A 3ITDA 1SUSA 2VJMB 3K09C 4B87A 4U9UA 3I0NA 5EE0A 2JGMA 1ZP6A 2VKQA 3NTOA 4IDPA 4MW1A 4WPGA 5JE8A 4P1ZA 3NPMA 2CVOA 2I3BA 2FG7C 2PMWB 3P9RA 5JSFA 5TJHA 3IPYA 3NB0A 4AZTA 4E2FA 2JAHA 4Z7JA 3IDOA 1Z74A 4B8WA 1U8XX 1D7OA 1KXJA 3IAUA 3PA6A 5FL7D 3IA2A 1CERA 4IG9A 1B6GA 4URUR 1UZUA 2WUGA 3SSOA 2ZRBA 4DMRA 3WICA 4DIBA 3BIFA 2H1RA 2VH1A 1M8JA 1YZQA 3D8RA 2IK8A 4JNCA 1DC3A 1CB0A 1YQUA 2WWWA 1M1NB 5EZQA 3PP8A 4GW3A 5K99A 4NPAA 1L7DA 4EG8A 3ZJTA 3HS3A 1XTIA 2RHJA 1XTJA 4CMEA 1QRSA 2ZUEA 1WEKA 3EZGA 3OX2A 2VPPA 3OLCX 2II6A 3Q9UA 1U94A 4ESVA 1JYFA 2H63A 5ER9A 5CK4A 1GGMA 2DWPA 4Q9IA 1H69A 3K9FC 5FXMA 2EGUA 5KVSA 4RVCA 4U00A 5LYJA 4ZARA 5EQTA 1COWD 2O1WA 3JWEA 1QVZA 4O0LA 5M2QA 2O3UA 4LMRA 2J6HA 4TYYA 4QJBA 5GWXA 3ZW7A 5JQGA 2CBGA 4KQWA 1N2CE 3KJIA 2IPLA 5FEUA 1B73A 2JIBA 1I1QB 3AT1A 2I91A 4LZJA 4CUKA 4N9WA 3HUFA 1ACLA 1V3TA 5EZYA 5LKRA 1K4MA 4HYQA 1KBZA 5TEWA 1KI9A 3BERA 3RK1A 3WKDA 1M0EA 1GPAA 4BMNA 4E14A 1YL7A 3AZQA 1UUFA 3R6LA 1MMFB 3KYCA 4ZU1X 3FA2A 5CRIA 2JD1A 3LBHA 4O2AA 4OMFG 3K4QA 4RMHA 4KYIB 4YRJA 1ORVA 3KEFA 1QBGA 2DBVO 3CHYA 5FO1A 1N9GA 4AMVA 3GC6A 1LC0A 1L5MA 2IELA 3GWZA 4AO6A 2XB2A 2EKQA 3QVVA 5BQOA 2ZP1A 2OR3A 1Y6GA 2GZ1A 4G8BA 3LY7A 3PXXA 4N8SA 5CYGA 4X63A 4CHTA 2PX3A 5E4JA 1UJBA 3FIJA 2AKEA 4L57A 4N7JA 4GL2A 1VBMA 2X42A 4N7RA 3ZE6A 3EF1A 1EEHA 1E4OA 1P9OA 1REQA 3G9XA 4MUXA 2WLTA 4OKIA 4ZDJA 4IMJB 2O8EB 2JGDB 1YS1X 4HVLA 2HRCA 3GJ6A 5BVGB 2PT7A 3BFVA 3R3ZA 3LPNA 2ZQ5A 1IXYA 1ZEJA 1X7ZB 2IEAA 4BGEA 1EWKA 1K1EA 2Z6VA 2BIFA 2JHGA 3HFRA 3Q0IA 1J2UA 4WTOA 5D3KA 1IG0A 4BZPA 4YAGA 3ESQA 3OZBA 1P2FA 3M4JA 1ZVQA 4J4TA 4ILKA 5TJ9A 1U7HA 2WPNA 4MUBA 3W1VA 2RKOA 2W5UA 3BWBA 3AU8A 4TXLA 4TWAA 5C1DA 2GK6A 1P9NA 3NIBA 4Q4DA 4DM7A 5JAPA 1YZVA 2XUQA 4BP9A 2PMKA 1MO5A 2F17A 1QF7A 2O2XA 3IJRA 1LVGA 3LCJA 4G67A 1J24A 1D07A 2B30A 3AVQA 4ZO7A 4MV6A 4Q03A 3CUTA 4XASA 4YP0A 3WFIA 1ELOA 1DVRA 3SYRA 3RVNA 3WWPA 3ZHBA 4HTFA 1VMDA 2QQFA 5TS3A 4ZJPA 4XLZA 2D13A 2YXDA 4LF9B 2VJDA 1FUYB 1T13A 3OOHA 2PMBA 4CL0A 3WS7A 1QH0A 3KWLA 4L78A 3S0JA 1FOEB 2GJ8A 1CQPA 3MGAA 2V6MA 1E20A 1JFSA 5JDIC 9GPBA 1KIFA 5D7BA 1NOIA 2WC1A 2H7XA 3EVEA 4S3MA 3PGVA 3DO6A 3R20A 4WBNB 1EQ2A 2HMAA 4L9WA 5G4KB 3KFVA 4J7AA 5CB4B 1X7HA 2ZS9A 3IXMA 4NZNA 3A6LA 3AIOA 2QVCA 4KPUB 1YZKA 2HW8A 4Q01A 1YF3A 2IP4A 1T2DA 4XQEA 1LGYA 1HE8B 2EBFX 4HXYA 2IS1A 3DMNA 4U7DA 2HNAA 1GG9A 4QGGA 4PGMA 2VJBA 2QZJA 3A11A 1NR5A 5FI3A 1GPBA 4ZI7A 2ZUWA 4ZV4A 4GLLA 3RC3A 4FD3A 1FFCA 3AY6A 3PHBE 2R65A 3V8EA 4IH9A 4EUHA 3OFNA 1UMDA 5KYVA 7GPBA 4YJ3B 3OZEA 4NE2A 4M9SA 3DHWC 5HM6A 2YHBA 4U2FA 4QL3A 3GN2A 1CZNA 4JC4A 4B1FA 5I01A 2MCFA 4NEQA 3DW1X 4F1KA 2IXTA 1UJCA 2Q3MA 2ATXA 4ME6A 2VSXA 1Y8QA 2ZR8A 4OH7A 4RDIA 1XMPA 3KKPA 1IJFA 1QWSA 2B83A 1KQGA 2QRHA 1JEYA 3X2SA 3ZQKA 1U90A 4LF8B 2WYWA 1MN6A 2PVCA 2AZMA 1G5QA 1ZJZA 1XMJA 4CCAA 1BWPA 3ANXA 3SJCA 2NV0A 4DR7B 4EA7A 2N75A 2RIPA 4MQUA 4BNLA 1LJLA 3I6YA 3NM5A 2Q2WA 1EVLA 5ED0A 3I1IA 5ABPA 4Y6RA 1U9YA 1XGKA 1YKGA 1YJ5A 3EXHB 1XQWA 2V59A 4LC0A 4KIGA 4ZQBA 3N59A 3N2NA 3WMGA 1QK5A 4GXTA 3CB2A 1UAYA 1X8JA 1L4HA 1YKFA 1ISFA 1OT5A 1W0KD 2CVPA 1GAEO 3EZLA 5ARBA 1EP2B 4YQFA 2VK4A 5FPTA 5DM1A 3MELA 1OLUB 2V8OA 3OPYA 5FTMA 3WA7A 4MPDA 4JI6B 3AFMA 2YN0A 3KKNA 2P5TB 3KKZA 2COEA 2WLSA 2QRLA 3ETNA 1TO1E 2O6LA 1GYQA 5JCJA 1YJXA 1RQNA 4ZZ2A 2Q07A 2PD3A 3RKSA 4A8JA 4W6ZA 1SVWA 1KZ4A 1X2BA 2XSZA 3AR7A 5IXSA 3KQHA 3PSAA 2RHHA 4UBJA 1BQ4A 2EIHA 3FCAA 3JATB 4QPCA 4Y0VA 4FWIB 1D0SA 4LSMA 2C5HA 3IBSA 1OTYA 4WNAA 4L0MA 3BN3A 3RVRA 1IEXA 3HKBA 3EMDA 1JAXA 5EWLA 2NTEA 1L5SA 4CM9D 2Z2JA 3GG2A 1OHHD 3RQSA 3Q40A 4B9EA 4RNCA 4EKGA 3A6FA 1XALA 4E08A 1VCNA 5JFGA 1F20A 3LZ6A 5H4HA 3TLGB 5D87A 4F4CA 2GX6A 1XDUA 4Z9YA 5EP4A 4DIFA 4O4JF 2AUMA 4D9BA 4TTIA 1E9CA 4W7SA 2BLLA 4ERXA 2VNHA 2H52A 2XMGA 4MP3A 3IKJA 4HWSA 4J0QA 2BGRA 4NTZA 2ILVA 4OHPA 3GFBA 3BCUA 1GY8A 2WJIA 4D8UA 4B3HA 3G5LA </