4CNQA

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 85
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cnqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cnqA01
3U7GA 1ZD4A 4I9FA 4DWOA 4NAVA 2YJ6A 2I55A 2HOQA 5AESA 4Y2XA 4XOUA 5AI9A 1ZJJA 1Z4OA 1Y8AA 3QUBA 2YBDA 3DV9A 3WK8A 2GFHA 4KX3A 5AKHA 1Z4IA 2YY6A 2YN4A 5AM2A 5ALWA 4IFTA 3BWVA 3NIWA 4EX7A 1RRCA 3D6JA 3ED5A 4DW8A 1F5SA 3U7EB 3OTQA 3ZW7A 2I6XA 1JUDA 2HF7A 1TA0A 2PR7A 2B8EA 2I34A 2HCFA 1WPGA 2P9JA 4L6AA 2C9MA 5AKZA 4HYTA 5AW6A 1Z5GA 3ZVLA 1Z4NA 5AKIA 4RESA 3L0BA 1T9ZA 3ZX4A 5ALDA 3S6JA 5IT0A 3MC1A 2WF8A 2NO5A 2ZG6A 2EARA 4UMVA 4BBJA 3AR2A 1NNLA 4XPZA 2MU2A 5AW2A 4BX2A 2JAOA 2WF7A 4NWIA 2DQSA 2W4MA 3M1YA 3N8GA 2YMPA 3RFUA 3FVVA 1KYTA 3WK5A 1ZD5A 2B30A 2G80A 2RBKA 2WF9A 3PGVA 5AW3A 2GO7A 3E84A 3ONNA 1ZOLA 2FDRA 3U13A 4FYPA 2WFAA 5AVUA 4G63A 2G09A 5AI0A 2AH5A 3HLTA 3MMZA 3U26A 5ALSA 1O08A 2CFTA 3NUQA 3QU9A 3ZX5A 4Y2YA 5IT4A 4OHFA 4BX3A 3L7YA 5AVVA 1Z4PX 2OYCA 2OBBA 4Y2VA 1ZS9A 5AVXA 3NAMA 2AMYA 2WF5A 1RKUA 2G0AA 5ALTA 2NO4A 3QU5A 5AI5A 3AR4A 1IWOA 2C8LA 3N1UA 3ZTWA 3OCUA 3KOOA 1L8LA 2FPXA 3QU4A 3L0YA 2RAVA 4YCMA 3L1UA 3WK6A 5ALYA 1RKQA 4YGYA 3SF0A 5T41A 4C4RA 3OPXA 3UMCA 4CF4A 4Y2PA 2NYVA 2RARA 4HGPA 3KD3A 4EX6A 2CN1A 2OM6A 3TLMA 3AR3A 3WK4A 3ZI4A 3I6BA 3PGLA 2YJ4A 2B0CA 3R09A 5AM4A 2EAUA 4MUMA 3F9RA 4NABA 4UM7A 3UMBA 5AVYA 5AI4A 3L8FA 4YH1A 4BX0A 1RLMA 1YNSA 4KNVA 3OCZA 1O03A 3SHQA 2B1RA 5AKKA 5AKGA 3ZWDA 1YMQA 1QQ5A 4BEVA 4UMDA 4BYGA 4C4TA 5AVZA 2B82A 3U7HB 3WGVA 2MSNA 3FM9A 2P27A 3QUQA 5AM0A 5AK6A 2ZBGA 3ZVNA 1FEZA 3QYPA 2YMMA 3IJ5A 2HDOA 5AK3A 2IOHA 3SD7A 4ZEXA 4MWOA 3ET4A 4UU0A 2C4NA 3DDHA 2IOFA 2IA5A 2G1AA 1Z4LA 1LTQA 1XPJA 3WK9A 1ZD2P 4BNDA 2IYEA 2ODAA 2BY4A 4FFDA 1Z4JA 5ALKA 5ALQA 1U7OA 5AW7A 1RKVA 3FPSA 4KN8A 3J7TA 5AW5A 4UW9A 3NALA 5ALRA 3UMGA 4BEWA 5AM3A 4UAUA 5ALMA 2B1QA 3IRUA 2HHLA 1YS9A 3QUCA 5AI6A 2W43A 3ZUPA 2AGVA 4HGQA 5AW1A 5AW9A 4UM5A 3B9BA 1VJRA 1WVIA 2YJ5A 4L57A 3E58A 3AR5A 3N5KA 2FPUA 5AVTA 3L5KA 4UARA 4BKMA 2O2XA 2BDUA 2R8ZA 4KX5A 4Y2UA 2G07A 3L0CA 4JDPA 1L7PA 3AR8A 5A3SA 5AW8A 2FI1A 1EK1A 1S8OA 1SU4A 5AK5A 4ZEWA 4OCZA 3QXGA 1CR6A 3I76A 3NASA 1NF2A 1Q91A 2ZXEA 3AR7A 3ET5A 1SWWA 2JARA 2ZOSA 1J8DA 1TE2A 5AKLA 3SLRA 5AK4A 4XE5A 1TJ5A 3L1VA 1QYIA 3P96A 3QNMA 3E81A 3NRJA 2WHEA 1T5SA 2EATA 4C4SA 2ZBEA 4YCLA 2I7DA 2FUCA 3RF6A 3EWIA 4CNQA 1YDFA 2Q4RA 3FZQA 2CFSA 2OA0A 3VAYA 2YJ3A 1QQ6A 4OFZA 4KYTA 4UU1A 3W5BA 5AIAA 5AW4A 3DNPA 1L7NA 1QQ7A 2O9JA 2IOFK 3W5AA 5AKEA 5JJBA 4I9GA 3KDPA 3L8EA 2WM8A 5ALJA 3FGOA 4EZEA 4XQ0A 2PKEA 3QU7A 1Q92A 3QX7A 2PQ0A 4YIHA 1L6RA 1YV9A 4O8CA 3WGUA 2I54A 1ZD3A 4NFLA 5AVSA 3PDWA 3ZWKA 3EF0A 4IG4A 4AS2A 1VFPA 3E8MA 2HX1A 5AIBA 3WK7A 5AVQA 4OD0A 2AUTA 1J97A 2G08A 3BA6A 3SMVA 4HGRA 4UASA 2I33A 5AM5A 4JB3A 5ALLA 3U19A 4CF3A 5IS2A 1RLOA 2QYHA 1RQLA 5AICA 5AM1A 3QUTA 4UMFA 1LVHA 2FUEA 5ALOA 2Q4TA 1VJ5A 1NRWA 2QLTA 2FPSA 2P69A 3WKEA 2RB5A 2P11A 4Y2SA 2YMQA 1CQZA 2C8KA 1RQNA 1Z4QA 1XP5A 3GYGA 2W11A 5A3RA 3ZTYA 2R8EA 4F71A 4Y2RA 3AR9A 4HGOA 2ZBDA 2WF6A 5AW0A 4QQFA 4J03A 4Y2TA 5AHXA 2HF2A 3W5CA 5ALHA 3L8GA 3W5DA 2R8XA 4GIBA 3A1EA 5ALEA 1X42A 3ZVMA 1RMQA 3SKYA 4UATA 4GXTA 2G06A 1S2OA 4Y2QA 1U02A 2FPWA 3EF1A 3M9LA 5E0OA 1WR8A 2Q5EA 3ZU6A 2VKQA 5ALNA 3I28A 3FPBA 3N07A 5FP0A 3AR6A 2HSZA 4KNWA 3QGMA 3KBBA 4EEKA 1ZRNA 3PCTA 4AP9A 3U7FB 3NANA 1U2TA 3MPOA 1Z88A 1RPZA 3OCYA 3DAOA 2C88A 1RC8A 3CNHA 4UMEA 1QH9A 1XVIA 5AKYA 5ALUA 1L7OA 1Z4MA 3CZ4A 1RMTA 5ALXA 4J2TA 2GMWA 1K1EA 2GHTA 3R4CA 3ESQA 5AKJA 3KC2A 1L7MA 3EPRA 2YFYA 1Z4KA 3K1ZA 4EENA 2MU1A 4QJBA 1AQ6A 2B8JA 2JGAA 5AVWA 2HO4A 4L6CA 5AKXA 2ZBFA 4CF5A 3N28A 5ALIA 5ALFA 2HI0A 3QU2A 4HAIA 2CFRA 4RETA 2BDEA 3A1CA 1Z5UA 1RLTA 3R9KA 1ZRMA 1WZCA 4Y3UA 2X4DA 3MN1A 3B8EA 2R8YA 4BNDB 3WKCA 4B6JA 1U2SA 5ALPA 1RMYA 4UAVA 4Y2JA 3WKAA 1SWVA 3I1YA 1U7PA 5A3QA 4YCNA 4G9BA 2FPRA 3QLEA 4EELA 3OCWA 4HGNA 3OCVA 1N9KA 1N8NA 4DFDA 1EK2A 3HYCA 4AS3A 4YIKA 3WKDA 5ALGA 2HEGA 3UM9A 3L8HA 4DCCA 2GHQA 5ALVA 3ESRA 1L8OA 2JAWA 4E88A 1RDFA 3IB6A 5AVRA 3KZXA 1MH9A 2YMLA 3OCXA 4FE3A 2JAUA 4PNHA 3WKBA 1PW5A 1TJ3A 2D2VA 1T5TA 4F72A 2FEAA 5ALZA 3SKXA 1TJ4A 4ZEVA 3A3YA 4NV0A 3A1DA 1YJ5A 5AI8A 3B9RA 4H1WA 4CE6A
chains in the Genus database with same CATH superfamily
3D7LA 1ZD4A 1Z38A 3CLUD 4G3XA 1EJ6A 2X8JA 3R3UA 1MHPA 2AUMA 2WVAA 3ILYA 2QTMA 3GLHB 1NWCA 2RI1A 2HOQA 2CMGA 3KSRA 3K5WA 2Q7XA 2FOLA 2PZKA 8ICEA 4OH7A 2YWEA 4RNCA 3REOA 4J9MA 1F6BA 3LT2A 2PQMA 4RENA 3PFFA 2OORC 3USES 1WXIA 5FTJA 1UZNA 4XYEA 4BRUA 4ZHQB 1WCIA 3AUUA 3Q9UA 1TL7C 1QB8A 4LDQA 4ZQEA 4KMRA 1Y88A 2DLNA 4ZYWA 4DCGA 1G60A 2XX3A 1UMCB 1PD1A 2RK6A 2LCQA 5ALWA 1P74A 1T2NA 1Y0BA 3OQMA 4RACA 2F3QA 2W2KA 1FJ2A 3F6EX 5FTMA 3RNOA 5T6BA 1OYYA 1Q50A 5EZ5A 2GN2A 3B5EA 5B3JA 3ZW7A 2VJ4A 1A97A 3HUUA 1MD9A 3HB0A 3O8NA 2XQFA 4XYMA 1WZ2A 3EHDA 1TA0A 2VA8A 2PR7A 5I7SA 3JPQA 1WPGA 3AHEA 2PWYA 4G5YA 3EBOA 1NBIA 1KIFA 3E82A 2YWRA 2XMRA 5FEMA 2HSDA 2ZWVA 3PDIA 1ILEA 2MAXA 4RESA 2IZ0A 2B9EA 4FGUA 4CIXA 5LWQA 2K4MA 3PD0A 5IT0A 1QSSA 3IIKA 4RY0A 4WT7A 2NO5A 1ULAA 1XHEA 4J2HA 5BSKA 1OB5A 1L5SA 3UB4A 4LZZA 4LSMA 3EPLA 3B89A 5CDFE 1TKBA 1NFQA 3DDUA 5ED0A 2QG4A 1SIOA 4TQSA 2H31A 4JBYA 2XMPA 2WQ7A 4UZFA 1KMNA 4CV3A 1AKQA 3SDBA 3SIWA 3KQMA 4BX2A 1OI3A 3WRVA 4ASUD 1VSVA 4DARA 4A8JB 4BV8A 3HUEA 4KUHA 4RVHA 4O4IF 3WNBA 1LC0A 1FXSA 1TT7A 4O4HF 2P9FA 2ZSFA 4IGIA 1RZRD 1U7TA 1UKAA 1OXKB 1Y8QA 3R0JA 2I4NA 3QEJA 5C1BA 1Y3FE 4RK4A 5FLKA 1DG3A 4F4KA 4QO7A 1BW9B 2LYBA 4I14A 1W25A 1D0SA 4GR9A 3HGQA 3N0VA 4MAFA 2PWBA 3D6HA 4MO2A 3KTOA 5F9HA 1M83A 1CE8A 2DWOA 4IS2A 3MRSA 3H9EO 3QPVA 1QNLA 4P5DA 1F8GA 3ZHSA 2A0WA 3K1TA 3ZK9A 3JD1A 4CCYA 1JE1A 1QIMA 1ZXLA 5HJ7A 2EP5A 4LY6A 3NBUA 2QTAA 3DMYA 1B14A 1NLMA 2YYYA 1Q8KA 5TMDA 3ZHOA 4C0BA 1UDAA 2JH7A 3IPXA 3JASA 4GSKA 3C8ZA 4BX3A 5JS6A 1XRNA 1IJFA 3PFBA 4FYMA 2WBLC 4D8XA 1OA1A 3DO6A 2H0QA 2VKTA 2QDXA 3T79A 3MCTA 4EYHB 4ZC8A 3LYAA 5DTJA 3KSZO 4JU8A 3RUAA 3TW8B 3QELA 4U1RA 1IUPA 4ECTA 2P6NA 2PKCA 3NNDA 4RD6A 3VBEA 1T5OA 1ZOOA 4CMIA 2LM4A 3HMKA 3FTFA 5ALTA 4RQ4A 1F9AA 1L4HA 2GLXA 2JJ2D 2OO5C 4JNCA 5BNFA 2X0FA 3WMXA 2HQ1A 3H7IA 3HWX1 3PDHA 3FOEC 4P2HA 1U7HA 5BQPA 5LXTF 1SVWA 5GTHU 5E4TA 1LY1A 5FWXB 3WWEA 2R5WA 1E2UA 1BG6A 2AMVA 4GT1A 2IY7A 5B1HA 1PUXA 2KWIA 1V25A 5KFWA 3UXPA 2QXTA 5LM3A 4D82A 1M33A 5A6VA 2CB0A 5C0OE 1FSZA 2F3RA 3KU1A 1WCWA 5JZSA 3F6YA 4QLOA 1MW8X 1J0CA 1Y7PA 3IT1A 4RA9A 3C74A 1DAOA 3JQBC 4NNOA 3KT6A 1CSEE 3U9LA 1OC4A 4MB6A 1W1IA 3WP1B 5CBPA 5IXSA 2XA2A 4JXXA 2H59A 1N6OA 5ECGC 5TT0A 1M6EX 5C4MA 1L9KA 2TYSB 4U9IS 1Y1KE 3FSRA 2Z08A 1M6NA 3Q0EA 4IIVA 4HPJB 3UAZA 2YJ4A 4F4HA 4HLCA 1E20A 3ZWNA 1ZQHA 1WEKA 3S8YA 5M2QA 3HJUA 1Q7CA 3IAAA 4MV8A 3T7DA 1C8KA 5JNSA 3UWSA 4MUMA 3SC2A 2ZR9A 1G6HA 3DFZA 5T8KC 1DGJA 1I4WA 4N7RA 4RZUA 4KMOB 1I7SB 5BT8A 4IOMA 5I51A 4MVJI 3JQDA 4I99A 4MSUA 1O03A 4Z9XA 1BXRA 2GM9A 3R75A 5K8CA 1EZ4A 3R24A 1LNSA 4XFJA 3O84A 1CRXA 2PJZA 4TTQA 1EM6A 1P6UA 1SBYA 3VPXA 5JAZA 3SEQA 4UNIA 2J0UB 2ZTUA 2I80A 3MJRA 4JVNA 1UMKA 1NK9A 2OVBA 3MLAA 4FC7A 5DN6A 5DOVA 1H6BA 1H2AS 4ND2A 1ISMA 4MKFA 2H08A 3TWOA 5CYGA 2CK3A 1U0SY 2V6JA 1LX6A 1YUNA 9ICXA 2PBZA 4O4LF 3QYPA 1RVDA 5K0SA 3WV5A 4ESEA 1FMFA 3AI3A 3O7MA 4G1CA 3SD7A 1NBHA 4UOQA 5M5BA 2O8CA 1GPNA 3ET4A 2X42A 4UU0A 4R6XA 1O9HA 5DI3A 4EEZA 5HG0A 2IP1A 3HB4X 2PL1A 2JA2A 3KPVA 3WGIA 4ZYZA 3RBAA 4H15A 1IIRA 3CRQA 5K4AA 3KXLA 1RAHA 1XAHA 3N59A 4WNAB 3OHMA 3S8MA 2Z2JA 3WK9A 1ZD2P 1ECBA 1K6JA 1QHSA 4FE4A 3PV8A 2YXNA 3KEQA 4U2EA 1KJ8A 4XVHA 1KAOA 1QH1A 2GAIA 4WZBE 1U7OA 5T4HA 5JYCA 4K0KB 3R41A 5K0EA 5IF3A 1F2VA 3EVNA 3JQEA 4FXOA 4UM8B 4WDQA 1LLQA 3NBAA 2ODEA 2NQ2C 3UPDA 5K3OA 3M8KA 4C8LA 1BVRA 1Y6FA 5CNIA 3RB6A 5EIHA 5GTDA 4LC1A 1IM4A 1BGXT 3BD9A 4JEMA 1KK0A 4MKIA 3LF2A 3DL7A 4C3OB 3PQ4A 2NVOA 2NVUA 9MHTA 2PX6A 3Q9LA 4BAZA 2F8MA 1L1EA 1HEYA 3W90A 3ALRA 4QT4A 2GH1A 3GV5B 1H6CA 5IC4A 1CYEA 3TDKA 1NZPA 4DSUA 3RFFA 4Z1MD 3M4YA 3P0RA 1OX6A 3F4BA 4UBKA 1SUDA 1FA9A 3VI4B 4CR7A 3HYNA 3PF9A 3GY0A 2A78A 3ZUGA 5FYQA 5IYZB 4XD7D 4ECZA 2C1ZA 2AJLI 3WL3A 5HHTA 4DUZB 3OWHA 3SC6A 1E1CA 2GJAA 1OXMA 1EHCA 2V7VA 3TZQA 4BNUA 3ZY5A 4ECQA 1MJNA 3TB4A 4U7CA 3DG9A 1CF9A 3BWMA 2G5TA 4P4PA 1GSHA 3GZJA 3P1JA 4O33A 4R63A 3FR8A 3JSXA 3MTQA 4KJXA 3GEEA 1ADJA 2MDTA 2YOHA 2IZ5A 1IH8A 4QUHA 4X8LA 5HP4A 2GM3A 4PHPA 1CULC 1XZMA 1L8AA 3W9BA 3WGMA 4YMUA 4IL6U 1E4EA 4DMFA 3Q85A 4WXHA 4YUZA 1T3QA 1YGYA 1LI4A 1Q91A 1VL5A 5L4NA 4DR1B 1FC0A 4CQMB 2WABA 1R8QA 1DLIA 3T5PA 1BDJA 1ZL2A 4MH0R 4YJKA 4E2YA 1OFHA 3LXUX 4ZKEA 5JUWA 1KYIA 1L5GB 1JDPA 3LP5A 2XNSA 2ZRMA 2KMDA 3UFBA 3OQNA 2M6RA 3UICA 5K2MA 4PHHA 4DN6A 4UPEA 5F3WB 5SYMA 4XCVA 4I19A 2H3IA 3TAPA 4ON9A 4B3XA 1FX1A 1K8RA 4CQLB 1ZD1A 5LMZA 1SCQA 3OFJA 3M34A 2JK0A 2B0JA 2R00C 5C8YB 4QZHA 4TTJA 4BQIA 2RDJA 1GAJA 2Y77A 1XXHA 4CKWB 4QHSA 4NZZA 3C5HA 4OQPA 4ED8A 2Q1YA 4MS1B 5J2GA 1S2NA 1NUAA 2B36A 3EIWA 4B2LA 5B2EA 2IT1A 2WTMA 4WXYB 3SPXA 1OLUB 2REQB 2YH2A 3EDRA 1JBEA 3GJ0A 3A1FA 4UDYX 4MLPA 3ZZ0A 3TGWA 5EJ5A 1KO7A 1GY8A 4HDOB 3M6MD 1JXOA 2IHUA 4HWTA 3H2SA 4QU5A 3EW9A 4K03A 3ZD9A 5T14A 4KI0A 5TPWB 2KBFA 2VQ6A 3I9KA 4A0FA 1T8EA 3EXEA 1F51E 1RE0A 3CH7A 2JFWA 1N63A 1N2EA 2C59A 3CWQA 2HL6A 4YVFA 3UUWA 3A3PA 1IB6A 1WNFA 3KTAB 4P7JA 2G77B 3AZOA 3E8MA 5G1NA 1W36C 1EWTA 3QYFA 3Q6MA 3BXEA 4PLCA 5GZ3A 3ZDDA 5TE9A 4KQWA 4UASA 3I8OA 4RF3A 3NDJA 3JATB 4EJSB 1VB5A 1TLTA 3WVNA 2JR5A 2IYNA 3E9EA 1DO2A 4TSFD 2C20A 3AYXB 3RAEC 1HNWB 2ZYRA 3WGLA 4BHTA 5H82A 1SXDA 1F1JA 2ONZA 4J9KA 5AM1A 3G13A 3P71T 3SMQA 4AYXA 4O3OA 1VDZA 3D2BA 1SBTA 1QLNA 4QXAA 3T41A 3UXOA 2ZXUA 7ICIA 2JLXA 2A6PA 2R6AA 1SZPA 3O91A 4OUDB 2R8RA 3JR7A 2QROA 4DE5A 1SBIA 3C5EA 1Q21A 3OU2A 1SV0C 1LJUA 4Y0AA 2JIOA 4DTIA 2YOFA 4PG4A 3VQTA 1QCZA 1T5BA 1T8UA 3B53X 3EAQA 4MV4A 4XR9A 1Z4QA 1UCVA 1OBCA 4HGOA 1RR6A 2W2VA 4PINA 3GG9A 2D0PB 4Z4GA 5L1IA 1U9ZA 2CF6A 1U3WA 2HV8A 2TSYB 3KALA 1BOOA 3KTFA 4L8FA 2QLBA 4JITA 4XJVA 1AF4A 1OOEA 5FJJA 5A9SB 3FZYA 1BCSA 1CERA 3LHKA 3AY7A 4M3NA 2G1JA 1P9LA 2P0AA 1QIEA 3KQYA 1V43A 4Q9JA 3RUPA 3VZCA 1G7CA 2QZPA 3DMTC 5EJAA 5IU6A 5JADA 2W22A 3HUFA 1ENOA 2RKOA 4NCBA 3PO4A 3JQQA 5LP6B 4GXTA 5DTMA 4NZOA 3AEUA 4LBVA 3SC2B 4B84A 3H19A 4DAEA 5HZHA 2HREA 1Q1GA 2WAXA 4HD8A 4BS9A 4EGSA 1U02A 1LEHA 3EF1A 4LNAA 2H1RA 1NY5A 3F9CA 3KKZA 3W7AA 2H3EA 1JFFB 1NN5A 9ICIA 3H1TA 4JASB 5KCMA 3PICA 4ZV4A 5JANA 4UTVA 1O4VA 1HYGA 1TM4E 2ORWA 2AC2A 3DQZA 3HKEB 3OLYA 5DSXA 4ZH4A 3KUDA 2J0EA 3N2KA 3OHSX 2R8BA 1C1HA 4QEKA 4DCSA 1POXA 3GH3A 3AR6A 4YCBA 5JW6A 5E6RA 1Y1TA 5LLTA 1QPZA 1QFSA 5F4ZA 1NJZA 3RSSA 2I9KA 1RRFA 5CRIA 2IPNA 4N82A 5G02A 3R6WA 2DWQA 4N7MA 1SPXA 3T1YB 3U60B 4IBOA 2FG6C 4DKJA 2YX8A 2QRKA 5GONF 3IQZA 1T4DA 2Z04A 3LI2A 1KZYC 2VXBA 3KJXA 4NICA 5DHFA 2W2MA 4DZRA 1U2TA 3RVKA 5JC1A 4Q66C 2OAGA 3C3AA 3PVSA 2X0RA 1FQOA 1SVNA 2C00A 3RVQA 1MJGA 1NRXA 2JL1A 4EOGA 1DCTA 1J09A 4EZ6A 1FPMA 1QLWA 2G6TA 3A4IA 3I1FA 4EH1A 1NN1A 3EDCA 1RMTA 3SIXA 4L0MA 4DLLA 5JNTA 5DVZA 4UXJA 1ZH6A 2K4IA 1GU1A 3R3WA 1EEXB 4PXSA 5BVGA 5F9MA 5JZ9A 3VX3A 4TV9F 2Q2VA 2I8AA 3S2IA 3AVQA 1E0AA 1DJMA 3K0HA 1NJGA 4J1QA 4MXDA 5J1TB 2BCEA 4AG5A 3HCBA 1EFPB 4I1OA 3ZEIA 2J87A 4BO8A 1QP4A 3LWLA 4C43A 2AN1A 4R66A 4YS6A 1NMSA 5DNDA 2C5BA 3VO1A 3ZHUA 5J43A 3ORFA 4IDPA 4DB4A 1PR5A 3FJYA 2RHFA 3O31A 2UVVA 2HO4A 4FB5A 2NXJA 5JDCA 1XYYA 4Y1GA 3SYZA 1KK2A 1W73A 2CK3D 3EDOA 3I5UA 4UVIA 3UKDA 3W8NA 4QJIA 5BOSA 5AP9A 2YC2C 3E9NA 3M70A 4X00A 2EGUA 4KAFA 2Q8NA 3DFUA 3JD4A 4X7PA 3TAUA 3QU2A 3H9UA 5A5EA 3TRKA 2TMDA 3A1CA 1AXEA 3BMCA 4OBXA 2WTBA 4WLFA 5BN4A 1NTRA 1ZXIA 2SKCA 1FNNA 4R5HA 1JEQA 1M2WA 1P73A 2BSXA 3W06A 2QTZA 1PEKE 5ITSA 5KQGA 4HS9A 1QGUA 1UP4A 7REQB 4YI3A 4C7JA 3C41J 3A4YA 5EVCA 1J2NA 3THWB 1Y5LA 4L85A 4YRTA 2ZTEA 3W79A 4V1CA 2HHAA 1GEGA 1ZQ1A 3CNEA 2RHHA 3K9FC 3V1MA 4C8KA 2XB9A 3TLZA 1I4OA 1U7PA 1VKJA 3PIRA 4F1JA 1Z0SA 3F3KA 2ZWPA 1JIHA 4AN0A 1ZOIA 2HSEA 3E48A 4B4DA 2R7MA 4Y18A 3G0DA 1D8LA 5DZSA 2NP6A 1UANA 4XI9A 1W88A 2PY6A 1UXKA 1I7LA 2EOAA 2IUTA 3D8HA 4MP6A 1NUPA 5LBTA 4ZWNA 4LJ4A 2IV2X 2VLIA 2GPWA 2VLBA 2ZSIA 3MSCA 2P6UA 3BMNB 3B3QA 4B9AA 1PWEA 1R12A 1KIAA 3QKSA 4H4CA 4I50B 3UC9A 5CVCA 2JLYA 4L4UA 2G7ZA 3UM9A 3AK4A 3IE0A 4K6FA 1MHTA 2GHQA 1YZ7A 5BSRA 1CKEA 1J99A 4KQJA 4RVFA 1RDFA 5IJ0A 2JCBA 3KZXA 4TL7A 3ZNOA 5C1DA 3G2NA 3VH3A 4RNOA 3OQBA 3K1YA 1JHUA 3B82A 3H5IA 1G5TA 3HJGA 4DRXA 2AR0A 2EIHA 4J91A 1IZ0A 1P29A 1P18A 1SZHA 2XI4A 3RU2A 2OHXA 4DAOA 5EYPA 4AW9A 4ZT7A 1WUIS 1IULA 4GYKA 5JNUA 1P39A 1H2BA 2PIAA 3BL8A 2DUMA 2XMZA 3FCSB 1ZINA 3JXEA 2D3DA 4OQLA 4WKGA 3L41A 2WWRA 1R5BA 1BN6A 2AHOB 2H6EA 3E22B 3MMXA 2WA1A 3KAPA 2IXEA 2QB0B 4R1TA 1FU7A 4RSMA 4Y0NA 3RSOA 2ZR8A 4W9RA 1JB9A 4KO2S 3SXUB 3SHFA 3T1HB 3WLRA 1O0BA 3IYLW 2X8AA 5CA1A 1ZZGA 5FNVB 2FUNB 3WBBA 1CDEA 3GZTB 3G1UA 3QPWA 3C4QA 4MR7B 4EITA 3GPCA 4NLKA 4YP9A 2CFIA 3A14A 4NBNA 1YU6A 4QGHA 1XZJA 2CXOA 1R8YA 4L7VA 5FULA 4JUFA 2GNPA 4N6OA 5JUMA 4RPCA 2J5XA 3GRAA 4DOCA 3ZXSA 4W7IA 5B1IA 4UB6U 5REQB 4DSJA 4V0MA 3LH5A 1KEUA 2C84A 3PWSA 4BWYA 3BAZA 1I94B 4PQEA 3R9XA 1QFMA 2FCRA 4CKCA 5CA0B 4QVKA 3OTQA 2OV8A 3NVAA 1V97A 3HQ4O 3LUBA 2VJAA 1TIKA 1WL8A 5K0ZA 4GBGA 2ZW9A 3ANNA 1KSJA 4JB8A 1UQUA 4A73A 2V0GA 1X77A 4AYBF 1NBME 2DWUA 1Z3CA 4RL4A 4LISA 3N7AA 4BWVA 1YS4A 1G7SA 3AFGA 4H31A 2WF8A 2NPIA 3K0FA 4DUGD 3E0XA 4P3OA 2OYYA 1EFPA 3FTCA 5ANRB 3RC9A 1UBLS 4L0QA 4QU9A 2C83A 1U81A 5KT4A 2CVZA 1WWKA 2IBMA 3MXOA 5BRNA 4HPWA 4B81A 1ITZA 1FTYA 1I4DD 1AXGA 1Z12A 4XGRA 4ETNA 4PVDA 4EKNB 1SFRA 1DXSA 1B8VA 4RPXA 5KG7A 1N6KA 1RRGA 1ZUNA 2ZJ7A 2ZSDA 1H2XA 1MX9A 4WINA 1NBOA 5EQDA 2R62A 4R7GA 3RVOA 5TDHA 3UHOA 4AP5A 1X0VA 2BFFB 1R0KA 3K9WA 5IIJA 3OO0A 3LYLA 4FJ1A 2Z5FA 1KORA 1QYDA 3GNLA 3LDFA 4Y9DA 3H6HA 4DZZA 3ZG6A 1JKMA 2ZRCA 1HPLA 2GO7A 1V16A 4PFSA 4X85A 4ECAA 4ARIA 1AZLA 1MOSA 3THRA 5B55A 3ESAA 1ZM7A 3BG5A 3LKBA 521PA 4MZDA 4KC0A 1RWNA 1F14A 3HLTA 4HX2A 1TK0A 4FSXA 4JZKA 3VKVA 3Q87B 5KT6A 3SR0A 4TQGA 4BLQA 5CK4A 3Q3EA 4GMFA 4PSAA 4IJ5A 3BA1A 1JRLA 4QARA 5BN5B 1ZQMA 4YRJA 1NMYA 1R64A 2QP4A 4KGZA 5MN5A 1R0WA 4QBHA 4NAUA 2PX4A 3EEIA 2CMDA 1SG0A 3FWNA 4BP9A 5IAAA 1TOAA 3GR6A 3I8SA 1RXUA 4OHFA 3WGTA 4ZZ3A 2VNJA 2IYLD 1YC5A 3OZAA 2GBIA 2FP3A 1EH5A 1YR7A 2IZ7A 3GROA 1XT6A 4OO1J 1RJDA 3C7AA 1C7IA 1KZ1A 4PO9A 1TJPB 3VKFA 2PUEA 2I03A 2V1XA 1Q1AA 1QHIA 5DKFA 2R6ZA 1OFVA 2NV2B 1OXXK 1P61B 3E3NA 2K8AA 1XVUA 4GX5A 2H2WA 2YTZA 2XNHA 3KOOA 5GOTA 2KHQA 4MUBA 5J8YC 1L8LA 1PEAA 5KYGA 1O4WA 1DIRA 2AZTA 2UZ1B 4LJAA 1VG1A 4Q03A 1ZW6A 3NDIA 3UOWA 1VOTA 1AKNA 3F7MA 3ZLTA 3FOCA 3BTOA 1GCUA 3PZRA 2VSNA 5T3UA 2A0XA 1T2AA 5T41A 2TMKA 3AM1A 3IVAA 5SZIA 1JSRA 1E9VA 5KS2A 3PX0A 3N0RA 2GERA 3FPFA 2RARA 3I4CA 1XMXA 2J5BA 3KD3A 3C3YA 3IQFA 3LCUA 3KQPA 3DVRX 4FFMA 4PG5A 4AG6A 5B3KA 1LDMA 3AKEA 2QSUA 4TWRA 4TV8B 2Y2UA 4UDXX 3SJBA 3W8RA 4CW7A 2VVTA 3I0MA 3T5CA 2R4UA 2FSHA 2N47A 4PXAA 2BCVA 4AQ7A 4FLMA 1K68A 2QYOA 4TPKA 5IDXA 4TMWA 1A2BA 4BNVA 3ZV5A 2LZ0A 1ADCA 4G4SO 4D96A 2EAUA 1NW7A 3O3NB 4KITB 4ZVKA 3A27A 5KZMB 2NXCA 1OVMA 3QVLA 4UM7A 3EF3A 3OE7A 1AMUA 2RKWA 2NUBA 5EJ7A 3M82A 4NULA 2MUTB 1SURA 3B12A 5BWNA 3F73A 4RY2A 2X9LA 2OO5A 2EX4A 1QV7A 1NR5A 4G85A 1YQEA 2Y0EA 2AN4A 1M0EA 4PY2A 3S2FA 3SHWA 1QQ5A 4BBPA 1EINA 1ZN7A 1E66A 4WSOA 2PO7A 3NHRA 2EBWA 4IKPA 5T5QA 4H77A 4DBLE 4PX3A 1Q14A 1E32A 2B82A 3PZBA 4G1MB 4WGGA 4B2IA 2E21A 2EWWA 5GADl 5AK6A 4XB1A 1OW5A 3A0HU 3GP5A 2Y1KA 4D9KA 1TMOA 2KJ8A 1XTKA 3WDSA 2YMMA 4LVSA 1DAIA 3RF9A 2BIFA 1O9GA 3HCAA 3KSAC 2BFDB 2IOHA 5AHKA 4BE4A 4MWOA 5LWHA 3E5RA 4QUAA 5HJ5A 2WWXA 5HKLA 3U7QA 3HL0A 3TNLA 3AVOA 4BX8A 4DCUA 3DHVA 4XCQA 2JZOA 1CLUA 3MGHA 2QRPA 1YVDA 4OH1A 3ZV7A 3QEBZ 5K3DA 4DSFA 2I5PO 3KKNA 1UFVA 2D1FA 2IYEA 3USZA 3VR2D 4D0NA 4NIMA 3I5YA 1BW9A 2AFIB 3DCIA 4V0LA 1RKVA 4KN8A 4BNWA 4CKEB 4O5KA 1I5EA 2OCYC 3U17A 1AMOA 3L4KA 2X41A 4LYAA 2GF2A 1QYRA 4EGCB 2J46A 1FB5A 1TFUA 1CE8B 2Q1WA 1E1RD 4C9BA 1P7PA 1F1BA 4UAUA 3PC8A 4X0EA 3HHEA 3RG8A 9ABPA 1FFUA 3IRUA 1ZRHA 2XWJI 5IAKA 5CDUA 1O89A 3E7XA 2AWOA 2XT6A 3STTA 1MT0A 4G26A 5J2FA 5J2BA 2AGVA 4U7JA 3ER6A 1XNGA 2ES4A 4HZGA 1L6NA 1BDMA 1NVFA 2JCXA 3FG9A 3CLSC 1WVIA 3LS2A 3O1LA 4HQ0A 4HSGA 4KU4A 3UY4A 4AJLA 5J0WA 1N8KA 4DB2A 3AR5A 4DSOA 3A04A 3JQFC 9ICTA 1NYQA 3B78A 3K70B 1N5OX 2MSDB 4BQSA 4ENWA 2VF4X 3DAHA 4MW9A 4DDTA 5LNK6 3LO5A 4FGWA 5IZ4A 1WXFA 3FNIA 1V8BA 5A0TA 4NNPA 3GUZA 1NMEA 2AK3A 3GLGE 1DIAA 5IPFA 1QAOA 4X20A 3NC1C 5T7BA 1UBFA 4MLZA 1Z08A 3VR5A 5JBNA 5JEDA 5KX5F 4G84A 3ER9A 4TROA 4B8WA 1IN4A 1PUZA 3GVCA 3T5DA 1L7PA 1NP3A 3R5SA 3TW0A 4HVLA 5HOQA 5LQMA 4CDGA 5KOJB 3HILA 3NATA 3UJPA 2FQYA 3Q40A 1YWGO 1ZA2A 2ILVA 3LT5A 5EUMA 1RPTA 4Z7OB 1NVVR 2HOFA 2E5SA 4H7IA 4RNMA 4A8HA 5ITVA 1GRNA 1KVQA 1LSUA 2BBTA 2X3YA 4G5QA 4UXHA 3SEZA 3BBLA 1Q95A 3DS8A 3NRCA 4XTCS 2VHJA 5CPBA 4EFNA 1CUHA 4NVRA 4YMSA 3H9BA 3S55A 3OX4A 1J8DA 1X1AA 4J0EA 5AKLA 1Y4SA 2A1TR 2P6MA 4GC9A 3OFNA 3LIIA 1PR3A 5HCUA 4IM7A 3B6JA 5J40A 4CV0A 5C2JB 1QG6A 3DW1X 4HFRA 5FOUA 2OH2A 3BMXA 3KXDA 3MGAA 4EG0A 2K8CB 1ESNA 2OVFA 4JLWA 3LX6A 4L8YA 4C4SA 1IXSB 3K2EA 1HL3A 1ODIA 2PLRA 1WBDA 1DAGA 4M36A 2YZNA 2D1TA 3DQQA 3U7JA 5DG7A 1KQGA 1H1LB 2DFNA 3WWOA 4H0NA 4OFZA 5DV9A 1A8PA 2NU9A 4I2HA 2X2PA 3GPDG 5BPHA 1GKUB 2VYND 3CUUA 4LECA 1L7NA 3GNTA 4FYXA 4QRIA 2RGWA 4J6EA 1U2PA 5IZCC 4M0AA 1UOQA 4LHYA 3N2EA 4F21A 5LU9A 2OHVA 2RHTA 3B0YA 1X14A 3KS9A 3M2TA 4RIEA 5ALJA 2EZXA 2JJYA 5G0TA 4EL0A 2XMSA 5DEOA 4FHEA 1IN6A 1LW7A 3ZK7A 2V7PA 2VTDA 1BROA 4O02B 5JPDA 4DL9A 1Q74A 3ZWWA 3ZWKA 3TF5A 1PNVA 4YV1A 3C0KA 5JQWA 5EJ4A 2FW0A 4RMIA 5D7NA 1GO3F 1K4YA 2OYRA 1H9AA 3LUKA 1W0JD 1NVTA 2WPNA 3E05A 3WK7A 5DNEA 5BN4B 5J4YA 1AV6A 1ZJWA 3ETHA 5DBGA 1J06A 3HTXA 3SMVA 2P75A 2A1JB 3N7PD 1HDZA 1RHJA 5IKPA 2A1TS 1FNSA 5KFMA 1TM2A 3OZBA 2G25A 4K87A 4O6VA 2UXBB 1LTHR 1WU8A 1NRIA 4CCHA 5JNRA 1NF3A 3PGJA 4ZQBA 1E79A 1P7YA 1RI1A 4D4MA 2IBTA 2AQKA 3W6NA 2I66A 2P8SA 2XZTA 3LA6A 4QIWC 3UB2A 3N2LA 4A03A 2F8KA 2ZK7A 4Q4AA 4RVUA 1ZH2A 2ID8A 2GTPA 4PFJA 1LF0A 3HRDD 2QQEA 2PUVA 1M3SA 4HVAA 4YUVA 3ITKA 2BWJA 4P82A 4I2BA 4MFCA 1WPRA 5H0IA 3EUWA 2VH1A 4IX1A 1RNLA 4DV2B 1F3LA 1TQ8A 3C39A 4G1FA 4IGAA 1XP5A 4I2EA 5EGSA 3A1SA 4LI0A 2P2ZA 4RGQA 3ASYA 1BKDR 4E3WA 3CYMA 3CZMA 3MCWA 1QP0A 2GQ0A 2ZBDA 1UWKA 2FPIA 3G2OA 4Q3AA 2HPHA 4A8PA 1VL1A 2JNWA 3OSPA 1XZQA 4EGFA 5SYAA 1URJA 3OICA 3A3KA 4JVOA 2Q5LA 1E0KA 3L8GA 4JI7B 2ZRFA 2VZ9A 1VHTA 1YS2X 1LBHA 5EMLA 5I9TA 5A1JA 4OX9Y 2DFVA 2AL7A 1T1JA 5KHOC 4NFSA 4ZOQI 2GF9A 1QP7A 1L5RA 3C1YA 4NLBA 2EFCB 3HCOA 4BPRA 4ED6A 1P7ZA 3D9QX 3EY9A 3HJAA 1DZIA 1PZNA 4MIEA 4OKSA 5AYVA 3W2FA 4TLCA 5T6MA 4ZMSA 3Q3IA 4GNRA 1YJQA 5CFLA 4MR8B 2ACEA 2CUZA 4WZBA 4LDRA 2J6CA 3IAS1 3VTZA 4CQMA 4DV1B 1UJBA 2OFWA 1G8SA 4D25A 2A84A 2ZYTX 2I7CA 2P7HA 4XQGA 5C18A 2VP0A 3KVRA 1IAQA 3VYWA 1J1ZA 1W0CA 1F2UB 1ZW1A 4U2GA 2W71A 4KNWA 1JZTA 1JYSA 3DTVA 4G5RA 4P7FA 4AZWA 5K45A 2UYCA 2GK7A 2A67A 1YBVA 4CLOA 2P65A 1RJEA 1H93A 1M0TA 3BIJA 2P4HX 3S4YA 3GP8A 3EQ2A 4JLOA 1X7XB 2VWHA 4AP9A 4ZU1X 1O97D 2JGMA 5IIIA 3CEJA 1Y9JA 2O2SA 1KFSA 4CM8B 2I2CA 4ZEOA 2RGXA 4JX8A 1ONOA 4FO6A 3IEKA 2BHSA 1KVRA 2ZR0A 1AKRA 4PZZA 3EC2A 3CNHA 1F8XA 5L95A 1XA0A 1KP3A 4P2BA 4ENVA 1TC2A 2Z09A 1LBQA 1YR8A 2XGSA 3LK7A 1N2CB 1PHPA 4GYYA 4ZAWA 3U39A 2XOXA 2ZUCA 3H86A 3EPKA 2UXDB 5F2EA 4LVNA 3FCXA 3HLYA 1II8A 1PDVA 1V7CA 3QV2A 4Z6EA 1UDCA 4DWWA 3NV7A 1Q3HA 2ODQA 1QK3A 4TXHA 4EFKA 3U4MA 3L4PA 1OU4A 4CCAA 2DF8A 1SQ5A 1ODSA 9GPBA 3D6FA 1Q0HA 1DKUA 2F1OA 1WUKS 4Q5IA 3LZCA 4K9NA 3VH2A 3ZV3A 1P8AA 2XD9A 4K9OA 5AKXA 3GEIA 1TQ6A 3H1GA 7ICKA 1U2GA 2WSYB 2CXNA 3GGOA 3LUGA 1FU8A 1JPUA 4FYYA 2DTXA 4Z7JA 4NZNA 4QWBA 2RBEA 5KG2A 4BDPA 3T34A 2OT3B 4EMBA 2HI0A 5KT5A 1Z22A 2IYYA 3JWEA 1BO6A 3H1FA 3QVUA 1ZN2A 3AKCA 3Q98A 5TVGA 2D06A 4P3YA 1WP9A 4PAMA 4ARAA 4AU1A 4BFVA 5IFLA 7GPBA 2ZRLA 4YPVA 2OGZA 4NBWA 4BLOA 3PW0A 1L3VA 2EXXA 2GM5A 3SHOA 4MUIA 1LPNA 2VOJA 3PVZA 5EKUA 3EXAA 4NJEA 4BYMA 1T35A 3N97B 2VQ3A 5J0TA 4NENA 3BS4A 2WUEA 4WECA 3UV3A 1N32B 2D1QA 1NFFA 1M34B 2HU2A 3ZZ1A 5EWJB 4KLGA 1FTNA 1GPJA 2KKVA 4RTPA 2AJDA 3BF8A 2PL3A 4LK2A 5M7EA 2C31A 2P66A 2WVJA 2ZBVA 4TKVB 4R54A 1GNRA 1WCYA 1YZHA 1TKCA 3RJ5A 2NU8A 1O9BA 3VUEA 4J3NA 4AO6A 4DMCA 4IHKA 1E2LA 4ZOLB 3KETA 2QV0A 3WL5A 1GAWA 1XXLA 2EBFX 4B2PA 4UPDA 5ENZA 1DLJA 2UVDA 2XNDD 5CDSA 4FDLA 5LDDC 4PANA 2QMUA 3KL2A 5KPJA 3GRYA 3L1IA 4FOTA 3M6XA 2FZVA 1AXRA 1DQYA 5KFAA 5ALGA 5L45A 4WLUA 4S0XA 4JBWA 1D7OA 5CR0A 3OOWA 4XPIA 4YGXB 4F9EA 3MOSA 1XRMA 4LUCA 2KYRA 1KI1A 1QGED 2FSFA 4KQKA 2C77A 5L1JA 1EFLA 1MZVA 3EA4A 3PGXA 4J8PA 3OH8A 5GV7A 3BWEA 3VDXA 3H16A 4EW1A 4FFBB 1X1EA 2BFNA 1MH9A 5C31A 4C0XA 3UPUA 4C7OB 4FE3A 1X39A 4JB2A 4YI5A 2EBUA 1G8PA 4IQ4A 4TWBA 5JV5A 3EJWA 3EPGA 4QZ9A 2Q27A 4MWDA 1IXYA 1CDOA 1C9JA 4WTOA 2FEAA 2GPSA 2ZTSA 5IUJC 1QPBA 4K40A 3BGSA 4NV0A 1GDHA 4ZEVA 4DLNA 2GEJA 4MWSA 2P3QA 4B8ZA 2AGOA 3KYCB 5J59A 4RORA 3V2IA 4X6LA 1OYWA 3VV2A 3K4HA 1V39A 3KQQA 3HADA 3MRVA 1GVNB 2IPLA 3OZ7A 1T94A 1MNAA 1AQJA 1G63A 4DRYA 1U9LA 4OQXA 3WSTA 1XKLA 1L3IA 4WFJA 4XEUA 3X1ZA 1S7GA 1DV1A 1N8TA 3DDWA 3IGFA 4I3FA 4M22A 3SS9X 3FTEA 3DOUA 5BSWA 1J90A 3ZCVA 1ZUD1 1S96A 2AQ0A 1QZTA 1Y1PA 4ALJA 2QMOA 2XCSB 2HYIC 3PRJA 5DYIA 1DBWA 3MIIA 1R4NB 4J9VA 5AM2A 2Y6UA 1SG6A 2CNWD 4Z99A 2CLSA 2YFKA 4CTOA 1RJWA 4WE3A 2UUAB 2C2OA 4JU9A 2X5KO 5T4BA 4F5QA 1UJNA 2O8FB 1GAXA 1AO3A 4DW8A 4Z3KA 2GN1A 1XQXA 2AOUB 1GTMA 4PRZA 1BMTA 3AG5A 3FPHA 2JGNA 2QN3A 3OPYB 4QPPA 5BR8B 4B83A 3I9NA 1H23A 2AXEA 2VPWA 3CNLA 2HCFA 3PS9A 4KGVA 1FRQA 5D86A 3T5GA 6GPBA 2HGSA 2J5RA 3E3MA 3ITNA 1JILA 1Z5GA 1RWKA 2MINA 1FQWA 4L7QA 3QWHA 5NLLA 1ZJ4A 2J0UA 4UE6A 2ONJA 1FNBA 1IHOA 2FWAA 3MA0A 1OX5A 4M8IA 3FRIA 3QSGA 1W59A 2C5AA 4BGEA 3CE9A 4RSHA 4BBJA 3PQ2A 1RAEA 4A6DA 4V24A 1XNJA 3GLHE 1JBQA 2EBHX 4GL2A 2IFTA 3NHKA 1MEEA 4YLEA 3JQ8B 4F84A 3ADDA 3THXB 2AFRA 4JGGA 2REOA 4TTRA 4ZV7A 2BGMA 3E4DA 4YAUA 2G9RA 2KFNA 4EO4A 4IHJA 4EHFA 4DBLC 3H04A 1JDBB 4AD8A 4HTFA 3RJEA 1I3KA 3QWAA 1RIIA 2NLOA 3AHHA 3DLPX 3MLBA 3OFVA 1YZUA 3UT0A 1P9WA 2Y66A 3VR4H 5JISA 3ST7A 2WF9A 3JWGA 3MGCA 2XIDA 3ADPA 3N7UA 5AW3A 3AEYA 2OFOA 1SJ9A 4CKBB 1ZEJA 5J0SA 1K3TA 2C4KA 2Q6IA 3DEJA 3KQWA 2R00A 3LUJA 2JFYA 5BNZA 2VJLA 3T0FA 4COOA 4G63A 3T7JA 4JYCA 4MEJA 4F0JA 2CUNA 2LPMA 3H3FA 5HUHA 2WWTA 3DULA 2J07A 1I24A 2NV6A 1ZGAA 1ZJYA 5F12A 3VPCA 2B34A 2XQGA 3TZKA 3BKWA 2HHQA 3ADBA 1UAGA 1N0HA 4R4JA 1LV7A 2C2MA 3QKSB 5LUAA 5JSYA 2CRXA 1Y7HA 5H3HA 4LBWA 3TNJA 3O26A 1M6HA 3VZPA 4ARBA 4AWXA 3B3FA 1V8FA 3DGFC 4ZRMA 5ITWA 3KEOA 4OHYA 1LPAB 1OAAA 3L7MA 2OYCA 4AJNA 2PI5A 2HBKA 4X44A 3ZU2A 5IYZA 3PJEA 4FR2A 2CLOB 3RUEA 3EVEA 1DDGA 4LW8A 3SLKA 3OX2A 3H9QA 3R6DA 4RIIA 1LBEA 2Q0XA 1AZSC 2JFZA 2QN1A 2EAPA 1XQ1A 3I52A 3PGA1 4UREA 3DM9B 4D41A 2LHTA 4M47A 4G65A 4K6HA 1FUUA 3D54D 3M8RA 3JWHA 3NBKA 4P36A 3H17A 2W3SA 1C7JA 2CCGA 4BVFA 3QU4A 1W44A 3GJSA 1O57A 2ZWIA 4WK2B 5DHAA 4HUQB 4USAA 2AZXA 1EDDA 3CE6A 1YAJA 3M6WA 4WPGA 4IVPA 1PJAA 2V3WA 4DM7A 3ZDXB 4DOAA 4C4RA 4GPIB 1DDOA 1IRXA 2JJQA 2W54A 2V03A 3AVWA 3F2DA 4Y2PA 1I7PA 2EX0A 2XB8A 2XUPA 3BXPA 3KZNA 3PR2B 3EA0A 4KBGA 4EJFA 1T9AA 2WFMA 1AK1A 5E3IA 2FPPA 3VU9A 1CJSA 4ZVOA 2ALZA 3THYA 2AQIA 2BM8A 1OJ7A 1AB6A 1JDSA 3SI8A 5CDGA 5L6LB 5C5JA 1WHSB 1JR3D 4C7YA 4YCJA 3G23A 2NSDA 1DNPA 3DEEA 4YXWD 2QZSA 1R5JA 1EWVA 2XOKD 2N46A 2RAUA 3ETGA 4O2BF 5CVVA 5THQA 2OFPA 3QVMA 1OXBB 1W4CA 3DD1A 2JD1A 3FHCB 2OBYA 3RH4A 5FPHA 3ZGXA 1X7ZA 2E4ZA 1COOA 1SC1A 2A59A 1L4GA 3E8SA 2HMUA 2IU4A 1XKXA 3Q15C 3QLVC 1RCFA 4MEAA 5ETJA 1T9HA 5AKGA 3PMLA 1P2TA 4UTRA 4TMZA 1K7CA 3BJMA 4HQNA 621PA 2AOUA 4DV5B 3HO8A 4P5PA 1QKKA 2WIJA 4M37A 2NUTB 3B5JA 4GICA 2IVZA 3M5CA 4D02A 4C2BA 4KO8A 5LIPA 1B26A 3EXHB 3N9IA 1Q0SA 2CDNA 3ERCA 3VO2A 1QVRA 3D6NB 5CLGA 2YOGA 5WRFA 3UPTA 2N1RA 3VZBA 3D1LA 5JZOA 3D4NA 2WYUA 3X2FA 4UQOA 2C9DA 1RD4A 1MTZA 2VJDA 3IJ5A 4FDMA 4FUQA 4ITUA 5DTRA 1PSDA 2QE6A 4XJSA 3V7WA 3QXHA 1T3ZA 1U0TA 2PLAA 4RK1A 3NX4A 1ZR2A 3RKRA 2HJSA 2YNMC 3WG9A 4OLFA 2WZQA 4O2BB 3AT1A 4OAOA 4U7TB 4N5NA 3PEYA 2FOXA 1NJSA 1P2UA 1YQGA 4BO1A 2X8LA 3PXGA 1NN3A 3MWYW 4PRLA 1HUQA 4RM3A 2EYQA 1DO8A 5K4GA 3TGPA 3FWHA 1V8ZA 2QOEA 2WEKA 3BFKA 3TAXA 4V0ME 3BYZA 4IQVA 1CJUC 3NHYA 2JAPA 2R8GA 2PS0A 3MXTA 4I1YA 3ZYZA 1NKCA 1RYZA 2R751 3G85A 4HAXA 1W9MA 3G79A 4OMUA 5E7JA 2ATEA 2MTBA 1H1TA 3AX6A 3C24A 3S7TA 1OLXB 2O8NA 4JWNA 3QTBA 4U7HA 5KOYA 3EPHA 3HRIA 2FZGA 4IINA 5LB4A 1XDDA 2ZRIA 3I2KA 4QFCA 2W6JA 1Q0PA 1SQSA 4PHFA 4URYR 4WASA 1PK7A 3PNMA 2OAQ1 4OGWA 3KVVA 4R0NA 5IG2A 2AKAB 2J3QA 3ONDA 1DTWB 3M3DA 3O8DA 4DHEA 3NHPA 4HVTA 4NQZA 5BORA 1KQFA 3T54A 5IUKC 3AC0A 3FNHA 1H6DA 4UE3S 4B6FA 4Z4EA 4C5BA 5DM1A 2FSGA 3HB7A 4QWMA 3LZ6A 3E9MA 1LV8A 3LCMA 4UTXA 3JYLA 1KDVA 4UBIA 3UBTA 2HA6A 2H5JA 4HDSA 4DT1A 1YBFA 4KX5A 3ZI0A 1L5NA 5CIYA 1U4NA 2WAOA 3NBFA 4CM1A 2EQBA 2NAFA 3S5JA 3DZCA 1E89A 2IXGA 1A95A 2ISQA 2G70A 4UAWA 1QAQA 1TM3E 1USGA 3KB2A 5GV8A 3SE7A 4CL0A 1N77A 1XDWA 3PYXA 1NNSA 1QCKA 1RBMA 1ZVMA 1DEKA 2FVYA 2IP2A 3IKJA 1CUYA 3K1JA 3QXGA 2CVQA 4OJ6A 2W6IA 2XKJE 3BIOA 4IIJF 4RAOA 5FV7A 5GIOE 5M3BA 4Z86A 3HFRA 1M54A 2BSAA 4GVXA 2VZLA 3AUKA 1AIPA 3CIFA 2XTZA 4PL1A 2Z8ZA 4QOJA 5F35A 2FMUA 2Z9DA 1JHPA 3ORRA 4FFWA 4N3CA 5J9FA 2IX3A 4M2LA 4IIBA 1OXVA 4EHJA 3T1TA 1H69A 1TZMA 1QYIA 3NRJA 2YYAA 1KLNA 2YIVX 1CNFA 1XC9A 1H2FA 1W5EA 4NMHA 4ZAYA 3PSIA 4B9NA 4L72A 3KJHA 1JLRA 3QXSA 5EKXA 3CBGA 5T64A 3JAKA 3WYNA 5KNIA 1M6VA 2A1AA 4LEIA 2A8YA 4RC9A 4IR1A 2WT8A 5EWLB 3NP7A 2D54A 3LL4A 3ENVA 1GP2A 5KFTA 4CIVA 5IP5A 2V1UA 3V9PA 1II8B 2J7KA 4UU1A 4JQZA 4OREX 4JP8A 3PX3A 4IL5A 1HORA 3I0ZA 1XAJA 4I7EA 1K7XB 3SJZA 5E9QA 3T1QA 1KE1A 1JL3A 2AZDA 2IHVA 2R85A 3KX2A 1I2AA 4N0DA 2OESA 2PX0A 3C4JA 2E4VA 1A9OA 4RLHA 3NPMA 4TL8A 1RIFA 4IVRA 3CLRC 1P0FA 5IASA 2R6R1 4ZCQA 5I01A 3LT0A 4EUSA 2IUEA 4O8CA 4IWNA 1FMJA 2ZB8A 2FV8A 4EEXA 3K0EA 1M1XB 4P35A 3LVWA 1NQWA 3NBYC 4CL8A 3A10A 2ZYIA 5GGYA 3TX2A 1L4YA 1D2HA 1I1QB 2YRFA 3D1JA 5HSGA 2BMWA 5GM1A 4BFSA 3EIFA 3L8YA 4AJ4A 4XEHA 3LLCA 1VLVA 2ZROA 4KPFC 2J3MA 1P2SA 3N4MB 3CUYA 1WPQA 3GLUA 5HIIA 1GDDA 1RBZA 2R6GA 2ZTMA 1AJEA 1Z2DA 4UNSA 3NNNA 4Q16A 5EXSA 3HA2A 1RLOA 2TMYA 3LPCA 9ICGA 4YWJA 4CKEA 5IX8A 2DKXA 1RQLA 3R3HA 4G1BA 4HADA 4UC0A 1ZPDA 2XA1A 4OXYA 3UZUA 3C5GA 4DSZA 1JTEA 4IV8A 1E62A 5EJGA 1C8VB 3I34X 1UF9A 5HTOA 1PFGA 3KHUA 4LWQA 2NU8B 3WZLA 3THWA 4NONA 3GT7A 2OENG 4MGKR 4ED7A 2CL6X 5J2AA 1C3JA 4YP0A 1N4DA 5D1HA 4KSYA 5TJHA 3ZH2A 4LOIA 1MQ8B 3R5TA 3FR7A 1ZIYA 2WFZA 5B7QA 3WNVA 3EXG1 3RYFB 5JJIA 1KK1A 3RBEA 4M9JA 3DMGA 4LRQA 1TRHA 2Y1DA 4FGZA 4BLWA 2D6FA 2IY9A 4NG4A 2HJ9A 4R64A 3KPUA 1UDRA 5D3KA 4EVQA 1D4AA 1PK1B 3KZMA 3PNYA 4KLJA 1QG0A 2Y9PB 4H6WA 421PA 1N6LA 1JV2B 3DLIA 4X6UA 2Y68A 3QOFA 4HN9A 1MB0A 2RGEA 3MT9A 5BVHA 2VYCA 4IX9A 2FWNA 4HAWA 5LZ7A 3YASA 3A06A 4F06A 1QRSA 1AN0A 1B15A 1B8UA 3VU3A 2L42A 2XR1A 2KVSA 5EWMA 3A2NA 2NU6A 4I08A 3F5MA 1TYEB 3ORQA 3PNVA 4U0KA 1S1CA 2FW7A 1QRAA 1GZ4A 1OIWA 1PJBA 2WWGA 2E18A 3EBLA 3H5WA 1EVYA 2OXOA 1G1MA 1SVSA 1C8BA 1ZUWA 2KB0A 1I1OA 2NXWA 3QEMA 2X5NA 3IP3A 1C7RA 1NJ5A 1THMA 3IRVA 4PXYA 1Q15A 4R9NA 3B9QA 1KYVA 5C3UA 5CDYA 4LJXA 1G17A 3H0CA 3ZU6A 3TQTA 2KD1A 1V5GA 2BTQA 4IFIA 5TGZA 1Q77A 3THSA 2WHPA 3KPYA 1EJBA 9ICSA 4KR3A 1X3SA 1CUDA 1I4EB 2V74B 2XF2A 5FP0A 2QAIA 2CDRA 3C3WA 1ZICA 5DLFA 4C4OA 2VAPA 2FFBA 4MQEB 5TQVA 1E3WB 2KSQA 4JGBA 4UAZA 3UV7A 3BRWA 4NJMA 1OPRA 2IDKA 1I6LA 1NLYA 2D3WA 3FPEA 3OTHA 3W8FA 5BXQC 3KQLA 2OCBA 1PVQA 1Y8ZA 3DWEX 3AVPA 4MQFA 3B9JA 4WMLA 4POOA 1ZJMA 2RHGB 3KAKA 4AYTA 2IF0A 1Z2AA 1U5BA 3EDQA 3M4JA 4Z5XA 1N2IA 5G1PA 2QL9A 2C5LA 1P7WA 3CU5A 3KWMA 5FFFA 1T26A 1XVIA 3QQPA 1N62A 1O95A 2PRJA 4TUYA 2PSEA 4Q1EA 2VTKA 3NBQA 4R05A 4MVJP 2OUIA 3W77A 1E7QA 4PG7A 5B4VA 3R9XB 4QU8A 4TS4A 3KAJA 4UBOA 2V7QD 5ECDA 3DT9A 1U45A 4A8JC 3FCUB 3C5CA 1LVUA 2KVCA 3B6MA 1V11B 2YFYA 2KNJA 3H2GA 4O59O 3GLGB 3REGA 2XKAA 5LD2B 2XUQA 1XVAA 5HUQA 3K8QA 3QHQA 3QY9A 3LOUA 1B22A 1X7YB 1H94A 2ZRJA 2R8KA 2GBLC 5AVWA 1HDIA 3H83A 4HAOA 4Y6SA 4BZZA 5K1ZA 8ICNA 2E4YA 4YY3B 2YHBA 1BPZA 2XJ9A 2Z1MA 4IUCS 3MHTA 3KE8A 1JPVA 2JDID 4RDIA 1N33B 5KFJA 4N8SA 1YUBA 3V34A 1GNLA 1V1RA 4V0SA 2H5LA 2C4UA 3D6UA 5JAMA 2JVJA 3G5LA 3RU3A 3UCEA 2QUZA 3GGJA 1DMRA 3GJ4A 3T6KA 4XUSA 1KF0A 4WV3A 4X60A 1L6IA 3A7EA 4L27A 1SOWA 4RPJA 2XUJA 2Q1SA 1D2EA 2AG6A 3N74A 4KP7A 1M75A 3SZMA 2QT9A 4NG5A 3GT0A 1PZFA 2R97A 5TF0A 2DUJA 3WS7A 2AJQA 1C7YA 4N5HX 4ZD6A 1SHLA 2EWVA 3KHGA 4IQUA 5K0FA 1USKA 4H60A 2VSQA 3CZQA 3PHIA 4O4JB 4EYSA 5D49A 3K3PA 1IK6A 2ZATA 1Q1EA 2FPMA 1L5WA 2M6SA 2NWQA 3GJQA 2VJCA 3GPIA 3HU5A 1LDBA 4LPKA 2Q2WA 4PTLA 3H5OA 5DGIA 2OBFA 5IBRA 2R0QC 1RG6A 1MB2A 1RWBA 3N8IA 4NPHA 4B0OA 4CVNA 2J45A 1V2HE 4BBAA 1S89A 4BLPA 1U63A 4GFDA 4J49A 5A62A 1J25A 1Z7GA 2H3ZA 1HQDA 2JLAA 2ZRNA 4ED3A 4F5PA 4BN4A 5ALVA 2QVCA 2HA5A 3GEHA 1X80A 4Y9SA 1EYZA 3V6MA 3WQBA 4D9BA 2RDIA 5I9IA 1AHPA 5BVHB 2GM4A 4DLSA 1I0IA 2XUHA 1U90A 2PTHA 2XCQA 3E23A 4PGXA 2WE7A 2C1XA 3L5OA 1AHHA 3NG1A 3RFCA 3G68A 4AG3A 4OHZA 4EG7A 1PFWA 1CIJA 2I6UA 2PEZA 3EGXB 4YMHA 3D59A 3BN3A 3C1AA 1R0XA 5EP1A 2FF7A 2OEPA 3TOXA 3BQ1A 3WISA 4BASA 3FPJA 5CURA 2QMZA 3ESXA 1ULUA 1GNTA 3GCZA 3HLKA 1G98A 2AU0A 4FOSA 1RJ9B 4OOFA 1JBKA 4ZARA 1Z19A 2WYOA 2GHIA 4LJSA 3TVDA 5K9ZA 4K8RB 1NATA 1P7DA 2C2XA 4M0MA 1JNYA 4I9FA 1UQTA 2A3NA 1N5LA 3OKAA 4E12A 5KYWB 4IQWA 4J4BA 4OHVA 2JAHA 4Q4DA 1V7ZA 2P3SA 3M81A 3ZY3A 4HAYA 4NH4A 3L06A 4DSKA 1GSOA 4EMSA 1VRWA 1E3QA 1NVGA 2A33A 2VUSA 5H02A 2KN7A 3U3XA 2QY6A 4CUJA 2C2RA 2JF0A 2RGUA 1C81A 1G2OA 4BFXA 4I4NA 2GN6A 3U5ZB 1T4CB 5K0TA 4N9QA 1NZDA 1T6NA 1V1JA 1N8SA 1XLTA 2IYXA 1Z62A 3AOEA 3BWVA 3EFOB 3D7KA 2XBUA 4DXAA 2LM1A 2V7QA 2VSOA 4E5MA 2PMZC 2QAJA 3OEEA 2W83A 2OCXA 4BEJA 3K96A 3IJEB 5CDFA 3ZDAA 1KVSA 1K6EA 1LLDA 4PWZA 4TS1A 1M74A 2MMCA 4KO4S 4P34A 5FH9A 5AKZA 4FEEA 4RHEA 5ITZB 2PH7A 1DIBA 1Y82A 5I7OA 3D6VA 3PR5B 3GLVA 1YJCA 4ZCMA 3BUSA 4BB5A 3VUFA 1ZU4A 3VV3A 3W5UA 5IDYA 1S9DA 3PQ5A 4HQRA 4UMVA 1FRFS 4TYYA 1TQHA 2GEBA 2B35A 2HSGA 3K53A 4MCHA 1ZH4A 2AE2A 3U44A 2CNWA 5F3XB 3HT3A 3H75A 4JOCA 4CWAA 2VCYA 2ZUSA 3W4JA 1ULSA 3CRRA 4NC9A 3ZCTA 5I7EA 3IMFA 1E9EA 2ILTA 4OAQA 9LDBA 2ERXA 2PV7A 1TUIA 1COZA 3VO8A 1IHPA 4LQLA 1G8JA 3L4BC 3C3KA 1WB9A 1IHYA 3L46A 3LVQE 1ZD9A 4TM8A 5EWJA 3VR4D 4GBED 1C9YA 4RELA 1RXWA 3LC2O 1ZOLA 5EN4A 1AKYA 5JHGB 3U37A 4OY3A 4JYPA 4DL7A 1FDUA 4O4IA 2FEOA 2VDKB 4KLLA 4ZZIA 1XO0A 1ESMA 3W7BA 3QQ5A 2XXAA 2P78A 2YYZA 3WLJA 3LQQA 4L4ZA 2JK1A 4YAFA 5TQ2A 1FNMA 1D2MA 5A9RA 4QUKA 5C52B 2WD7A 2YC4C 4EYEA 2IZ1A 2ZRQA 3MIZA 3WHIA 3VSEA 2ISSD 4M38A 3V42A 2OMKA 1UBTS 3VFDA 3DO8A 1YULA 5TS3A 2QTGA 4J0CA 1TUBB 2YVKA 3EPPA 5BQ3A 5DYGA 3DVQX 4ED1A 4HH4A 1G4UR 1MPTA 1G21B 3INYA 4Q6WA 2KMLA 4KDEA 4Z9YA 2OBBA 3CXRA 4FFBA 2ZLBA 4Q24A 3AUYA 2JFQA 5BQFA 3SJAA 3KQKA 2ZTCA 2XSZD 5GAJA 4DT1B 5FPYA 2QD1A 2VYFA 3HV2A 5DCUA 1YB2A 4PQYA 4AZSA 1J2MA 3F4KA 3I2JA 4V0NA 1RFLA 1X80B 4MMZB 4W5WA 2G5GX 1KBQA 5C0YA 1B7GO 3A3OA 5LIRA 3P9RA 2IEIA 4DLTA 5GVRA 3DBVO 1F0KA 2IKSA 3KR9A 3LK6A 5JQGB 3ZQUA 3L0YA 2PPVA 2R7KA 3JQFA 4OHCA 1D04A 2W58A 5K6RA 2ZRAA 3IUPA 1BRTA 1A5ZA 1MABA 1RJGA 2Q1UA 1HT1E 1BVSA 2H4YA 3RT9A 5JRDS 4MHTA 2RRDA 1BGVA 2IEBA 2WMDA 4FB4A 1XD2A 2E1RA 2ZI9A 4PBSA 1Y7IA 1B6TA 5EJ6A 3EEOA 1I2ZA 3RLFA 5KYYA 4NMLA 1L5FA 3O74A 3QVJA 4TLDA 1QLJA 3SR3A 4KN5A 1VGQA 3VGJA 2OFXA 3KJQA 3PEVA 3OLQA 3WV4A 1MTOA 2HZBA 1NBMD 3AP2A 5KBYA 3GD5A 5TLSA 1FP2A 2GFQA 4JVLA 5CTAA 2HU5A 5CLFA 1IG0A 3DEAA 3F67A 4BO3A 3KWJA 4J1TA 4PZ0A 1ZESA 2B0CA 1QHHA 3I04A 1XTUA 4QFMA 2QENA 4B1FA 3VTKA 3VKUA 2Y9TA 3M0EA 5KOHB 3S8EA 4DLZA 4M88A 1HE3A 2I2FA 1SXEA 2JD0A 3L7AA 1JXMA 4J7AA 1EK5A 3P4YA 4ZU3A 2B1RA 4I2CA 4JUCA 2PNJA 4B34A 2A5YB 5T4EA 2M0NA 1FFVA 1Q17A 1PT9A 2H2IA 3HNPA 3VR6H 3BDVA 1QGAA 3TADA 3K0FB 5EJ2A 1Q57A 3QFRA 4X8MA 3KT8A 4ZQGA 2WJ4A 3TI0A 4P4SB 1MJ5A 4MUGA 1Y37A 3A32A 3VTFA 2BZSA 3NWPA 3QUQA 1OKKA 1JIKA 2HWWA 3CX3A 3IS3A 4J29A 3GJTA 1O6GA 1OAOA 2BFEA 3KIPA 3RS7A 1T9CA 3BL6A 3U0VA 3DE0X 3K9CA 4TQ9A 1C0EA 1R6BX 4ZICA 1OD6A 5J2TA 2YY5A 4BMDA 4LMPA 4S04A 1FX0A 4OB8A 4YP1A 5CGZA 1NUUA 1BD3A 3RJGA 1N5KA 2C4TA 3K71B 1DCMA 1P2BA 1U65A 2DKOA 3CUKA 1Z34A 1OF1A 3KZKA 3ENZA 1LTQA 4KTTE 4OGKA 1SCDA 2HB6A 3MCAA 3MWGA 1QZ3A 2PN1A 3SYLA 3K9NA 3RSQA 4CKBA 3TOVA 4NF2A 2P77A 3OF3A 5ALKA 4US8A 1M76A 2M9MA 4MVJE 4REQB 1ATIA 4RJ2A 5CH8A 1QPGA 4TYWA 5ENVA 4L2IB 3LUAA 2IYFA 4KO3S 3TTSA 3DDZX 3DV0A 3FUTA 3CO0S 3COPA 4HY3A 3K9HA 3T35A 4LZLA 4BIMA 2BE7A 3ZGLA 4UQGA 2ZE6A 4JAVC 2OP1A 2OC4A 3DONA 4OV6B 4ZRNA 1KDYA 3V4PB 2VP9A 5G3YA 4FZRA 4IKOA 3H9JA 1PJQA 2LBPA 1UOOA 1HNNA 1WY5A 1J5XA 4L9WA 4DOBA 1WKCA 2HJRA 3OM0A 3D7RA 3LLMA 5AW9A 4C7BA 3U3OA 4MQBA 3Q8LA 4NARA 5J2KA 1U0RA 4P58A 1V7PC 5ENDA 4GMDA 3RVMA 1MLDA 1KTIA 3BTSA 5H70A 5KTQA 3FDXA 4YRIA 3BHMA 4NLNA 4EUFA 5FRDA 2H1LA 2KP7A 3BRQA 1XMJA 2EKPA 3V1KA 1O87A 2BEVB 1HZJA 2BDUA 2HBMA 1SD2A 4B2YA 1L3UA 1MXFA 2ZI6A 4R0MA 4RKRA 1KMCA 3K4QA 4MLCA 1L5HA 1N5RA 4OIMA 3PFGA 3HKCB 1E2PA 2PVCA 4L5YA 1CQWA 3TI7A 3CZPA 4BLTA 4FCWA 3PA6A 3W04A 4P33A 1QTQA 3ZNNA 1CQPA 4Z53A 1EXWA 2F2AB 1S8NA 1ZIXA 1Z68A 2V45A 1FYFA 2PR2A 3OJSA 3NH6A 3BBPA 1ESDA 4GPAA 1ZH0A 4B3IA 2FPOA 3N39C 1CY2A 4I1RA 3E9ZA 3QE4A 4L0CA 1X40A 2QRQA 5CX4A 5A7FA 5DXJA 2LKYA 1D8YA 2P1RA 3BT7A 4BKQA 2IHYA 3DFMA 2W8ZA 3QOWA 3ZI7A 3DE4X 4DY4A 1H3EA 1ZM4A 3SLRA 2O8BB 1BJKA 3VYVA 3SCZA 5CA0F 1M5TA 1ZM3A 4NMMA 2ZI5A 5HIJA 1E8MA 1LDEA 1J9ZA 3RJKA 5H9VA 4E5NA 2A14A 2BDPA 5KSZA 2WHEA 1L1FA 1PAUA 3BIXA 1N1EA 3FRJA 3CTPA 1XMOB 4J9SA 3WB2A 3CSUA 4AZVA 1KQQA 1WCIB 3TPCA 2E8PA 3V4OA 3GUCA 4ECEA 2JLWA 2QU7A 3IPLA 3H8SA 2PUAA 2CFSA 2JBAA 2Z5GA 3INNA 2YJ3A 3VC1A 2MWMA 2AYXA 2P2DA 3L18A 5FNVF 3UUFA 2QQ0A 2SECE 4XDZA 2OZKA 3HJRA 2M6LA 2YYSA 3SJ7A 1GR1A 2FRDC 3DZIA 3MWEA 1OFUX 4GPEA 4KSBA 2RGNC 4OLJA 2BZGA 3Q88A 4FWIB 3T0GA 2LTAA 5FUQA 3TLKA 3W78A 1BXRB 3TFSA 1Z9BA 2OGWA 1C80A 4J94A 5DEIA 4L3OA 3AEKB 4IVNA 4JUBA 3SF8A 4ZMRA 2PFKA 4J0QA 2FMSA 4MP3A 3HO1A 1USWA 4YALA 4IH1A 5DT9A 3UO8B 1VE9A 3WDMA 5JEEA 1AQIA 2JLQA 3VR6A 1NW8A 4QYXA 1V1RB 1Y6QA 2DHQA 1MAHA 3MTBA 5EJFA 5EAIA 1GPWB 1PR0A 1R6DA 2ODWA 4PEVA 1WVMA 3AM4A 2D74A 3RUCA 1NW6A 3TBHA 4EF6A 3GBSA 2FDXA 1ZJZA 3VXKA 5HWSA 1YNOA 1BPYA 2JFHA 5AM5A 3GMIA 4X62B 2B3DA 1G0NA 1KQOA 2AFIA 3B1KA 4ITRC 3T5TA 3LWNA 5DHUA 1TKAA 1N25A 3ICEA 4KQMA 4M8SA 3JPNA 4B3SB 4UMFA 2Q4TA 1VJ5A 2R8PA 4G5SA 1BWSA 4FYWA 1P1KA 4DC0A 1MENA 1V5EA 3C70A 2DERA 1W30A 1YQXA 2RKBA 3EC7A 1E6MA 1GN9A 4FX2A 5IUNC 2JH1A 8ICHA 2VBFA 4Y2SA 1ZJ6A 2WIDA 2BUCA 5FWDA 1E2IA 1XJ0A 2QK4A 4JK3A 5IULC 3K6SA 5DO9A 2CGEA 1UWLA 1SB3C 3VDMA 2WSSA 1XDUA 2DFKB 3FNRA 1XMSA 3CV3A 3MUEA 4G24A 3E61A 3EHEA 3OJEA 4Y2RA 1H22A 3WYBA 1B2RA 1ZYUA 1RHMA 2DQYA 2XQIA 3KSMA 4JQOA 4CG2A 2X1VA 3ORYA 3TAQA 1UADA 4BXOB 2SHKA 5B1DA 4KCGA 1OJLA 1B00A 4GLXA 1U1IA 1HC7A 1NVAA 2EZ8A 2GYVA 2HLNA 1Z0ZA 2P5YA 2C8JA 2Q8PA 3MTGA 4GGPA 4N5MA 5GM2A 4F4YA 2XVTA 2XYPA 4GIBA 3L8DA 4LVCA 4NYIQ 2F44A 1DINA 3E27A 5GWXA 3VOAA 4DJTA 4EI8A 1OH7A 1JHOA 2R47A 2R8IA 4QIWF 2BEKA 2NUAA 2PX5A 4XLTA 3RSCA 3N6RA 1AU9A 1A1SA 1T9BA 4RO0A 3BS7A 2JLRA 1F4PA 2OD9A 3D3QA 1L5UA 4CTKA 3COJA 1DU4A 1DFHA 3CSSA 3N2GB 4JCCA 3LLVA 5FBVB 3BS5A 2V54A 1GL6A 1P3JA 3B1YA 3DEIA 3HCPA 4MWTA 5G5GA 4PQFA 4R3NA 4RJIA 4WOPA 3TLYA 3UK6A 2ZJAA 2H92A 3GELA 2WHRA 4D45A 1HEUA 3H5LA 3GLHA 4FZ5A 1PT7A 1PFKA 3G5UA 1EDZA 5EXDA 2F1IA 3ROMA 1UWCA 5JMPA 3B60A 3HX0A 1XSLA 2W48A 4M9RA 3E6AA 5LQDA 1DKQA 5TMPA 4W5OA 3TJMA 3JAWA 4ESHA 2JZCA 2VNHA 4JT2A 1OQAA 1U7WA 6NULA 3NYRA 2NPOA 1KYYA 3VNQA 5B7PA 1W2GA 4AXXA 5CX1A 3R4VA 4HX5A 2C2WA 2YWBA 1F8UA 3I37X 3I6QA 2Q41A 1D2AA 2GK4A 2A3VA 1GM5A 4TUPA 4OP3A 1DS6A 1N1DA 2XY4A 5AKYA 4Q9HA 5JCZA 3WRYC 1UXHA 3TE6A 4DWJA 3P27A 2GMWA 1K1EA 2H1SA 3E3LA 3L2OB 2UVPB 3MINA 4PS1A 4BLSA 4EPTA 3KYDA 3KC2A 4B7ZA 5BWMA 2UYQA 4MYTA 1IM5A 3MWEB 3O47A 3OT5A 2NT4A 3ZCXA 1WW8A 3K1ZA 4J0KA 3U3JA 1FFEA 3UK0A 4KPEC 1PK9A 2VJYA 2PJUA 4TTTS 1SZCA 1SUFA 3D4BA 5K3EA 2GWRA 9ICBA 2WNIA 3V4LA 1C4OA 4Q9DA 1L4EA 5SICE 1T34A 1W8DA 2BLNA 3E2IA 4G89A 4MGZR 2WU4A 3C5VA 3FPKA 3JVIA 1O96A 3I01M 1QGZA 4IH4A 3RHZA 1A77A 1DKNA 2O2JA 4N39A 1ZI9A 2Q5OA 4K28A 3NTVA 2B21A 4F3CA 2FFJA 2WTUA 2B6HA 1CNEA 4C6TA 4Q34A 4M0EA 1XB2A 2DKZA 1DARA 4M6WB 5KFOA 4UTNA 1Z33A 5LQNA 2BZ0A 3FNFA 5J5AA 4UOZA 1GWNA 5JO9A 2VJOA 3FYHA 2VTVA 2O5EA 2VA9A 4EYOA 3FB1A 1R50A 3B8EA 1AHNA 1VPVA 2Z5VA 2ZDGA 3VZDA 1R9JA 5K3AA 4DNXA 3WY9A 1QH1B 3FSJX 4MPJA 4DDKA 1M2NA 1UM9B 1CVRA 5SZKB 2ZIEA 4U8HA 1X0XA 1P9RA 3RVJA 3IKMB 2NTJA 5EOZA 2R1UA 4AULA 3QFHA 2UYHA 2HMWA 3RC3A 3W6UA 1D3AA 1UT5A 1ZL0A 1DTEA 4HGNA 3IBCA 2I3BA 3GBPA 1WCV1 2QTWB 1V3QE 2OD7A 2OM2A 4RA6A 3TR5A 4TX1A 2FLNA 1WB6A 2IEDA 3L7OA 2X1LA 4E5VA 1QR2A 3F5EA 3TFWA 1VZ3A 5BNIA 1EX6A 4C0JA 3JZMA 3PDUA 4FNMA 1WNTA 4QXQA 5FOVA 4Q7MB 2VJNA 4JLAA 2F1HA 3HZHA 5F2KA 1WZEA 1SGGA 3EIEA 3FWKA 5F64A 4DA7A 1ZSNA 4UULA 1SBCA 3JQAD 3OCXA 4HYYA 1KOLA 3TCXB 1GTSA 4IWYA 1YU9A 1KN5A 4OHUA 1DFGA 1PS8A 4IMRA 3V8RA 3WGNA 4CG3A 1HG0A 1DAKA 9ICAA 2PX3A 2UKDA 3QPBA 3D3WB 3NHWA 3HWTA 1VGVA 1I30A 3GRFA 3GZNA 3PD7A 4B3MB 3TR0A 2Q5IA 3MS4A 5L3QA 3A1DA 4NCAA 1W87A 1CI4A 1LPMA 3OMXA 3P9KA 4H1WA 4HUQA 2RE8A 3TTYA 3DHYA 2HN9A 1EU1A 2PD6A 5LJLA 5BYBA 1ZQRA 2C7BA 1MVLA 3DZKA 1RRMA 2I4TA 3DOJA 3KG2A 4UBLA 1F6DA 2XADA 3SOZA 1E4EB 1D1SA 1NXPA 1R0RE 4X8OA 5A1TA 2X2EA 5G3ZA 5KDLA 1WBBA 5J3JA 3GARA 2FSVC 4I4TA 4GC6A 2OZPA 4PGGA 2GCOB 5B5SA 5EE9A 4F5RA 3SZ2A 4OBEA 3QUBA 4QTYA 1UMCA 3DT6A 4FLEA 3WYDA 3GFTA 4K7JA 4HQLA 4CR8A 1T29A 5CHGA 4IDNA 1SHUX 1KDPA 3ZQKA 5IK2D 2RGRA 3ZPXA 1XZGA 5CX1B 7AT1A 1KQPA 3FYUA 4IFTA 3OA0A 4FMBB 4IIXA 6PFKA 3NHFA 4ZREA 3IC5A 4EX7A 1EAMA 1AH2A 1V85A 2P0YA 1F5SA 2FHSA 1NJFA 3DKRA 4MGEA 3SVZA 3SZOA 4LZPA 5DNYB 1G55A 3ZCPA 3PDIB 2ZVJA 4K9DA 1JR2A 1O94C 2B8EA 2VRCA 3LNTA 4ALNA 5A03A 2C9MA 3OUTA 3TLGA 4G8JA 4BX9C 1BEEA 5HZMA 3SQWA 4UBNA 3FJ1A 1C0IA 4I2VA 3GT4A 4BFZA 1GRRA 1WMFA 1WAMA 4GYWA 1DRJA 1ZMTA 1L4KA 4PGYA 2EFJA 3FFWA 5FA5A 3O92A 5J2TB 1FW6A 4NLLA 2ISPA 3UUGA 1WZUA 4YMNA 2QG9A 3NTRA 4PPXA 3AR2A 4I1UA 2WVGA 3CSDA 4E5PA 1SXQA 2KHVA 4MITA 1A8UA 2UUOA 2FYTA 4CZ2A 1DRGA 4TZTA 1DUSA 1KJWA 1WDTA 3CCCA 3MT0A 1K27A 1CIPA 2WF7A 3I3SR 5FL7D 2PDAA 5YASA 4F5NA 1QG4A 3E35A 4ND6A 2ZUVA 4YREA 1E2NA 3FVVA 4R8MA 4P7GA 5LQCA 3MJSA 1PJCA 2B30A 4BNTA 1JEQB 3PGVA 2HW8A 4LZDA 1DKPA 4AS2A 2JEIA 2ZETA 3NWEA 4ZPJA 3CGGA 4GRDA 2H1OA 2C28A 1EFKA 1T9GS 5CG1A 4PL2A 3AEVA 1Q3VA 3V97A 3PZPA 3HB1A 1VSQA 3ZGVA 1ZAKA 4JSTA 4ED9A 4NYJR 5DLEA 2C78A 5DB6A 2C99A 3IB3A 2O2GA 4XD2A 1J2EA 1NQAO 1TDJA 4HL6A 2VANA 1ECWA 1MQSA 1JZSA 1JI7A 1LZKA 2IXAA 1UBMS 1BH6A 1P1IA 3JTMA 4OBBA 5CJPA 3A0UA 3GEGA 4IIDA 2P6PA 1TD9A 2PMBA 4GX1A 4A91A 3E2EA 5C53B 1JI3A 2AG0A 2VJMA 5JVDB 3KKAC 5HS4A 3A0RB 1NU6A 3F5QA 5HF9A 4L4XA 1QS0B 3TZEA 3D5QA 4FDTA 1PJ4A 3N86A 2HMYB 2FU5C 4YONB 2GD6A 2PT9A 5EMJA 4AURA 1XQ9A 3EEFA 1YBMA 2WG0A 3KKOA 3EGXA 4PO3X 3H3JA 1PFYA 4RQ6A 4OYHA 3ETRA 4FR0A 4N3AA 1I9CA 5EMHA 3TGLA 1CCWA 3ISTA 2OL4A 2C3YA 4RU1A 1VG0B 3M5WA 1D2NA 3B2QA 4FZ3A 4QATA 3FGPA 4D99A 3EZ6A 4DRXB 4J2OA 1I5OA 2K5UA 2W9CA 3OO1A 5C5DA 1TCAA 1ECJA 5EYPB 1DUVG 3W3AA 5ALYA 1GNSA 2MA1A 4YGYA 4B7AA 2V8OA 1JDVA 2ZBRA 3OECA 1BXGB 5A6SB 1ICEA 4CLEA 1B76A 3CB4A 1T5HX 2VDRB 5CBPB 3IAFA 4ZYLA 4CN9A 2HIHA 2Q6VA 4OM8A 2C3UA 3PFWO 2WAAA 3N2KB 4EJMA 4ZI7A 1G3RA 2BM0A 2CN1A 3BXZA 3RFTA 5L1MA 4F8RA 1TEVA 5L3SB 3TLMA 4NL9A 1V9CA 5C7OO 3ND6A 3CCFA 4GLLA 1ZKMA 4GOOD 4I4TB 3B51X 2KZ3A 3IULA 1O5IA 4RQ1A 4BO0A 4EPRA 1E1QA 3EOAI 3B52X 2A30A 3ZU3A 9ICWA 5C51B 5ELXA 3GFQA 4P2GA 3ZW9A 4N8DA 1CEXA 5GZ1A 1IBCA 2I2AA 2Z5LA 3E9CA 3Q7RA 4G1EB 1P33A 2VRCD 2AOTA 1DJLA 1RYYA 2ALJA 3EGEA 3MJHA 2DP4E 4GRIA 4QT0A 4BWMA 3JPRA 3RAQA 3ADOA 4BKRA 5A4DA 2XZLA 3CISA 4Q9LA 1H0HA 4RHCA 4CKCB 4FBUA 4CIDA 2XNKA 3OQPA 5FXMA 3VI3B 2B94A 4D98A 2V5AA 5FBZA 1GQQA 1K8QA 4KZPA 4OEHA 2YWJA 2A5DA 5K3FA 4FCCA 2D5LA 2ZIGA 3LCJA 3QWFA 4HNQA 4F2GA 2BR3A 3T9DA 3U7HB 5JNLA 3IP5A 2Q3EA 3F8SA 2I2XB 2BF7A 1FEZA 1K86A 1JHMA 4INJA 5DI3B 1PQPA 4EPYA 2ECOA 1GPYA 3JPTA 3E9DA 3F96A 4M0FA 4K6OA 4MNTA 4CFYA 1C8LA 3DLAA 3LPAA 4OQFA 4TZKA 2CLLB 4YRFA 3RG2A 1M0SA 3L0ZA 3CGWA 3F5FA 2IIPA 4WNAA 3VR6D 2MOKA 3FVTA 2AQ8A 3ZR4B 4ER6A 2F8LA 1BVHA 2ZS8A 4JL8A 2GZDA 1NWHA 2ATVA 4AJ9A 1LNQA 4RF2A 1JMKC 1LJ8A 3S2YA 5IEJA 3UW3A 4MROA 1FS5A 1S8FA 4H0FA 2X22A 4ZK6A 4YMOA 2P2NA 5ALQA 2GCIA 1T0BA 2YCBA 5ILGA 4OLAA 4R6WA 2EWMA 3DXZA 3H0LB 2DCMA 2GTHA 3G0GA 1EDEA 3RJIA 3ND8A 4NPAA 1M2GA 4AY2A 2LIPA 4YBZA 3VNBA 3HG7A 1RAIA 4U4AA 4YDSA 4DR5B 3T3FA 3GRVA 1BTOA 3OAAD 1OW3B 1PSWA 1B6RA 1XVVA 2Q2NA 3HCFA 4TTVA 3WHLA 4BMSA 4C1NA 1R37A 2FAXA 2PXIA 4K9MA 4OI2A 2A0YA 1ZMOA 2HHHB 1RQPA 3PY8A 2QHXA 4QWEA