4DA9A

Crystal structure of putative short-chain dehydrogenase/reductase from sinorhizobium meliloti 1021
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
219
Chain Sequence
MMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASDARASRSIINITSVERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSRWGEPEDIGNIVAGLAGGQFGFATGSVIQADGGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase
publication title Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 69
structure length 219
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4da9A00
1VL8A 1QR6A 4TRRA 4LMPA 4JROA 1Y8RB 4HBGA 1D1TA 1R4MB 4IM7A 4MP8A 3JD0A 4XYEA 3E9MA 1H9AA 3ROPA 3DHYA 3VTZA 1GV0A 1OI7A 4Z0TA 2O4CA 4XQCA 5T57A 5JC1A 4Z3DA 5MDHA 1DIGA 3ZWCA 1YKFA 2FP4A 4CL3A 4P8RA 4ZU3A 4PLPA 1X7DA 3MZ0A 4DQVA 2V6BA 3CZRA 2AE2A 1YB1A 4G81A 5LC1A 3E8XA 3EHEA 3MOGA 3BA1A 3U49A 1P74A 1B2LA 1I0ZA 2P5UA 3KZVA 3PYLA 1DDOA 4JP3A 2DUUA 3DZFA 1CYDA 2I66A 4NK4A 3LU1A 3BMCA 4GL4A 5B1YA 3C3XA 3Q3CA 3GEMA 1JLLA 4Q3AA 4XIYA 3W8DA 2C5EA 3V1UA 1LSSA 3GZNB 2GN4A 2QQ5A 3VZQA 5IN5A 5JO0A 1HDZA 3NAQA 1KYQA 1SB8A 1WW8A 2DBRA 3RWBA 1P31A 1GAEO 5CEFA 3HDYA 4IINA 1EZ4A 4KWIA 4W9NA 5ER9A 4AJEA 2Y67A 3NJ8A 3RUDA 4IS2A 1BW9A 1R4NA 4M89A 4E31A 1YBAA 4NK5A 5K6AA 4QECA 4I5GA 1L7DA 4CV1A 3ST7A 4BB5A 3PFFA 3FBGA 1V9LA 2HRZA 2J6IA 2PH5A 3ZN2A 2RIRA 2GASA 1CWUA 2O48X 3RUIA 3LT0A 1Z75A 1PS9A 1N5DA 2PFGA 1U3WA 2GZ2A 4D3FA 1DFGA 1PIWA 4JX8A 1E77A 3LQFA 4AJLA 1NAHA 2PKQP 1PJCA 3OHSX 4NBWA 3WYEA 1KY4A 3ZU5A 3IKTA 4XD2A 4OM8A 2PTGA 2VNSA 2VCYA 4CUJA 3BZUA 3KSZO 5KJCA 1OZAA 4HP8A 4LCJA 4J91A 4QT0A 1SOVA 5JNLA 4ZQHA 3H9UA 2POQX 3TOZA 3UICA 5JY6A 4BNFA 3W1VA 1UH5A 4FPXA 5CPBA 4CMJA 3ZGYA 5JYEA 1HSOA 1ZKMA 2ZTUA 5JDCC 4YAIA 4OIMA 4WLFA 3ANNA 3GT0A 4EI2A 2HMTA 4XYLA 5AVOA 3IDSA 3KYCA 4M49A 5C7OO 3IL2A 1MUUA 1NHGA 4CM1A 4W4TA 1ADBA 1HE5A 1S7CA 2OP1A 4Y6SA 4BMVA 3QRWA 3RJ9A 4W6ZA 3FNFA 4DQUA 1UP6A 2Q46A 4I8XA 1YOVA 1ENOA 4XRRA 5TGDA 4YQZA 3FRJA 4BNMA 4L75A 3Q9NA 3TZQA 1EFLA 3HHPA 2OXIA 2GR9A 2FMUA 3ANMA 2DUWA 1MX3A 5EESA 5A03A 1GYRA 3WSVA 3WGTA 3Q2IA 4ALKA 3RUAA 2V7PA 1BG6A 1GU7A 4FOOA 1U3VA 2DFVA 3KRTA 4Y8VA 4E2WA 5BQFA 1N1GA 1U7HA 4DMLA 2DTXA 1ZW1A 3BMQB 3RKUA 5DOVA 3KETA 3GRPA 3ZWVA 2EG9A 4OXYA 3GVPA 4OGWA 3ABIA 4B4WA 2WEKA 2EP7A 2C7GA 1Z45A 1B0AA 3D0OA 2QHXA 2A9FA 3OJEA 1SNYA 5HA5A 2JL1A 4WJZA 1GZ3A 1EBFA 4ALJA 2IXAA 2VTEA 3E5RA 2I65A 1N9GA 3I5MA 1TT5B 3ULKA 4EUFA 4ND4A 2V65A 3K31A 3ZWYA 2QRLA 3DXFA 2JD0A 1GDHA 3JSAA 1C0KA 1MC5A 4FIZA 3HB5X 3LYLA 3T7EA 1DHTA 1VL6A 1HYHA 1I32A 1U7TA 4XJSA 5AYVA 3TQHA 5K9ZA 1F0YA 4ALLA 5JDCA 2ZKLA 3I4FA 3NTQA 4B3IA 1AHHA 3JQ9C 1JTVA 9LDTA 1Z73A 3L77A 2NUAA 1WMAA 3JQAD 4DREA 3GN1A 2YYYA 3JV7A 3DHNA 2EKQA 1HZJA 4WE3A 4HV4A 5TX7A 5TNXA 2XPCA 1PEDA 4IDFA 4B4UA 1GPDG 1TA4A 4DQXA 3Q2KA 1T2EA 4IMRA 3BMQA 1O6ZA 4BO2A 4GBJA 4Q9NA 2O3JA 3KEOA 4TKMA 3SJ7A 5T5QA 4E2XA 4E30A 2F00A 5IFLA 5ILGA 3VZSA 1DAOA 2PR2A 2DPHA 3DOCA 1BSVA 1L1FA 1P1KA 1DB3A 1WVGA 3KOUA 3LC7O 2Y1CA 3B6ZA 4CMIA 3JQ7A 4NBRA 2J3JA 1HYGA 1NXQA 3FR7A 2PZJA 1OMOA 4NJMB 2VTDA 1GQQA 4B7XA 3BHIA 1CQIA 3DEYX 4WUVA 4IDCA 1E1KA 3Q0EA 4XYGA 4NNJA 5EL0A 1K6JA 4E6PA 4XYMA 2Q4EA 1BDBA 3JD3A 1BVRA 1CQJA 3BMNA 4BNNA 4KQWA 1X0XA 5I9NA 2Y0DA 4FC6A 1NHWA 4YEDA 1PQPA 5DBIA 1JKJA 3VPFA 4RPJA 1ZXBA 2SCUA 1U3UA 3O03A 2JCXA 4E13A 4P38A 5AXBA 3WX0A 1B16A 1GEGA 3EZLA 2DBZA 3ZNQA 3EZYA 2WE7A 3TF5A 4O59O 1VJTA 1DFHA 2W2KB 4D3SA 3ZV3A 4B3HA 3ETDA 3LLSA 1IPFA 1BXGB 2Y1GA 2FR8A 1GL3A 3Q11A 4NMHA 5H82A 1Y9AA 3GF4A 1Z74A 4F45A 1DC3A 4RVDA 4E21A 1KC3A 4B7UA 2FY8A 3QHAA 1E7SA 3NDRA 4CMEC 2VYNA 3HQ4O 3RAJA 2H9IA 1WMBA 1PTJA 1D8AA 1VKNA 4FCCA 2PLAA 4PRLA 4FGSA 4U6QA 4CMGA 1G1AA 4K6CA 4YAEA 1NQTA 2JHFA 2P91A 4P4LA 1H6AA 4OYRA 4PG8A 5L7TA 3RCBA 5BR7A 1NBOA 3DZGA 1BVUA 1LXCA 1PJLA 5G2OA 5H81A 3PZBA 2GN9A 3FTNA 4R1TA 4O63O 4RPLA 1GQYA 2FR1A 1O8CA 3V8BA 4DMMA 3U4DA 2X5JO 4N54A 4YR9A 1ENYA 4EW6A 4OH1A 3U4CA 4DPLA 1K5HA 4AJKA 4CMEA 5JS6A 5F1OA 2TMGA 5TRTA 1QYVA 1E6WA 2C82A 3SEFA 3IUPA 3LT1A 1HDXA 4BKPA 2DQ4A 1LUAA 1UXIA 1R15A 1WZIA 1N1EA 3TFQA 3KSDO 4YWJA 1E6UA 3RFVA 4GWKA 4K28A 1N9GB 3AOGA 3WLFA 2X5KO 3GFGA 2Q1TA 3TRIA 2ZYGA 1O95A 2ZCUA 5KVSA 1A9ZA 4UEOA 5ILOA 4I9UA 2H1SA 5JE8A 3DR3A 4HX5A 3K8ZA 4W7IA 1B26A 3BXXA 4YAJA 3B1KA 4YCAA 2OMEA 3HUDA 4OSOA 2P9GA 5AOVA 4PN3A 1PS8A 1SMKA 3WOHA 4Q3BA 4TZTA 3CH6A 5C37A 3PP8A 3PEFA 2Q45A 3C1OA 4I5DA 5F3RA 3ZCXA 2I3AA 3FCOA 1EVJA 3AM3A 4EJMA 5C7LO 9LDBA 3I52A 1IYZA 5G4LA 2C2YA 1MXHA 3VH4A 2Y66A 4K6FA 3ORFA 2DC1A 4D42A 4DYVA 5L4SA 2Q49A 2HK9A 5TJ9A 3VH3A 1I8TA 5I7SA 1H6BA 4KTTE 4UEKA 4BNLA 3IJPA 1KOLA 2ZTMA 5ITVA 1J49A 1PS0A 3OETA 1E3JA 3HZZA 2Q99A 2P4HX 2X0IA 5FEUA 3KYCB 4B3JA 1PSDA 1Y7TA 4K1LA 2YHIA 4ITUA 4PZEA 5COQA 3GGOA 4M87A 1NM5A 1WLYA 4GGOA 5JFOA 1DLIA 4U6SA 2H6EA 2CVZA 1T1SA 4HFNA 4C4OA 4CLOA 1TVEA 1Z7EA 1P1RA 2NACA 3D3WA 1X13A 2X9GA 1E7QA 3IJRA 1EVIA 2FHSA 2PWZA 4YRBA 4IIUA 3E82A 1BRMA 5KNLA 1Z82A 2UUPA 2B5WA 3UOGA 1V0JA 1NNUA 3PJFA 2ZCVA 4J7CA 4A26A 1HE2A 2YJZA 2ZYAA 1O94A 2EJVA 1SBYA 1Y5MA 2HMSA 2WYUA 1D4FA 1UR5A 4RQUA 2NQ8A 3WIEA 3WB9A 1TXGA 2FPIA 3JQAA 4BNVA 1A7AA 2Y1DA 1IY8A 1HLDA 2D1YA 2VZ0A 3DB2A 1ZXLA 3CMMA 3PYXA 4U0JA 5J23A 4UVIA 4H3VA 4LRSB 5JAZA 1ISJA 1YS4A 3DAGA 2DM6A 2G0TA 5I7FA 3OJLA 1U8XX 1VE9A 1I2BA 5GZ1A 3CZMA 2VRCA 2ZJ1A 2BRUA 1ZFNA 3HFGA 1M67A 5DP2A 1I3NA 2W8ZA 1XQ6A 2BFAA 1A27A 4R01A 2CY0A 2G76A 3AWDA 1PGOA 6LDHA 3GUCA 1JA9A 1H2BA 4TRNA 3MEQA 2WDZA 3ZHZA 5JDIC 2WYWA 4OSPA 1OC4A 3E1KA 4I5FA 4TQGA 5ES3A 4MIYA 3DAPA 4YPOA 3L6EA 3JQ8A 2HJRA 4A5OA 3OICA 4MP3A 3ZWNA 2VYVA 1GADO 1J5PA 3HJAA 3E18A 1E3EA 3ENKA 1UP4A 4RPKA 1DAPA 1H0KA 4TSKA 3QW2A 1EUCA 4HKTA 2VRCD 2JHGA 1GYQA 5JMWA 1IL0A 3LLVA 1ZSVA 1GEEA 3F1LA 4PLGA 3GH3A 1RYEA 5CEEA 1EK5A 4LSMA 2X0JA 1SZJG 1RYDA 2D5AA 4BO0A 1M2WA 1NQAO 3GLQA 1R4MA 1VKOA 3KHUA 3WWYA 3LF2A 5KOIA 1E1NA 1Q0LA 3G79A 3DAFA 1ISGA 4JIGA 4CMAA 1V3UA 2PGLA 2YQ5A 3AU9A 3F1KA 3OSUA 2OP0A 1A4IA 1ZEMA 3LC1O 4XB2A 2LDBA 4WNIA 1DFIA 4R41A 3BHJA 3OQ1A 1ISHA 4DPMA 1G0NA 1ZH8A 3L9XA 1ZK4A 5KJ6A 4DL9A 4RORA 3WS7A 3O4RA 3ZNOA 1QG6A 1NASA 1SCUA 3BTVA 1T2CA 1JW9B 5DULA 4P22A 2ZQZA 5BSGA 4JJIA 1CRWG 1LSUA 5DOZA 5A9TA 4GX0A 1O5IA 2DTEA 2EW8A 4Z0PA 4D0SA 1M76A 2QX7A 4WOKA 4E5MA 1DIHA 1EQ2A 3O9ZA 3ZNPA 3JYPA 2OL4A 4J4BA 1KEUA 1A72A 4MVJD 3K6JA 3K9QO 1DRWA 3WGYA 3ADPA 4RZHA 3NGXA 5B4TA 3WGHA 1B8PA 2D59A 3JYQA 2O3UA 3VH1A 1WDKA 4XR4A 4JLWA 2GF2A 4E5YA 3X2EA 4UUPA 5BT9A 5DCWA 3QWHA 4CQMD 3PZRA 3AY6A 1BXKA 3LT4A 5G4KB 3UW3A 3I9MA 5HRUA 2BH9A 4CR7A 1MXFA 4XZ3A 4Z9XA 4D79A 5C7IO 3OF2A 4JCOA 3WQSB 5DBGA 1CDOA 2EJWA 2Y93A 1F06A 5G0VA 4MKRA 4IJKA 3NYWA 3T7CA 4B8ZA 1TLTA 1QYDA 4PRKA 3CXRA 3LSYA 2FPGA 4TKLA 3NKLA 3W6ZA 2P9CA 1E1MA 2VHXA 4KDEA 4IQ8A 1LSOA 1EFKA 5TJHA 5TS3A 3E03A 1JAYA 1JWAB 2ZTLA 5F5LA 3A06A 5KJ1A 3ZU4A 4Y98A 1T2FA 4CR6A 3KV3O 4DXHA 3NT4A 2IZ1A 2ZB4A 1SOWA 3BTOA 1NX6A 1OBFO 2ZQYA 1BMDA 2O3TA 1WWKA 4MVJH 1I2CA 1DIRA 1Z6ZA 3R3SA 1UUFA 2BGLA 1DLJA 1ZIDA 1LA2A 2OZPA 5FI3A 4YAGA 4H7PA 4BO4A 3BMOB 4E33A 5JDIA 1LDBA 3TNLA 2DLDA 4GKVA 3V2GA 4NFHA 3RASA 4E0BA 3FPCA 1V3TA 3NV9A 2WJPA 3AUUA 2O50A 1I2ZA 3KYDA 3LDHA 3OQBA 2Y1OA 1ORRA 3FTPA 4YAKA 1PL8A 1GUFA 4A2CA 1IZ0A 1K6IA 2O2SA 4D3DA 2PV7A 1R0SA 1LQTA 2QIOA 3ADOA 4C7KA 1I33A 3KB6A 2P4QA 3FI9A 1XIVA 2VWGA 2X8LA 1E7RA 2E6UX 2I3GA 2DFDA 4GPD1 3RU7A 2V6GA 4MKZA 2YW9A 1E1LA 1E3LA 2RH8A 3MTJA 2V6FA 2RHCA 2B36A 2EW2A 4FR5A 2OHXA 4WEQA 4U0KA 3ZH2A 4DLAA 4J2HA 2B35A 2FR0A 2YHUA 3GDFA 3UCXA 3JQ8B 4ND1A 1TB4A 5A5FA 2Q2QA 1RPNA 4WCFA 3W4JA 2PY6A 3ZZNA 4A73A 1KS9A 2D3TA 5G0WA 1IHYA 3JQ7B 2QZ9A 5JLAA 4JBGA 4M86A 3U09A 4NHEA 4DIFA 3QWFA 5FI5A 1GZ4A 3JYOA 5L9AA 1E7YA 3KYBA 4AJIA 4KUEA 4CM9D 3HDQA 5FYDA 4MVJE 2HLPA 3KVOA 4B4OA 1YH3A 2YFHA 3JD1A 3OBBA 1GFSA 1N8KA 2PD3A 1NVGA 3CMCO 5IF3A 5JO9A 4MOWA 1E7MA 3RC7A 1T4DA 5A3VA 3S1LA 2VHZA 4XQGA 4F6LA 1IE3A 1PJ3A 3PK0A 1RM5A 3R6DA 2WD7A 4EJ0A 4BO3A 1SEVA 3VPSA 3EAGA 3K2BA 5A04A 3K73O 5AXDA 1RM0A 1X14A 1Y6JA 4BNWA 2W2LA 2PK3A 1X7HA 5JAMA 3GZNA 3HWRA 3JYNA 1WDLA 1LDNA 4GVXA 2W2KA 4R16A 5A9SA 3PWSA 4KUHA 4M8SA 3TZKA 1XA0A 1ZVMA 5TF4A 4U8GA 3PQDA 1KETA 4UREA 4BO8A 3AI3A 1FDWA 4BNIA 1EDOA 4BMSA 1TT5A 4RDHA 4XYBA 2V6MA 5IDQA 3WGGA 4NIMA 5DDIP 5DP1A 2YV3A 3G1TA 3UAGA 2ZATA 1NTOA 3JQFC 2OBNA 3U5TA 4CM9A 2HAEA 2PKRA 3DO5A 4QSMA 3OP4A 2VT2A 4Q3NA 2EV9A 4DTIA 3CE6A 1UXKA 3G17A 4NDNE 2NSDA 3KYDB 3ZV6A 3QQPA 3DMYA 4FBGA 4D46A 3QVOA 5L7WA 3AM4A 1O89A 1RJWA 3H9QA 3I1JA 4YT2A 4ZRMA 4WCFC 1QLHA 2BGKA 3R0IA 1K2WA 5THKA 1FMCA 4DIBA 4WPGA 5TLSA 1E3WA 2EGHA 2E37A 3KUXA 3OECA 2BMAA 1PX0A 4XDYA 4IQGA 1NFRA 1UAGA 3GK3A 1U5AA 1PGQA 3H65A 3WWZA 4DUPA 2X0RA 3KM0A 3O8QB 4AVYA 1LDGA 5HS6A 4CV0A 4X54A 1P33A 2NU8A 3W6UA 4FW8A 2VYVD 2CVOA 2DBVO 5HM8A 4E5NA 1RWBA 2PZMA 1IPEA 2HK7A 3IQDB 2EIHA 2AEJA 4W82A 3WTCA 4AFNA 4D7AA 2CF5A 1XSEA 1Y1PA 1DRUA 2JCYA 4JNKA 5T64A 4RDIA 1UDCA 2ZYDA 1P0CA 4CM4A 5ICMA 5LDHA 3JD4A 1P1JA 2O7SA 4BV9A 1C3VA 3DBLB 1GQ2A 3WXBA 1NP3A 2CUKA 2P68A 3KO8A 2O3SA 4KUGA 3A9WA 4XA8A 3PIDA 2CNBA 3ZV4A 3H4VA 3WJAA 4WECA 7MDHA 5F1KA 4BOYA 2Q4BA 4HNGA 2BFOA 3UN1A 1ONPA 4BNYA 2AA3A 3UH1A 4AJ4A 4YT8A 4WK6A 3C85A 2FZEA 3E9QA 4Z3KA 2IZ0A 1T25A 4XQ9A 1KEWA 5L45A 1LNQA 2QG4A 1Y9EA 5KWEA 5L4LA 2F1KA 2GCGA 5JCXA 1QORA 1YE3A 2PD6A 1C0LA 3GDGA 1ENPA 2IE0A 2Z1MA 3GVHA 4CLHA 1LDYA 2AEMA 2YDXA 3PHIA 3SLKA 1A7KA 1E6EA 2Y1FA 4R68A 3AI2A 4XR9A 2FWMX 4R1UA 3DWFA 2P9EA 3DL2A 2VZ9A 1IOLA 4R1NA 1UP7A 3OH8A 1XR3A 2A35A 1JVBA 1U9JA 1BXGA 2HQ1A 4R5MA 5KJEA 2XAAA 2JFGA 4AJHA 4RGBA 4BL5A 2C59A 1MP0A 3RKRA 1NWHA 2HRBA 1G0OA 1L7EA 5HBRA 1XEAA 3HG7A 3VOSA 1LI4A 4JJGA 3V1YA 1LC3A 5THQA 5BSFA 5I8ZA 1PL6A 3RC2A 4E3ZA 4UUNA 1H6DA 1QV6A 4JQCA 1A71A 1NYTA 2XOXA 1BXZA 2NTJA 4M55A 1B8UA 3Q6IA 4RF4A 3HADA 4FOSA 1HDCA 3H2SA 5GZ3A 1EDZA 4I9HA 4MP6A 3JQDA 4WCFB 3S2IA 3W8EA 5GZ6A 1LEHA 3JD2A 1PQWA 5JCJA 4N5NA 2Y68A 3GHYA 3L4SO 2PH3A 1QMGA 5AQ1A 3AOEA 4CQLB 1LU9A 2WTBA 1PQUA 2FSVA 2NU7A 1SO8A 1WDMA 2BFMA 4J1NA 1UAYA 3RQSA 4YXFA 1DXYA 5A3JA 4ND3A 1KERA 4PFJA 1PR9A 2NVWA 4Z9YA 2W98A 4OKIA 3TZCA 4C7JA 3L6DA 4RVGA 2I76A 3WLEA 2OGUA 4HFRA 1QV7A 3NT5A 4RF2A 4TROA 1KVSA 3BTUA 2J3HA 4BQRA 3GRKA 4CJXA 1DO8A 3L07A 1O0SA 1UJMA 2PZKA 1H6CA 4QX6A 3OEYA 3MJEA 1E7WA 3V1TC 4E5PA 1ZK2A 5CPFA 3EVNA 4JXKA 4BO9A 1M6WA 2UYYA 5DBFA 3GY0A 2E48A 5B12A 3AY7A 1NPDA 4KZPA 3FBTA 3O26A 2CDAA 3B70A 3F5SA 3B1FA 3RC9A 2W2LD 4A03A 1JVSA 1UXGA 4R3NA 3EK2A 1HDYA 5JXWA 3WJ7A 5A4DA 1CIVA 4AJPA 2AG5A 4EEXA 2VHWA 1QKIA 1YRLA 4IGFA 5DT9A 5KVQA 3ZWXA 2A92A 2NLOA 2OFPA 3NDIA 3C1TA 1X7GA 5EIOA 2EHDA 2AQ8A 4MINA 4MVJM 4ZGWA 2AE1A 4L9RA 2H63A 5EPOA 3GPDG 2B0JA 3NDJA 4WNCA 4FD3A 4XKJA 4R3WA 4YJGA 5T8KC 1XQ1A 2B5VA 3M6IA 4P4GA 3PQFA 1CEQA 1I36A 4RL6A 5EN4A 3AM5A 4JK3A 5DCYA 3D5QA 3RBVA 1YDWA 2J3IA 4ZHSA 4F6CA 2CDCA 3P5SA 1XU9A 2IZZA 3ZNNA 3GC6A 1MC4A 4PG4A 4FFPA 4WGGA 4L8VA 2YV1A 4J0EA 3GEGA 2BELA 1N2SA 1QLJA 1BGVA 3RROA 2VWHA 1PJBA 1BWSA 3GPIA 5I8WA 2O23A 3ONEA 4WKGA 4PLFA 3OEWA 3PVZA 2HU2A 4AJJA 1GCUA 1IB6A 4FFLA 4R1SA 4BGUA 1EMDA 1KVTA 5CDGA 3QWIA 4KDFA 3GA0A 2UUOA 2DVMA 3C1AA 2A94A 2VHVA 1U4OA 5TSDA 1ZEJA 1HDGO 4MVJP 2W90A 1R12A 2VWPA 1MV8A 5CDTA 1B15A 3ON5A 4Z9FA 1VI2A 2OORA 2BD0A 2G82A 4NZ9A 1ZNQO 2HO5A 4XGIA 3ASVA 4YQYA 5CFZA 2IEDA 3L4BC 4BNTA 3W4IA 4PLCA 4KMSA 1I10A 1AE1A 4YJDA 4Y9DA 5EMHA 1YL5A 1YJ8A 3NJ4A 4TZKA 4RVHA 1ADGA 4QXMA 4BIIA 1VSVA 4LK3A 2AQIA 4MIOA 3DFUA 3K30A 1KVQA 1AHIA 5JSFA 1U8FO 4L4SA 2NU9A 5I9LA 5A02A 1E3IA 1W0CA 4YTEA 3TL3A 1I3LA 2EP5A 3FPLA 4EYEA 5IZ4A 4IUYA 1Q0QA 4UEJA 3WYCA 5L51A 1DPGA 7ADHA 2Q2WA 1ISMA 1RM4A 2GERA 3B20A 1HRDA 3OA2A 2X9VA 3FF4A 1IULA 4LCEA 3SJUA 2UDPA 5IDYA 2AXQA 1YJQA 3JQ9A 3F5QA 4TRJA 5A9RA 2RHRA 4KP7A 1OOEA 3V5NA 2WD7B 3DMTC 3ASUA 3AK4A 3VZRA 2D2IA 3VHRA 1P77A 3TPCA 4MIEA 4BNKA 4IXWA 1JAXA 4EITA 2NQTA 2R6JA 1Y81A 1E0DA 4J2OA 4W99A 4YT4A 1PJTA 4EUHA 3NUGA 4RVFA 3ZWOA 4F3YA 3VPGA 2CVQA 4GH5A 4BO7A 4R54A 3U62A 3DZBA 1U28A 3WNVA 1EVYA 2HDHA 4FFRA 1UZLA 4R69A 5FF9A 3ZDFA 3WIDA 3OJFA 1LQUA 2GD1O 2HJSA 3DBRB 4ZQEA 1MB4A 4BNJA 1GD1O 5F1PA 4J43A 4II3A 4BKOA 3TFOA 1JN0A 4OL9A 5JPIA 3OIFA 4DA9A 2R00C 1PJ2A 2YY7A 1ID1A 4K9DA 3WG9A 4XJTA 3ZWBA 4XCVA 5JC8A 4FB5A 2CF6A 1QSGA 1ZSNA 3MOIA 1HWYA 3TN7A 4QFDA 2VQ3A 2P5YA 2WM3A 2HMUA 3KLMX 4D43A 4QUKA 4FQ8A 4U7WA 3EMKA 5DN9A 1NFFA 5ENDA 2B37A 1NR7A 2XXJA 2C0CA 3M1LA 2VWQA 3UGKA 3PHLA 1C1XA 1YQGA 2UAGA 1VJ1A 5CG1A 3H2ZA 1I01A 4IMPA 4PLWA 4EUEA 3NGLA 1ZMTA 2B4RO 2PGDA 3LT2A 2GRAA 2GPTA 4N7RA 2AMFA 4J9UE 3V2HA 4BV8A 2UV8A 1VL0A 3OFSA 1D3AA 4QFCA 2WE8A 3TJRA 4CUKA 3FNEA 3HSKA 4BB6A 1Y8RA 1FDTA 2IDZA 3PJGA 2ZB8A 3GGPA 4TWRA 1PWXA 1W8DA 3AOEC 4NQZA 3FWZA 4D45A 3AFMA 5KVCA 4ALIA 5KKCA 1Q7CA 2FZWA 2JFFA 4PGFA 4IDDA 3KLPX 4O0LA 3N58A 1T4BA 1AXGA 2VNAA 2D8AA 4J1QA 4UAGA 1IHXA 4ZJUA 1R37A 2FSSA 2GNAA 2B69A 2X9NA 4PZDA 5JYDA 5IXYA 1FF9A 3OIDA 2PZLA 3TDKA 3ICPA 2NTVA 1F8FA 2C2XA 4EBFA 2YDYA 1DC4A 3INTA 1CF2O 1KEVA 3F47A 3I9KA 1T2AA 3AUSA 2GLXA 4L4RA 3SX2A 4GSLA 4Q3EA 4IGEA 3LZ6A 3UCFA 3M2TA 4IQ0A 4BNXA 1K3TA 1ISFA 2VYND 3EC7A 4GVLA 3DDNA 4LRTB 2BI7A 3CTMA 1B14A 2IXBA 2ZIZA 3QV1A 3GG2A 4YA6A 4CL8A 2J3KA 4YVFA 2Y99A 1R0KA 1M66A 1WAMA 3RBXA 3H9JA 4LGVA 1EK6A 4J9VA 2G5CA 3OJOA 2VUUA 4J7XA 3MJTA 4GKBA 3ZHYA 3QP9A 4FGWA 1FK8A 1UXHA 1E92A 3ZWAA 4QO8A 3HB4X 1T26A 4AG3A 5KIAA 4FFOA 3QVWA 1ML3A 3VC7A 1ZO8A 2NWQA 1F14A 4RLHA 3DTYA 1OFGA 3DBHA 3PLRA 3FWNA 3IP3A 3W4KA 5L40A 4ALNA 2X5OA 1XU7A 4HWKA 1I5RA 1PL7A 5CAEA 2Q1SA 1LJ8A 3MJSA 3H6KA 3O38A 1YBVA 4J6FA 4ZA2A 4CPDA 1YL6A 1YO6A 3GNTA 3H9GA 1DBVO 3DMTA 4UVGA 3QVXA 2LDXA 4L4XA 3ITKA 1WPQA 2EKPA 4CQLA 2BF7A 2EGGA 5DF1A 3M1AA 3VDQA 4YRDA 1GCOA 4M1QA 4B4VA 4BNUA 3GDOA 3U3XA 3LF1A 5T67A 3MWEB 1ZJZA 2WD8A 3AUTA 4NJOA 2IRWA 4HXYA 1UDBA 4S1VA 1U2DA 2X86A 3H3FA 4CM8B 1YOVB 2YHIB 4IBOA 2HKIA 1JKIA 3WTBA 1RKXA 4Y6RA 1XWFA 5LDGA 5COBA 1MG5A 2QYSA 1FDSA 3ZW8A 5CDSA 1NR1A 1I3KA 1ZK1A 4FJ1A 3G3EA 4DBZA 4TRMA 4MO2A 3G0OA 4XRGA 3PDJA 2D5CA 4TVBA 3WQRA 3DBHB 3IKVA 1IZ9A 4IJVA 1BTOA 3F9IA 3PDUA 5IN4A 3H8VA 3V2UA 4RPGA 4Z0HO 4CQMA 3TZHA 4EZBA 6ADHA 1HLPA 4YYZA 8ADHA 2G1UA 3ZHBA 2HMWA 1SB9A 3BMOA 3CPSA 4JGBA 4GLOA 3RUEA 1EVZA 4RCVA 4E4YA 2WSBA 2Q1WA 4IDGA 4URFA 1KBZA 4RVSA 4YT5A 2FRDA 1PZFA 1HKUA 3UXYA 4GAEA 2JAHA 4YJFB 4NBVA 1H93A 3BHMA 5DZSA 1P1HA 2R00A 1LRLA 2Y0CA 3CKYA 2FPPA 3MJ4A 4CMHA 4I9NA 1LLCA 4IPTA 4PLYA 1LSJA 1HXHA 3PLNA 1BW9B 1R4NB 4HFJA 4J7UA 3DOOA 4QTZA 1SAYA 2AQKA 3L6OO 2HMVA 2NU6A 4NBUA 4N5LA 3Q1LA 5G4KA 3ZV5A 4JBIA 4DLLA 1EEHA 2PGJA 4OO3A 4S3MA 5A5EA 1UDAA 2Y05A 3GMDA 1HF3A 3I9LA 4ZD6A 1PZHA 4K26A 4PLVA 4WLOA 1UZNA 5C3MA 3DBLA 3MJCA 4BKUA 1Y8QB 3S2EA 3A14A 3SVTA 3RI3A 1N7GA 4Y67A 5HTOA 1X1TA 5AXAA 2NVUB 1QYWA 2X4GA 1DRVA 1EUDA 2WWRA 1X1EA 2AW5A 4GX1A 4XX0A 2JCVA 3L9WA 4ZQBA 4RJTA 3T4XA 3FHLA 4RZIA 4PG6A 3WICA 4AJNA 5KKAA 1H9BA 1YWGO 4P4NA 1QRRA 4XGKA 2GZ3A 3DFZA 1A5ZA 1ZMOA 4CODB 4ZQGA 1EE2A 1PGJA 4H16A 3MTGA 3WFIA 2C07A 2IEBA 2NADA 5BNTA 1LLUA 1UZMA 3I9OA 4LISA 3D5TA 4GQAA 3BTSA 3D4PA 3LC2O 4XIJA 5JW6A 1ZK0A 4JP2A 3GN2A 4DWVA 3PIIA 4LVUA 4LN1A 2RBEA 2ZB3A 2YV2A 3A1NA 3OMLA 2CFCA 1R6DA 4R4JA 4D44A 4FFNA 3F6YA 5B4UA 5F5NA 3GAFA 2NVBA 4IJUA 1KY5A 4BQPA 4WLNA 5BSEA 3AU8A 1WNTA 4UVHA 5K0ZA 1XYGA 3KEQA 4GMFA 1XELA 5EQDA 1NQOA 4ONEA 3PHGA 1Q1NA 5U4QA 2EXXA 3PJEA 3RFXA 2JD2A 5EJ2A 1U5CA 4OHUA 1KVRA 1FJHA 3BAZA 3VZPA 4CMCA 3AY3A 1PZGA 3D1LA 3GNSA 3DOJA 4AICA 3FNHA 3ZHXA 1U4SA 1R16A 4ND2A 4FC7A 4GLLA 3VH2A 3WGIA 4BMNA 3QWAA 2JJYA 1HYEA 1XLTA 2IODA 3JTMA 4PVDA 1JDJA 3STHA 5U1PA 4CLRB 3I9NA 3AFNA 2BHLA 4PCVA 4JN6B 4L73A 1NWCA 1ONOA 3NTOA 5GMOA 5L7YA 1NPYA 3DQPA 4E2YA 4F46A 5CEJA 1P44A 2W4QA 1BHSA 2RAFA 3PHJA 3ROKA 5JBIA 4WOJA 2OO5A 4MVJG 2D4AA 2P2SA 4BO5A 2C7VA 4HFMA 5A9SB 4IDBA 1HEUA 1LLDA 4XWYA 5FWNA 3I23A 3K5PA 2RCYA 4I5EA 1CERA 4WLUA 2BGMA 4IJWA 4OXNA 1YONA 4NFYA 5AXCA 5KTKA 5HS4A 1J0XO 1LLQA 3WFJA 4PLHA 4U5QA 1HDOA 4OJNA 4OOEA 1OC2A 2Z1NA 2VT3A 4YJHA 3S8MA 3WMXA 4GSKA 4RF5A 1QYCA 1T24A 3ROQA 1C0IA 3K96A 3C24A 1I24A 1R0LA 3TWOA 5KJFA 2B4TO 3GG9A 1NVMB 4OXKA 4NU6A 5H83A 3VDRA 3JQ6A 3GOHA 1V6AA 3WQQA 3GFBA 2X22A 4ZN6A 3ONDA 3PQEA 3HFSA 1LDEA 4J49A 1H94A 1CETA 5CDUA 2VOJA 1ZCJA 2J5RA 2O3QA 2A4KA 4B7CA 1DIAA 3ONFA 5DNAA 2Z95A 1WP4A 3U4HA 4NPCA 4XGNA 2JAPA 3HN2A 2I9PA 3BMCB 1PR3A 3GR6A 4G5HA 4PG7A 4BKQA 2VN8A 1Q0HA 4I08A 3DONA 2NM0A 1K89A 1YB4A 3CEAA 5I7VA 2Z5LA 2I99A 4PIVA 4B8WA 3PJDA 2BFPA 3GMSA 1N7HA 1P9LA 1DEHA 1R66A 3N7UA 3T4EA 3F4LA 2EKLA 3QA9A 5JMPA 2DU8A 3L4BA 1SPXA 1V8BA 3CIFA 1ARZA 4QEDA 1HDRA 4CR8A 2GGSA 3DZHA 3H7AA 3VKUA 5KCZA 4BS9A 4CMIB 1NPTO 3HN7A 4FS3A 5JCJD 3RFTA 3OQ6A 2X7HA 4ESOA 2QRKA 2PNFA 4OKNA 1E3SA 4RV9A 3WGQA 2TMDA 1PGPA 5TQVA 3OM9A 3RSHA 3ZW9A 2R2GA 3TZ6A 5G0UA 4CLDA 3WGZA 3C7DB 1XGKA 3VVBA 2E49A 4A7PA 4Z6KA 3ZWPA 4GX2A 2NV6A 3VVCA 1DIBA 5EINA 1P3DA 3G1UA 3WBFA 4EGFA 4D41A 3HE3A 1S6YA 4UVEA 1AN9A 4EJ6A 2GSDA 1VJ0A 2B83A 5T6BA 4OOFA 3WYBA 3ETGA 1K6XA 3BIOA 3PWKA 1MLDA 3PRJA 4JBHA 4IDAA 2J5QA 3UFXA 4CV3A 4TMFA 1ULUA 4NBTA 3I3OA 3DZKA 2O4UX 4YB8A 4GGPA 3JQCA 1Z7BA 3GNQA 3JQAB 5K6AC 3HNPA 4AJOA 1PJSA 2BI8A 3SC6A 5B37A 4QQRA 1PJ4A 4MVJF 1Y8QA 3IS3A 4WLVA 4GI2A 5IAAA 3VTFA 1Q7BA 1XCBA 1XKQA 2GZ1A 3DBVO 3QLJA 4B79A 4CM7A 4CLRA 5A06A 5IJZA 5G0TA 4A0SA 3I6IA 3JYLA 2XXBA 5B4VA 4PG5A 1YGYA 1DOHA 2CDBA 3MCVA 1NQ5A 2GUGA 2Q3EA 4Q39A 2DPGA 1LTHR 5A1TA 2XF8A 3RUHA 4RLSA 1HTBA 3GZ4A 3INGA 4FSHA 3OJ0A 4CM4B 3UVEA 3KSUA 4BNHA 1F12A 4NR0A 2ZTVA 2VOEA 3UCEA 2Q2VA 4IIVA 4Y6PA 3H3JA 4YDRA 1D7OA 3NT2A 3H5AA 2CSUA 2HUNA 3U4IA 4ZQFA 1V35A 3LVFO 4KWHA 3KTDA 1B8VA 3HDHA 3NRCA 3RVDA 1VRWA 1KC1A 4DBVO 3EUWA 3RJ5A 1U2GA 4FJ0A 4J1TA 1SEPA 4LMRA 2GN6A 2C29D 4R9SA 4NFSA 1GUZA 3ROMA 2ZK7A 4BGVA 1Q7GA 3AI1A 4G65A 3GQVA 5ICSA 3AW9A 5ER6A 3JQGA 3EVTA 2JFHA 2OBYA 3FR8A 4HADA 3C7CB 4MDHA 4MVJI 3SLGA 1KEPA 3I9JA 1V3VA 1ISIA 5IZCC 3P7MA 1O9BA 2GDZA 1VSUA 4HNHA 3KXDA 1MFPA 3OIGA 3E48A 3GUYA 4R51A 1XHLA 5EERA 3FNGA 4LW8A 4J4HA 3VKVA 3PHHA 1QXSA 1GPJA 2UVDA 2J5KA 1HE3A 1VC2A 4IZHA 4GX5A 1X0VA 4J1SA 5COAA 3PGXA 2VHYA 3VPHA 3NTRA 2E4AA 5BNFA 2AEFA 1G6KA 2C20A 2GYYA 5IDWA 2EF1A 3E9NA 3WBBA 3S2FA 2GN8A 3IP1A 3JCZA 5IDXA 1PZEA 1B3RA 2NNLD 5KVVA 1EUZA 1ZJYA 3EDMA 3K92A 3QE3A 4A27A 3WMWA 2DBQA 3CUKA 1AGNA 3RU9A 4BGIA 1B7GO 4MKXA 3GVXA 2X1HA 3WGOA 3JQBA 3JQBC 4DLBA 4XDZA 4YJHB 1LDMA 1ZZEA 4J90A 1AUPA 3RC1A 1HETA 3E6AA 5DCUA 4OQZA 1P1IA 5JAIA 3GAZA 3RBZA 3EYWA 4ZVVA 1VLLA 2WYVA 2QZZA 1WXDA 1YL7A 2VRBA 4J4TA 3IC5A 3N74A 5ITWA 1HT0A 5EQFA 4DPKA 3IMFA 1TT7A 4UVDA 2CMDA 4CM5A 3TL2A 2EEZA 1PJQA 3W8FA 4CQMB 1EBUA 2BLLA 5T8KA 1CJCA 3RUCA 3WSWA 2DT5A 3G49A 4XB1A 4AJ1A 3U0BA 5L95A 4CMKA 2RH4A 1P45A 2DKNA 1VPDA 5MGBA 4TVOA 4RVUA 4KOAA 3UF0A 2IYOA 3EGOA 3I6QA 2FN7A 3F4BA 5JAQA 4AL4A 4CLOB 2O2YA 4DVJA 3JQFA 1NAIA 4N18A 2GO1A 5CG2A 5BSHA 3ENNA 1LRKA 1NVTA 1J4AA 3P2YA 1JKFA 4INAA 3IOYA 3R3JA 4E32A 4DYDA 3S55A 4OAQA 3PPIA 3JQEA 5I9MA 2VZ8A 1PGNA 3JQGB 1GZ6A 2HCTA 2D0IA 4FN4A 4O5OA 4ILKA 4CMBA 5BNIA 2FOIA 1M6HA 1E5QA 1JU9A 4MJLA 3WDSA 5CHEA 4PVCA 1I30A 4N5MA 4UULA 3RIHA 5IXSA 4DGSA 5CP8A 3D4NA 1YQXA 2QYTA 3MWDB 3H9EO 4ROSA 2EERA 2ET6A 1HE4A 3CINA 5F21A 4RPHA 4LVCA 1OAAA 3OA0A 3F3SA 4WCDA 5HWSA 4CLEA 4KQXA 5GY7A 1P0FA 1T1RA 3UHAA 3BYZA 4R9RA 2ILTA 2OOSA 4MVJA 3FN4A 4MPDA 4CLXA 8LDHA 1QYXA 1FDUA 1YBMA 3RUFA 3WR5A 4E5KA 1B3BA 1A4UA 4IZIA 3QVSA 2YZ7A 5JY1A 1ONNA 1ADCA 3DTTA 4CM6A 4OQYA 2AQHA 3D3EA 4WLEA 1W6UA 2C5AA 3A28A 3GHHA 3VPXA 1BDMA 4XQEA 5A05A 3PFWO 2BKAA 1YQDA 1U1IA 4NI5A 4IS3A 3TSCA 1GYPA 1C1XB 1MGOA 1HL3A 2Q1UA 4EEZA 3DZIA 3GVCA 4H15A 4IDEA 4FDAA 1ZBQA 4W9NC 1C1DB 2E82A 3GGGA 3INRA 4IXTA 2HSDA 1DJQA 3AUAA 3P19A 4YRAA 1RM3A 4FJ2A 3SXPA 3DHEA 3COSA 2C54A 3UKOA 4DIOA 2NTNA 4PLZA 1DHRA 2DAPA 2Y0EA 2H5LA 5TIIA 4FFMA 5C5IA 4GMGA 1FXSA 4NU5A 1PWZA 2J8ZA 5L3ZA 1GTMA 3U9LA 1KVUA 1LRJA 3ZWMA 1GY8A 4HY3A 3I4CA 2VUSA 1Q2XA 1ZK3A 2Q50A 1H5QA 2VUTA 1J6UA 1U3TA 3B1JA 4E2ZA 1SC6A 2WMDA 1I3MA 1TEHA 4AJ2A 4RO0A 3PWZA 4BVAA 1YXMA 1TI7A 4RQTA 4JJFA 1HSZA 2X6TA 1MA0A 3E5MA 1ULSA 2X58A 1E5LA 5G0SA 5LCXA 1C1DA 3ANLA 1T2DA 5L53A 3RD5A 1M75A 4L76A 4YACA 4R5HA 4NH4A 4G2NA 2X0NA 4J0FA 3CSDA 2DTDA 3D3WB 3ITDA 3QJ5A 5TT0A 2X23A 3WNQA 3D4OA 1N92A 3PI7A 4LSWA 4J3FA 4BKRA 4WASA 2O3RA 4CV2A 1ENZA 3MJVA 5ADHA 3FD8A 4PZCA 1GV1A 4ALMA 3L0DA 1K0UA 4L74A 1W4ZA 2ZB7A 1F17A 2HK8A 3NEPX 4M54A 2EWMA 2G17A 2YFQA 3BMNB 1MG0A 4CM8A 1NFQA 3F46A 3SC4A 4O1MA 3GEDA 1GR0A 5TC4A 1ZUD1 3QWBA 3O8QA 3ETEA 4NJMA 1C14A 2CZCA 1D1SA 3C8MA 1XDWA 3IAHA 1E3WB 3QVTA 5ENVA 2YQ4A 2OUIA 1LBEA 1W73A 3EW7A 3ZU3A 4A10A 5I7EA 5IG2A 4I1IA 1ZSYA 2O7QA 1A9YA 1UXJA 3EY4A 3DBRA 4BNZA 3QIVA 5FFFA 1VM6A 4GWGA 1WZEA 1P1FA 1Y5RA 3R1IA 4II2A 4BNGA 1PU2A 4IY1A 3PGJA 4Q3DA 3DC2A 3NX4A 2PKQO 4RF3A 4W7HA 2QRJA 3IIEA 1DSSG 1DJNA 1KIFA 2B4QA 2PA3A 4CM3A 1F8GA 3PYMA 1FDVA 1EQUA 1DC6A 3ZI0A 3PXXA 3ZU2A 2AG8A 2NVUA 3LK7A 1XG5A 1EE9A 4BO1A 3HDJA 1H2HA 2PD4A 3Q9UA 3UUWA 3X2FA 3A4VA 1HZZA 4D0RA 2YUTA 3C7AA 1AXEA 1DC5A 4KTVE 1LC0A 3IUSA 1JQBA 3SBOA 4XEHA 3D7LA 1JWBB 3KBOA 4QO7A 2IYPA 4DC0A 4E12A 2Y1EA 4WEOA 5IZCA 3P2OA 3PTZA 3QY9A 3K2EA 2QW8A 4YJGB 3I83A 3GVIA 2JD1A 4ND5A 4Q3CA 2AHRA 5U9CA 4L0QA 1X15A 3FSRA 4YBZA 4NG5A 4OMUA 1LX6A 4O6VA 4BHTA 3D64A 3S2GA 2JKVA 1YB5A 4ZRNA 1ADFA 4BGEA 1GUYA 4BUCA 4DC1A 3H5RA 4EDFA 4PLTA 4J16A 5CDYA 1MFZA 2I5PO 4UUOA 3H5NA 3TOXA 4ID9A 3AJRA 3DZJA 3M2PA 4YJFA 1YDEA 4CUZA 1YVEI 1QP8A 2CD9A 1C0PA 5TT1A 4BO6A 4ZICA 4DRYA 2I6TA 3VAZA 4HUJA 3ZWWA 3ICCA 4UUMA 1IUKA 2ZJ0A 5L4NA 2I67A 3QSGA
chains in the Genus database with same CATH superfamily
4JUCA 4OA8A 3AG6A 4F3CA 2H7XA 1S9HA 4AY6A 2PQ6A 1MAVA 2Z9BA 5AMXA 1SXJB 1HDEA 3VPAA 3JD0A 3VHXB 1J09A 2WP0A 4U7TB 4RHEA 3HVUA 1D6NA 1RCTE 1RBZA 1T6XA 2WMNB 1T9CA 3E9MA 4K81B 4MW1A 5LFAA 1WL8A 2HIHA 4XQCA 2IY7A 4JVLA 1GZHB 2GEJA 5MDHA 5HIIA 3A3PA 2WPNA 1PJZA 4MULA 3CUVA 2FP4A 4XPZA 4ZT6A 4CL3A 1BWQA 2I7TA 3HM2A 1X7DA 1HLFA 2V6BA 3CZRA 2AE2A 2BHNA 3A6HA 3JVEA 3Q7IA 3E8XA 3EHEA 2HPHA 3R8XA 2XA1A 1I0ZA 3KZVA 3IMGA 2VA8A 3PYLA 4HDSA 1C3EA 4LPKA 4PQEA 4EJ2A 1LTKA 3DZFA 1UWLA 3F49S 3RBAA 3U4AA 4NX2A 2JASA 5D1NA 1L9KA 2VK8A 2ZUUA 1X38A 1ZIPA 3AONB 4JEHA 3Q3CA 5F78A 2BGUA 3D7RA 1NMEA 4XIYA 1NI3A 1LSSA 2AFHA 2GKOA 1L5YA 3BT7A 4KK4A 1GKKA 1IFXA 1NBMA 2Q3CA 4JQOA 4RAOA 2EHJA 1KYQA 1NDQA 1Z6QA 2I2BA 3RVKA 3VC3A 4ARZA 4KQEA 1TQ2A 2DBRA 4HNTA 3G2QA 1LH0A 4JR2A 5EZQA 1BCRB 2Z2YA 4GP6A 1COZA 1VPEA 2YYAA 4KGVA 1CUCA 4Q7EA 3NIGB 4D4KA 5LIRA 3V1NA 4W9NA 1T9KA 2Y67A 4JX9A 3VJRA 1VBFA 3H2IA 1AKUA 4KGDA 1IMJA 1K97A 1VLMA 1CR6A 3PICA 3BMXA 2LKDA 2ISSD 4M89A 4KLCA 4NK5A 3QEBZ 1KHTA 3TH5A 2VH1A 2JKYA 4N8SA 3ST7A 4UTRA 3PFFA 3FBGA 2GAJA 3QXSA 2J6IA 2PH5A 5IAGA 4IGAA 3ZN2A 5SY6A 2IIPA 1CWUA 3DVAB 4P2GA 3NCHA 2F7SA 4GI7A 4EY3A 2ECKA 5IFKA 3DKRA 1OU0A 1WPXA 2P1RA 1Z15A 2PFGA 3KZ1E 4NCKA 1RYYA 1LNZA 1E0JA 1E5VA 5TY0A 4D3ZA 4QM6A 1DFGA 1PIWA 1G5HA 1QBGA 1TM5E 3CUTA 3GGCA 4JX8A 3DOFA 5CTJA 3IB6A 5JSZB 1MVNA 3OHSX 3MWFA 4G0OA 5LP6A 3I8XA 4PPQA 5CJJA 4OM8A 2Z09A 4AJ9A 1UMKA 4BQEA 2VNSA 3E9ZA 2VCYA 4CUJA 3BZUA 3HFRA 4GBGA 821PA 1Q22A 4S1WA 5SZIA 3N7TA 3O2JA 1K3FA 2YICA 4ZQHA 2IYFA 3H9UA 3UICA 5BRAA 3T94A 3I05A 1RQ7A 3LECA 2HYDA 1B76A 4CMJA 5JYEA 2ZTUA 4XEUA 1Y34E 3ODPA 1B43A 3ZDRA 5LPNA 3D2LA 1E5TA 4ZXPA 4OIMA 4ZCRA 3I39X 4WIAA 3ANNA 4EI2A 3SMVA 2HJGA 4QOFA 3EF3A 3NP9A 1WB6A 3UMSA 3K9BA 2C96A 4QXQA 1CUBA 1HE5A 1DEKA 1ZWLA 1F2UB 3QVKA 3QRWA 4LE0A 3RJ9A 2AR7A 3R9XB 3I5AA 1SD1A 4I8XA 1LPBB 1ENOA 1YOVA 3MWJA 2FG7C 3OOJA 4LG1A 1ZOPA 5TGDA 3X2SA 3PD0A 4PONA 4L75A 3VR5D 1XYVA 3Q9NA 2VSOA 3P9SA 4XJXA 3K1JA 1U0EA 1EFLA 2Q0QA 3T41A 3TZQA 4F21A 3OTOB 2PDAA 2WJ6A 2OXIA 2VTKA 1L5KA 2DUWA 4I55B 3T5CA 1MX3A 5A03A 1GYRA 2FLWA 5H59A 4COOA 2RMKA 3FWKA 4HQOA 3WGTA 2BJVA 4NCHA 3KQSA 1ZVVA 3KAPA 3RUAA 1BG6A 3TLBA 2GXUA 1U7HA 4DMLA 3LCJA 4JFAA 5FTJA 5CA0B 2V5VA 1Z17A 3TEMA 2NXCA 4WNYA 1LWNA 4Q7LA 3ZXXA 1ODLA 1ZC3A 1EWRA 4JL5A 3W06A 2WEKA 4CEJA 1QHHA 1W19A 2EP7A 2NSJA 2XNCA 2PSDA 2C7GA 1Z45A 5LQSA 3NTXA 1KJQA 2QM7A 3SHWA 1RHQA 3LQ2A 1SG0A 4X92A 3IBSA 4IX9A 2C78A 3A9RA 3GFFA 1IN5A 1COWA 4OFBA 6AT1A 1O95C 1EBFA 3N6VA 4HRAA 3DOHA 2IXAA 3UKJA 2ZSEA 2WJZB 4FMBB 1CUJA 4G37A 2L17A 2P2DA 5C18A 4NFLA 4F85A 5DXJA 1E2GA 1XF9A 2V65A 3K31A 3ZWYA 2QRLA 4NDZA 2JD0A 2ORED 3U39A 1T6NA 3VGJA 4IQ4A 1SWWA 3JSAA 2QZSA 3G9XA 5AI6A 4ZYVA 1G2PA 4FI3F 4MROA 3GZJA 4Y1RB 5FAXA 3THRA 5AM0A 4EY7A 1HFJA 2O54A 1RRKA 3GT3A 1GNTA 1U04A 3S6JA 4LZLA 3GEEA 2ZPAA 2QD1A 1XTTA 5D85A 2BBOA 4NXNB 1EUDB 4UM8B 1ML4A 2C1EA 5FBHA 3RSQA 3ZLTA 2ZKLA 3O73A 5IUKC 4B9AA 1G5FA 3BK1A 3NTQA 5BOVA 3LRPA 2AF3C 4UNRA 4B3IA 2IEIA 3BD8A 2QA5A 3F9RA 3JQ9C 4LGMA 2R8XA 4LXUA 4BYMA 4B82A 1UOQA 5HFAA 1Z73A 2JGAA 3H87A 9LDTA 1XQYA 2NUAA 5AVWA 2XKKA 3JQAD 1QP0A 3KB2A 1QZXA 3GN1A 1XTKA 2C0QA 3JV7A 1HZJA 1VECA 5J47A 2O1SA 2P1DA 3E9CA 4Q4JB 2ZAOA 5TX7A 2XPCA 2GEFA 4IFBA 5DM60 1ZRSA 1GPDG 2VJLA 3SFZA 4HWSA 4B4UA 2AUNA 4AAYA 1L6RA 3NHMA 2EARA 3NWBA 3Q2KA 1E0SA 4IMRA 3TI7A 1BJKA 3LP5A 1EFPA 1JG3A 4Q9NA 2O3JA 1UKZA 3M33A 3IUYA 3SJ7A 4E2XA 2LV8A 2E18A 4EPTA 3P94A 1SKUA 3MRTA 1DWQA 5ILGA 3DOCA 4JOQA 1I4EB 4FDUA 1EXDA 4TPKA 1XMOB 1PK8A 4EABA 2IUSA 3HLTA 3KOUA 1IN7A 3FKSA 3LC7O 4CMIA 2UUBB 4NBRA 1KJIA 5F5XA 4CTOA 4XD7D 3LFTA 1CY8A 1L5NA 3O8CA 1OIXA 1SOAA 5AVYA 5HBGA 1M54A 4YIKA 3ZKWB 5EIWA 1TTTA 4NBKA 1X9GA 2W37A 1JHYA 2I1WA 2UYQA 1SN7A 4KPGA 1GQQA 4H3SA 3DEYX 1E1KA 3Q0EA 5JV5A 4YP6A 4NNJA 2AI1A 3AMVA 4Y2HA 2MYUA 4R8MA 1G5TA 4EOGA 1BDBA 1DZIA 2CXTA 1BVRA 1CQJA 4EARA 1TVKB 1NHWA 3DFMA 4HOYA 3VV2A 4US2R 3VPFA 1HT3A 1KR2A 2VJQA 1WCV1 3EPPA 3SYMA 3ZHUA 1UK6A 2GPJA 2VDNB 4EKIA 3CU5A 5EIBD 3HBJA 2JCXA 4JLVA 5JEDA 1JBKA 3KOWA 3WX0A 3I2KA 1GEGA 2QGFA 5DK6A 1GT91 2J9XB 2DBZA 4JOBA 2B6NA 3MRVA 5FPYA 1VJTA 4IO0A 2PIAA 4XUDA 1KO1A 2ZYRA 3WLAA 3KYJB 7YASA 4Q9KA 1EWVA 2Q9BA 4P4TA 1TQHA 1GL3A 4G97A 221PA 3PXGA 5HYVA 3HXOA 4FU0A 2H1FA 3S8YA 1YE5A 1Z74A 1DC3A 4F45A 4RTMA 1DMSA 3WB1A 2GDJA 2ZZKA 3QHAA 4UNQA 3GZTB 2YWEA 2B3DA 3EXHA 3NDRA 2DFLA 3UOWA 1YZTA 4CMEC 1QNLA 4ZCIA 1X1CA 3TTUA 1V5WA 1WMBA 3Q6NA 2TSYB 3IXQA 4Y9SA 1M2OA 4I50F 4FGSA 2QP9X 2JZCA 3JQRA 3SNHA 1G1AA 2FX2A 3VPDA 1OVGA 1NQTA 2P91A 4FX2A 4QRIA 4EQZA 1EE1A 3ID6C 2MYTA 1ISPA 4EGCB 1YSCA 1CZKA 1SM4A 5DHUA 3DMDA 4K9LA 4RYLA 5BR7A 1BVUA 2GBIA 3M7IA 1P9NA 1LXCA 3W3AD 4WN9A 2JIPA 1SCQA 2WSYB 2QDXA 1ODCA 3RRFA 4CKCB 3P27A 4EY5A 1ONBA 1WZ2A 1K0FA 3KTOA 4LA4A 4O63O 4C3VA 2YXPX 3V8BA 2QSJA 3K9WA 3WIOA 4M60A 4QVKA 1Z26A 2FDXA 4G4JA 1QTNA 1YDHA 5GWXA 4YR9A 1J70A 2O1EA 4YJ2F 3NBQA 2QRUA 5AKYA 1OAOC 3A3KA 4LHEA 1ENYA 1W5FA 3SE0A 1ISRA 3P0IA 1Y9ZA 2ZBRA 1ISSA 1DKPA 1LBHA 3NI2A 4H0NA 1XD2B 5BVGB 1U63A 4DN6A 1TU0A 2PVCA 1E6WA 1QIHA 4KLAA 2XGMA 4CQJA 1N32B 1S1CA 4G0XA 1UKCA 4ADSG 5J59A 3UAYA 4BKPA 2AJCA 1U2SA 3CRQA 2G70A 1R15A 1N1EA 2CNOA 1U7UA 3OQIB 3Q98A 3HKBB 3EEBA 3TSZA 4UAJA 4FMCB 2X5KO 1G2OA 4FBLA 3P4UA 4OI1A 1O95A 2ZYGA 4U6NA 1A9ZA 1ZD8A 4HG2A 3UGTA 1RC8A 3LYAA 4HJXA 4JUFA 3EXFA 5JE8A 2G83A 5REQA 4EA7A 3HRKA 4JT4A 3F8SA 3H2KA 3RK0A 3BXXA 1QKKA 3B1KA 3R24A 4QYIB 1DTEA 3MWGA 3RFCA 3N76A 4ENTA 5HILA 3HUDA 3WIBA 1NJ8A 4YS6A 4E08A 4O8CA 2FV8A 2AHOA 1JXOA 4Q3BA 4X3OA 3O82A 1SCUB 2FQWA 2IYYA 3PP8A 3C1OA 2CBGA 5DW3A 5F3RA 2XDYA 5I7HA 3AFGA 2AWOA 1YRAA 4M9UA 2VHTA 1KAQA 1OH5A 1IYZA 1T8YA 2I3BA 3V3KA 3VH4A 4AWAA 1ZCZA 5DFAA 5JZMA 5AVQA 5L4SA 3HVKA 4UM9D 4D42A 3ENZA 4KB5A 1ABFA 1J25A 3N0VA 3VH3A 1PQYA 4FYWA 5SZJA 4QM7A 2C95A 5ECGC 4QOJA 4PICA 1TIKA 3CN9A 2P9BA 3WL6A 1J8QA 5ITVA 1PS0A 2JANA 3OETA 3C7TA 2J85A 2EZ8A 1L7MA 2YS7A 3BGWA 2Q99A 4AO7A 1JSCA 2X0IA 5FEUA 3E3MA 1KTIA 2BFFB 4ITUA 4NECA 5COQA 3L0SA 2J9YB 3SCZA 4Y1FA 3GGOA 4HTAA 3SDBA 3SR4A 4KPEC 2V1XA 4RHUA 1QFZA 5JFOA 4U6SA 3S40A 3PRKE 1T1SA 3N2NA 4HFNA 4C4OA 5CFLA 2Y92A 2DY0A 2NACA 3AKEA 3HBFA 3OFJA 5AM4A 1QGED 1N25A 5EIHA 4RTNA 1E32A 1KIAA 5FL7D 1P6UA 2R85A 3HXMA 2KS6A 5DN6A 2BHRA 3E82A 1U6IA 4I8IA 1IJFA 2REQA 2Q6LA 2UUPA 3LX5A 4FGJA 2FZCA 3D2AA 2XWQA 1V0JA 3NYQA 4YCBA 3DEAA 4GF5A 5CNIA 4J7CA 4J2TA 3B51X 2YJZA 2XYPA 4NCNA 3OY7A 1O94A 2CVFA 1N9ZA 3COPA 5LZ2A 1XO1A 1STOA 4D02A 1T8PA 1W5AA 2HMSA 2V7EA 3K7EA 3UWDA 3J80A 3QVGB 2PRZA 3GXBA 3HRIA 1PFKA 3LA6A 3WB9A 4MGZR 3WIEA 3WLOA 4BNVA 1A7AA 1DG1G 1B0PA 1V1MA 2IYLD 4HGYA 5B1DA 4ZI7F 2AN9A 1HLDA 4I5IA 4M0LA 3PYXA 2KPOA 4LXXA 5M7EA 1EUQA 3ZE9A 4E22A 4U0JA 3HA5A 1Z8NA 1GQFA 3PUZA 1YS4A 4Q24A 2QNRA 2C88A 3DE7X 3KEMA 3ELDA 3O1LA 5I7FA 4WXHA 3L4EA 1U8XX 3TZEA 4BVEA 2V7GA 2VTVA 3W1WA 3EH2A 3CZMA 1JZQA 2BRUA 2GHRA 3QPVA 4LK2A 2WIBA 4UOQA 4EAQA 4HAWA 4DV0B 3O3MB 2BFAA 1YDMA 3NWPA 3VHLB 1SA0A 1A27A 2E3JA 5SZKB 4R01A 4RK0A 1KGSA 3OVMA 4A8JA 1PGOA 2HO4A 5IUJC 6LDHA 1TA0A 1JA9A 3GUCA 1SC4A 4C4TA 2YTZA 3BH0A 3MEQA 4TRNA 2ZE7A 1C50A 4AURA 4OFXA 4B2IA 5JDIC 1P7YA 2VS1A 4JT2A 5TDHA 1DKOA 2A9QA 3O7MA 3KJIA 1GZSA 3C3PA 4I5FA 3STYA 2FF5A 4TTTS 5E4TA 1QLWA 4MIYA 3DAPA 2WU0A 1CRPA 3L6EA 2Q0HA 1KOJA 3QMVA 1X2BA 2AOXA 2VYVA 4LJSA 3LT5A 3RVNA 5KQPA 1J5PA 3L0IB 4QUAA 3C7KA 4RFSB 3DV9A 4DJ5X 3THSA 4RPKA 1FPMA 1GVHA 1NOKA 2PL5A 3OQPA 1E94E 3BG5A 2DBYA 2SCUB 4V0KA 4F7DA 4X8HA 1H23A 3G2NA 1OX4A 5JMWA 1JKJB 3FPGA 3KKMA 3WYGA 3GH3A 3IHTA 4IKOA 2DFKB 3B7WA 4I66A 4UARA 2UXDB 4L6CA 4ZARA 5TXGA 1ZP6A 2GCEA 4PNZA 5DYTA 3DYVA 4BO0A 2WJAA 2IQ5A 3I09A 1IPHA 2CB0A 3HA3A 1VKOA 2JG3A 1DTSA 3KHUA 2YXDA 3H11B 1SPBS 1MVOA 1T1EA 3IQWA 5EMJA 1E1NA 121PA 1K6MA 4JL8A 3CLHA 4H1UA 5KVAA 4CFZA 1RYZA 3FBWA 3QUSA 3I01A 4BBPA 4CMAA 2Z8XA 2JEYA 3KQVA 5HQ3B 1Y6QA 1EWTA 2QRVB 3NNDA 2GA8A 2OP0A 1ZQ1A 3OWHA 1J7KA 1H5NA 3CLKA 4OP1A 4WNIA 1SC9A 1ZOOA 4OD0A 5KNBD 4Q48A 3GBPA 4JMPA 3BHJA 2C4WA 1RRCA 5K6RA 4TKUA 1ZK4A 4G63A 3R3ZA 1TZCA 1H1LA 1L4UA 4GW3A 3WS7A 3O4RA 5BWCA 1O96A 1KXZA 2V0GA 3LVQE 3P0RA 1XK7A 1NASA 1DI0A 5GJWC 2JBWA 3A3OA 3C6BA 3PHBE 5B57C 1T2CA 2ZVQX 4L8FA 4PZPA 5DULA 1EQAA 1U94A 1UKAA 1K8ZB 4K2HA 1CRWG 4AIIA 4AUNA 1E18A 2NO1A 4ZMRA 5JNWA 2DTEA 3BXGA 4Z0PA 2PZBA 3WKBA 2FPSA 1DIHA 3BGDA 4KH0A 3O9ZA 1VJCA 3QLTA 3WRVA 3GNLA 3ZNPA 2OL4A 4ETMA 5CB4A 2GZSA 2QVGA 5IWCA 4CNQA 3L8GA 4R8KA 2QLFA 1DRWA 3O8DA 3WDMA 2Y4OA 1G98A 3D59A 3X3HA 3WV5A 5B4TA 2L69A 1PLKA 2GN1A 3ZJ5A 5D7NA 1NMQA 2NZYA 5K0CA 4CG0A 1A5TA 4G86A 3RVOA 3X2EA 2YIJA 3PUKA 3OZ7A 4Z4FA 4QHSA 3MGCA 1F6DA 5AR1A 4HNQA 1BX0A 3ME5A 1BROA 2A9RA 5BMVF 5IMSA 4M53A 1R0RE 3I9MA 1KFBB 4YI3A 4E15A 3CR3C 3M4XA 2HXGA 2ZYUX 1VE5A 2G9QA 3G1WA 4ZVPA 2Q3MA 3FAZA 3JZFA 3PSAA 4TQ9A 1Y8CA 2CUTA 1M6EX 5HPYB 2XMQA 4IJKA 1P0PA 2JLCA 4KO8A 2HIAA 4NV3A 5EJMA 4RHYA 4RJIA 3HM9A 5EC8A 3FYHA 1A8QA 4HX2A 4TKLA 3W5HA 1SQSA 2JFWA 4DR5B 1IAQA 2BSXA 4ZVQA 3TBFA 5BRJA 1T35A 3QEKA 2PA0A 3D8TA 3VMMA 4IQ8A 1LSOA 5KAPA 5AW4A 3TGPA 3LVRE 1JWAB 2QT9A 2ADOA 3NONA 1D2AA 1JJVA 2OILA 5CFRA 4JBNA 4WKNA 1HOTA 3A06A 1N9KA 4RKRA 5JH7B 5KJ1A 4Y98A 1T2FA 2IZ1A 2ZB4A 1SOWA 1BMDA 1ZIXA 2DWPA 4I1YA 1Z6ZA 3R3SA 1UUFA 3BIXA 2WWIA 1MQAA 4LWZA 1FC0A 2OZPA 4H60A 4H7PA 4YRPA 3TOSA 4H7HA 4EP1A 3BMOB 3T06B 3JS5A 3RHTA 3TCXB 1LDBA 3TNLA 3B7PA 3AL3A 1O9GA 2WIDA 2Y4NA 3EUEA 4NFHA 3LBNA 1V3TA 3LUFA 2WJPA 1T3SA 2YXNA 4FD2A 4WXEA 4EG0A 5BN1A 4RACA 5FR2A 3T9BA 1GDTA 1G8MA 3BWMA 5KHLB 3FSEA 4KXXA 3FTPA 1KKUA 3D7MA 4MWBA 1W30A 4Q4HB 5IF9A 1IZ0A 1K6IA 2G08A 2GETA 2FFAA 2R4UA 3IQFA 3PGLA 2W8BB 2XZDA 2ZRDA 4M9SA 5FOSA 4FZVA 4HYTA 5J5AA 2WWFA 2QN9A 8ATCA 4U7HA 3TLYA 5C1OA 2F90A 4JJ8A 1R6BX 2HMYB 2F17A 1OFTA 1KQOA 5ALTA 1E1QD 1E1LA 3QLEA 4L3WA 2DH5A 4JC8A 3HCDA 4O5AA 1F2TA 2F3TA 1LFDB 3MT7A 1HY3A 4QQKA 1L4EA 3RS8A 4JP5A 3X44A 3W5AA 2FUNB 2FR0A 1RRGA 3A4YA 2W2XA 4KN6A 3DHWC 1MA3A 2Q2QA 1WHSB 3V7FA 3MCWA 2AFIE 4GMXA 3W4JA 4RU1A 3ZZNA 1FB5A 4A73A 4DV6B 3PDCA 1NC3A 3JYHA 1QHYA 1ZUNA 2E5LB 3A7EA 1PSWA 5FNVF 1XROA 2BUBA 2B2XA 3QX7A 1SQFA 3U09A 1DQNA 3QF4B 1LS6A 1YS7A 3A37A 4NYIR 1FMJA 2GFHA 2OAQ1 3PNYA 2XHEA 3PIRA 4H6VA 1E2EA 3JYOA 2GPBA 3BSFA 4MR9B 5EE3A 4QTUB 5HIAA 1CNMA 3H84A 3Q12A 4HDCA 1N2CB 3AERB 4FYVA 1CF9A 1XCLA 3TSWA 3BERA 2NSLA 3AP1A 3IHWA 3DO8A 2D7JA 2R1VB 2VDQB 3JD1A 3CBGA 2ESRA 2C2MA 1U0SY 1N8KA 3LBYA 3OE7A 4GICA 1WOYA 4YRFA 5KOHB 3OEEA 5K0BA 1XHFA 3QITA 1E6KA 6REQB 3QYFA 4KQ2A 1XUOA 3CRW1 1TM2A 3OPYA 2Y0BA 2X0KA 4EENA 4RY8A 3RG2A 1MJ5A 4EJ0A 4LMBA 5ISMA 1MRSA 4HH4A 3F7OA 4FNMA 5AXDA 1RM0A 3MOSA 3ZIDA 2JIDA 3IEPA 1U9IC 4QJIA 1ZMRA 1EG2A 2AD1A 1E8DA 3TLMA 1WDWB 3E15A 5E9AA 2K2WA 4U7DA 1C5KA 4JXXA 2GCOB 1GO2A 2QDKA 5PNTA 3UJDA 2FWBA 2WJGA 4W1SA 2W2KA 1UC4B 2OZEA 4W5WA 4BZWA 1RWKA 1KYYA 4C1BA 1DMRA 2X5NA 2ZUBA 4M8SA 5GVRA 3TZKA 1YBHA 1PT6A 2FCRA 1WXXA 2LBPA 3C48A 1NJ5A 3R7WA 4IO1A 4N6NA 4A82A 4R71A 3OI7A 4UREA 2ACWA 1Z6GA 3IPCA 3W5UA 1RSZA 1EDOA 4PC1A 4Q1VA 4ENWA 3WGGA 1L7NA 2H3EA 4NIMA 5F64A 3ESQA 5FQOA 3G1TA 5KYWB 5M5BA 4R9UC 1V96A 4CM9A 2PKRA 2PYZA 3DO5A 4LJ6A 4CKBA 3U5TA 1X8KA 4ACAA 3QY0A 5AQEA 1W44A 1T8TA 2VQDA 2TS1A 4Q3NA 2EV9A 1PTKA 1ETHA 3G17A 5BWOA 1FX1A 1S02A 3IQEA 1M73E 4D46A 3AEXA 3QVOA 1P3Y1 5BQOA 4C0QC 1UWCA 3EC1A 4JOCA 3V9PA 2VDWA 2XJ4A 2ZT6A 4OQXA 4BFUA 1OXTA 4RIGA 3STVA 1LBTA 3BX1A 1E9FA 4WCFC 2BGKA 4X90A 3N39C 5THKA 3CVUA 3QBEA 4LXTA 1U7WA 1WY5A 3MINB 4WPGA 5TLSA 4GOMD 1E3WA 2H65A 5BV2P 1GAJA 3KFXA 1CUHA 2BMAA 2C84A 3HWX1 4KRGA 3HCOA 3VOAA 2ZJFA 2VP2A 1MOSA 3GK3A 2KLBA 3H65A 3QPCA 3M5PA 5BMVB 4GUAA 4AVYA 5HS6A 4CV0A 1XNRB 1EYZA 4IJ5A 3A04A 1KH3A 1U8CB 2RHGB 1CSEE 1KAHA 2WKSA 1M6VA 4LDAA 2CVOA 2DBVO 3W6UA 4E5NA 1RWBA 3C45A 4HDAA 5KOJA 5E6SA 2F1OA 1IPEA 2XTAA 4HAXA 3KUKA 3MGBA 2I2FA 5CMLA 4XE5A 1EWQA 3MXTA 4Q9DA 3ZDXB 2FMXA 3CW8X 5LOVA 4LF9B 2AZTA 3D3NA 3H04A 4JNKA 5AD1A 1GL7A 4MRSA 1J2TA 4ZKDA 3V4VB 1T8WA 5ICMA 1NRXA 4MV5A 4P3OA 1P1JA 1V2GA 2O1XA 2W70A 4Q6BA 4BV9A 5HUQA 4E5VA 3DBLB 1FYVA 3O4FA 1GFIA 5CYFA 1E66A 3ANYB 3OPQA 3PUYA 3WXBA 1D5CA 5HZHA 4KUGA 3U17A 2UZ3A 3A9WA 1A98A 2Y6UA 5CIYA 5IC6A 3CLTC 3H4VA 4TGLA 4S2UA 2H17A 4YPVA 3GCXA 4CKZA 5F2EA 1V11B 2AD5A 3KHSA 4BOYA 4CNBA 1D6MA 2AG0A 2BFOA 1NUTA 1ONPA 2OHGA 2IXDA 2DQSA 2AA3A 4GRDA 1O6CA 4AJ4A 3B2QA 1KP3A 4OPMA 4OQMA 2IP2A 1R6VA 4P86A 2FZEA 3WV4A 4RDXA 5K8CA 3ZXSA 4XQ9A 1NZJA 1HG0A 2BDEA 1AN0A 1ODKA 4YWHA 3RYFA 4F8EA 4MGYR 1QFYA 4C7XA 4YQEA 2VH2A 1DBQA 2HY7A 5KX5A 1PLJA 5KWEA 3DF7A 5M29A 3EB9A 1FTQA 2QPTA 1QORA 1CXZA 3I04A 1YE3A 4FWTA 5JQGA 1K4KA 2BAGA 4KDRA 4QNRA 4TWJA 3I2IA 5ILQA 1C0LA 1VB3A 5SYNA 3BHNA 4CLHA 3DYIA 5H70A 1XQWA 1LDYA 2YDXA 3EZNA 3AEQB 4MMZB 1E6EA 2ANBA 3SLKA 2RGGA 1JIXA 2QL7A 2XGSA 3KE8A 3UJAA 4K9RA 4XVHA 1RR6A 1SQ5A 3H97A 2F8SA 1UP7A 1UBEA 1XRJA 1KK0A 3CO0S 1D2NA 1XR3A 3OLXA 2A35A 4FP9A 4ZEWA 2ZZNA 2FUG6 2IYAA 4P4SA 5FD8A 2JFGA 5KJEA 5C4IA 4AJHA 3ZX5A 1FNDA 4JXJA 4F9GA 5JJCA 3ICVA 2CE7A 3PE4A 3BIJA 1QVRA 3RKRA 3OT4A 1RJGA 3A6DA 3L7IA 4R8LA 5TQ2B 1MU0A 1XEAA 4KEAA 2B8JA 5IVKA 1X7YA 4Q03A 3G8BA 3V1YA 3DT8A 3RC2A 4AKTA 1F3LA 1E89A 5HRAA 3ZBPA 4DMRA 3C98A 5IT9A 2AFHB 2OWDA 4BVLA 1R2QA 3BF7A 3TLGB 3EGDB 1OLSB 4JQCA 1A71A 3G6WA 1J97A 4F4FA 2NUBA 4FYMA 3B6JA 1J33A 3N2LA 5LQUA 2CFTA 1NL3A 3MGKA 5DGCA 1DQPA 1WVIA 2BTQA 4Y2UA 3GQBB 3ONNA 3Q6IA 4E03A 3FTFA 2GF9A 3LV8A 4X1KB 2I1QA 3MT0A 4DAEA 3K1ZA 2W42A 4TSRA 4ZAVA 5NLLA 4W5HA 1L5ZA 4Q4HA 3C5EA 1OD6A 1F0PA 5G53C 4WCFB 3SPXA 3AUJB 4LDPA 5ICFA 1A9SA 2V8OA 4LPSA 3NETA 4N5NA 2KE5A 1XEFA 1QMGA 4F5DA 1YASA 2I3DA 4W8GA 1XTBA 2LPMA 4Y6OA 2V4ZA 1QF6A 4ND6A 3CEMA 5KO2A 1Y3FE 2NU7A 8MHTA 4QPNA 2ODEA 4IHKA 1DXYA 3CG0A 4FILA 4LNUA 2PHZA 1Z4JA 2O5VA 2VP5A 3JVDA 4PFJA 5I4CA 1FRFS 1JFVA 2NVWA 4Z9YA 4BWVA 3IEMA 3MB8A 4F4HA 2W98A 2KBFA 3LBHA 1PYOA 2BP7B 2PM8A 2WJ3A 3L6DA 1QIFA 2I76A 3AHIA 2OGUA 4FE7A 4G3XA 1JG4A 3DAOA 4HFRA 4RF2A 5JWRA 1KVSA 2CJWB 3PC4A 4GPIB 1EBBA 1M33A 2IV3A 4BQRA 4PYKA 4CJXA 3ZR4B 2HSGA 2ALJA 1UJMA 2EFJA 3F6PA 4L9AA 2WF7A 3K2QA 3K5IA 1H6CA 4QX6A 4QNNA 5ELMA 3L7LA 3KU1A 3UGQA 3V1TC 4ZZ1A 1ZK2A 4CIYA 2AZXA 3EVNA 2JH8A 4BO9A 1X94A 1NUQA 4UCQA 4C88A 1VP3A 5A5DA 3VBEA 1N6IA 2OBFA 1DBIA 4JJKA 1RAGA 4B81A 1IY9A 3AY7A 4MWDA 3WMEA 3RVQA 3WDKA 3OQNA 3ZXYA 1MT3A 3ZZTA 1F8YA 4TLCA 1F9AA 3BFKA 4A03A 1JVSA 4DNPA 4I9FA 4J07A 1JEYB 4XIFA 1NI4A 3BM5A 5DHRA 4FM9A 2JKZA 4TTVA 1GSHA 1CIVA 4B3BA 3DXYA 1E79A 1VYVA 2AG5A 3DE1X 3ZHRA 1RWVA 1F6WA 5CDFE 4WK4B 2ZE6A 1UOOA 2CFSA 2NLOA 4MXDA 4ZGGA 5D87A 1HNWB 4V2UA 4NPHA 3SK0A 1Z2EA 3ELWA 2GMWA 1TEZA 1QO0A 1WW3A 4HQLA 5EIOA 2PLRA 2GLUA 1AJEA 2AQ8A 3S2YA 4CQNA 4MINA 3O8RA 2JLUA 2PS0A 1S3IA 2A7QA 4L4YA 3OTGA 2B0JA 1K4YA 4WNCA 4FD3A 4YJGA 1P0QA 1IJBA 1T2UA 2W6CX 2Z6QA 1EDBA 3M6IA 4P4GA 4RL6A 4M2LA 3ORSA 4L72A 5EN4A 2W2PA 5DCYA 1MOPA 3RBVA 1U3FA 1YDWA 3P0EA 4MKHA 4DUYB 4ZHSA 2CDCA 4FNAA 4KXLA 2IZZA 3BJMA 4YUXA 3GC6A 2V7VA 4E94A 2OCBA 3AH8A 5LOVF 2B82A 3A3YA 3D8NA 4AYXA 4EHFA 3UPDA 2D74A 2BELA 2Z8ZA 3QFSA 2Q7DA 2PL3A 5A6SA 1K88A 4CEJB 1T0JB 1Q83A 2F9MA 1U8TA 2G1AA 5IAOA 2VDLB 3AGQA 1NT2A 1TRKA 3DE5X 1QO0D 4PLFA 4DRXA 3PVZA 1CF4A 2HU2A 2VF5X 3R23A 4DR1B 3PC2A 1GCUA 2C42A 3VHXA 2PX8A 4HN2A 2RI6A 4BGUA 3QWIA 2DVMA 3JTEA 1EGQA 5ELLA 4KL8S 5FBVB 2EX0A 4QYXA 1IVNA 2UYHA 1ZL0A 4QAJA 2FK8A 4ZJZA 3UAOA 4PAOA 4MVJP 4DR2B 3N8DA 3V8QA 4CIDA 3SG0A 4DM7A 1Q92A 2VWPA 4MHOA 4HVCA 1MV8A 1YRBA 5CDTA 4Q93A 1RI2A 2SECE 5EMMA 3ON5A 3QM1A 3PXAA 4Z9FA 1VI2A 4PXAA 4ARVA 5EJIA 4CIBA 1ZNQO 4ZEVA 3USZA 3ASVA 4PTYA 4YRMA 1M1YA 1NW8A 1Z0SA 3PGA1 4PLCA 1PUIA 1VPVA 4KMSA 1VJGA 1U2RA 4BQNA 2JLWA 5E6RA 1GITA 3WGMA 1YJ8A 2WHYA 4BIIA 1SU7A 1KU0A 1N5IA 4LK3A 1JTEA 3D6VA 5FLYA 3IO5A 2AQIA 1RHUA 2RGCA 2LD4A 4M6WB 4MIOA 2QAIA 4PSUA 4YP9A 1KVQA 1AHIA 4YP5A 1S9DA 3Q7RA 5ULLA 1K98A 4MNTA 4ZOLB 2ROQA 2NU9A 3T0IA 7AT1A 2AMVA 5A02A 4HDKB 3LQRA 1VGVA 4UHEA 2EP5A 3B5EA 4EYEA 3PJRA 4NV1A 3W7AA 1RKBA 1KKMA 5IZ4A 4B3XA 3N3AC 4IUYA 1TW2A 2D2EA 3FMIA 2FCAA 2ZIEA 4RS3A 5D3MB 3ZIAD 4EECA 1BFDA 3EZ2A 3Q5EA 1IRIA 1G3MA 1UWKA 2C9YA 3WSTA 2REOA 3B20A 1HRDA 2BTQB 3CEPB 4LYDA 1OX4B 2HNKA 3H6GA 4M37A 3RT9A 4GXTA 3K0HA 4LCEA 2ID9A 2VJMA 3SJUA 3T4UA 3ZZ0A 3JQ9A 5K5EA 3DWIA 2E85A 3F5QA 4TRJA 5JRZA 2XBLA 1L5SA 3FPSA 1ZIYA 3JWPA 5BN5B 1TC1A 4GLBA 4LVNA 1PNVA 2PS9A 2IDJA 4KI0A 1AK2A 3VHRA 1SWVA 2CLEB 4NBNA 3HU2A 2QLNA 5T3YA 2W6ID 5AIBA 4EITA 2RFLA 5AKKA 3WDLA 1Y81A 1SA0B 4KJXA 4W99A 3UK1A 1W581 4YT4A 4P7KA 3HO8A 4NATA 4DE5A 1T9DA 2HADA 4RVFA 1OB5A 2YCLA 4EKGA 3QU4A 4MKFA 2QMUA 5IKMA 3KT3A 3D7KA 4BO7A 2YS6A 1SXQA 3U62A 2C9BA 3COVA 1GAXA 3NKFA 4FT4A 3AHGA 4V3BA 2R1VA 4R69A 4RZ3A 2XD9A 3RIYA 3WIDA 1VPTA 4A0QA 2IHNA 2CV0A 3OJFA 3R74A 3ASYA 1W5EA 4G0PA 2CNKA 3D5EA 1N2CA 1KJNA 1UKEA 3AERA 3GMIA 3W79A 5MN4A 1ICEA 4BWGA 5F2KA 2QD4A 4BNJA 1GD1O 4NU8X 5F1PA 3TFOA 3OOWA 5JPIA 1XJQA 3OIFA 4DA9A 4ODIA 1PJ2A 4L5JA 1VP9A 1RIIA 3VUFA 3DE0X 1VXOA 1IUPA 1N6OA 2QTLA 4EWLA 4FB5A 5JC8A 2JH9A 4WDRA 5EJ8A 4AI6A 1ZSNA 4HDNA 1H8HA 1HWYA 3FDFA 3PC3A 4EUNA 3KLMX 1J23A 2WF9A 1FYWA 1Z7WA 5FL3A 4GOKA 4FQ8A 4TTAA 4XLTA 5IBPA 2W2MA 4BLRA 5JFGA 5JCPA 1BJRE 3CCBA 4HS9A 1UJCA 2J7PD 4G5XA 3HCFA 2EDCA 4N6GA 3TL6A 1QRUA 3EXHC 3EQ8A 1XZFA 3FJYA 3QUAA 3PQ6A 4PGHA 1YQGA 2UAGA 1VJ1A 4FZ5A 2YWGA 5E8JA 4IV5A 3CTPA 3M9LA 4IMPA 4PLWA 3R6GA 1FOEB 3I4LA 1MRNA 4JU9A 1ZMTA 4EUEA 1SHJA 2PGDA 2REBA 1Z4QA 1GM5A 3LT2A 3ND9A 2GPTA 3MLAA 4N7RA 2BR4A 3V2HA 2CMFA 4RCYA 4B7AA 1RJDA 3BFPA 3OO0A 2QF7A 4WUTA 4CUKA 4GI3A 2DH6A 3RSGA 1NE2A 5KYUA 1F60A 3RPEA 3DSRA 2QOEA 3E4DA 1SXJC 1QDLB 1XE3A 2ZB8A 4NY1A 5EP3A 5AJWA 1W8DA 3CUWA 3WB0A 3HLKA 3S70A 1QM5A 1KDRA 3WVNA 4QDOA 1WF6A 2XUQA 5HJ5A 4LHZA 4ESVA 5F98A 3AFMA 4F4CA 3I76A 2PS1A 3REFA 4ALIA 4GDFA 3FPBA 1AUXA 1Q7CA 1T8UA 2JFFA 4PGFA 4X84A 2VUIB 4P08A 1ZVKA 1YA6A 4CYMA 3EBOA 4QVGA 5EJ7A 3CB4A 3LK6A 4AC9A 5D6OA 3GLFA 1F20A 2DLNA 2D7CA 2QTWB 2VNAA 1CZOA 3LKDA 1LVHA 4ZJUA 4KC0A 4CDRA 3NPAA 4IF4A 1IEQA 3DLTA 4HATA 4K9QA 4MJ7A 2AK3A 4L5AA 1IZYA 1F0KA 1BE0A 1QV9A 1WSAA 3DL4A 3KALA 4ML3A 3RABA 4C7BA 2B69A 2ACVA 3PNSA 4BAUA 5IXYA 4A0RA 1H0RA 1RLOA 3UOAB 4WW0A 2CFOA 2YFKA 3ICPA 2C2XA 3SHTA 2AOTA 5B1EA 2QTVB 1DC4A 3W5VA 1CF2O 1KEVA 2MHCA 2ZDGA 1EUCB 4BEVA 4L4RA 3DZDA 3E61A 3PD7A 4IGEA 5DI9A 5LSAA 3ZI7A 3LZ6A 5EJFA 1XT6A 4Q47A 1SRQA 3UCFA 4AMGA 3PEYA 3CRNA 1NN3A 4D8TA 5EWJA 1UINA 5BY2A 2P2NA 1T0BA 2OZLA 3WRYC 4KN5A 5E38A 3NAZA 1HQDA 2Z2IA 1HZZC 4LJ7A 4EMUA 4GVLA 3U9TA 5CT9A 1I94B 1B14A 4FWBA 2PCLA 2VSQA 3TW8A 2PGIA 3V3TA 2C94A 5EEHA 2ZSJA 2QAGC 3QV1A 1SG9A 4OKSA 4TT3D 4ZMSA 3MJDA 5J40A 4OXXA 4EMSA 4CL8A 2A0YA 3JAKA 2V7UA 4NDAA 1M66A 1Y3CE 1YI1A 1WAMA 3G89A 3LWBA 4YJKA 5CA0F 1PWHA 2AOTB 2H1VA 2BEVB 3VM6A 4UMVA 5L3QA 1E3QA 3OJOA 1XZPA 3EPJA 3K15A 1RQPA 3LLCA 2VUUA 5B6PA 3MJTA 1QZ3A 4LZJA 2CLDX 1WCYA 2YHAA 4FGWA 2HHHB 4M1SA 1FK8A 4CKYA 1E92A 1E2NA 3EG9A 1WXIA 3SBDA 4WKCA 3D81A 4RBNA 2IOHA 1ORHA 4YV0A 3ADBA 4LECA 4WAUA 4FX5A 5AKEA 1SVOA 3IO3A 1ML3A 3ZLBA 3TD9A 4C6TB 1YCHA 4J29A 3ELUA 5IKEA 1MQSA 2FPMA 3AV0B 3H0EA 2NG1A 5E4FA 1C9EA 3HO1A 4WH0A 4QLAA 4HEHA 2ZRFA 2A9VA 4KO1S 2BFWA 3IP3A 3THWB 4OB7A 4ALNA 3PRHA 1JHRA 2G40A 3M6FA 1S01A 4EYGA 4ZVOA 2QX8A 2LTAA 2Z6VA 4QG3A 3OOSA 1PL7A 3LZDA 1SFRA 1T3TA 3O38A 4CPDA 4GMDA 1YBVA 4ARAA 1ZN2A 2ZR0A 2CLIB 1N8NA 1YO6A 4QIHA 3R76A 2V3CC 3FOWA 1CZRA 3W9SA 2TECE 3QPAA 4GKKB 2EKPA