4DCPA

Crystal structure of caspase 3, l168f mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
141
structure length
141
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTEFDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3 subunit p17
publication title Molecular insight into the role of the leucine residue on the L2 loop in the catalytic activity of caspases 3 and 7
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 141
sequence length 141
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dcpA00
3H13A 1QX3A 2FQQA 4JJ7A 2FP3A 4ZVPA 4QUHA 5IAJA 1QTNA 5IABA 4M9RA 4JR0A 1PYOA 2QLJA 1GFWA 1RHRA 1I4EB 2H5JA 2QL9A 1RWPA 5IAGA 4EHHA 1IBCA 1I51A 4N6NA 2DKOA 3IBCA 4JQYA 1RWOA 3NKFA 2H65A 1ICEA 3QNWA 3BIJA 2XYPA 1SC1A 2FUNB 2CNNA 5I9BA 3D6MA 3IBFA 1RE1A 2WDPA 4LSZA 2H54A 4AWBA 1JXQA 2XZDA 3D6HA 2HBZA 3KJQA 4QULA 2H48A 2H4YA 2NN3C 2QL7A 3ITNA 5LUAA 3NS7A 4QUIA 4EHAA 1BMQA 4ZVQA 1RHUA 3H11B 4N5DA 1SC4A 3H1PA 4FDLA 3GJQA 2Y1LA 2CNKA 4QUEA 4N7MA 1RHKA 3PD0A 4IEFB 3OD5A 4NOLA 4QU9A 1RHJA 3GJRA 1RWVA 1RHQA 2C2KA 5IAEA 1NMSA 3V6MA 1M72A 4QUJA 4ZVSA 2J32A 4D3XA 2C2OA 2CDRA 4FXOA 4ZVRA 3DEKA 1RHMA 5K20A 4FEAA 1K88A 5IBRA 3K7EA 4FGUA 4I1RA 4QU8A 3RJMA 4N7JA 3SIRA 2H5IA 1RWXA 4PS1A 3V4OA 4QU0A 3GJSA 5IBPA 1RWKA 2C2ZA 3DEIA 4PRYA 4QTYA 3H11A 3PCXA 3V6LA 1RWNA 4EHLA 1SHJA 2K7ZA 3R5JA 4ZVTA 2HBQA 4QUDA 1NMEA 3S8EA 4NBNA 3EDRA 4I1PA 5IAKA 4N6GA 2CNOA 5IBCA 3DEHA 3UOAB 2AR9A 4AW9A 3E4CA 4JR1A 1I4OA 2C1EA 3SIPA 3R6LA 1SHLA 2CNLA 4QUBA 4EHNA 4DCPA 4EHFA 3V4LA 5IASA 3R7BA 1SC3A 3H0EA 1CVRA 5JFTA 4NBKA 1NMQA 3UO8B 4QUGA 3S70A 4EHKA 4HQRA 3PD1A 3R7SA 1PAUA 4NOJA 4EJFA 2CJXA 2J30A 1F9EA 4HVAA 2J33A 2H4WA 1RWMA 4QUAA 5IARA 4D3ZA 4NOMA 2XYHA 3V3KA 5LU9A 4D3YA 4JQZA 3R5KA 3R6GA 5LUBA 2P2CA 5IC6A 1GQFA 1CP3A 4AWAA 4PRZA 4ZVUA 5I9TA 1K86A 1NW9B 3NR2A 3P45A 4IYRA 2Y0BA 1RWWA 4DCOA 5H0IA 1QDUA 5IANA 2XYGA 4QU5A 4QTXA 2HBYA 4JJ8A 4JJEA 4NBLA 2QLBA 3V55A 3GJTA 5IC4A 4N6OA 4PS0A 1F1JA 3KJFA 4HQ0A 2QLFA 4NOKA 3P4UA 4DCJA 1I3OA 3R7NA 3KJNA 5LU8A 2J31A 4JR2A 2XZTA 3D6FA 2H51A 2C2MA 4EHDA 1KMCA 3EDQA 4JB8A 4ZVOA 2CJYA 2QL5A 3DEJA 2HBRA
chains in the Genus database with same CATH superfamily
2JFWA 4W9NA 2I5PO 4AURA 1PV1A 1J0DA 1M2HA 1NBEA 2OV4A 3M3HA 1K08A 2VSOA 4OKIA 1YS1X 2AJLI 2Q62A 3IIMA 1ETHA 5DXFA 1WUJS 2E89A 1Z6GA 4P3YA 3OVMA 2WVAA 4G63A 5IFKA 3R0JA 4ZQHA 4Z0TA 5IUNC 1E8DA 3F4LA 4ZDKA 5L4LA 3HGMA 3CW9A 5F76A 4BVBA 2O0KA 1E3MA 3DA8A 1BE8A 3AUYA 1JG4A 1O2DA 3JQ9C 3EOZA 1E79A 2VK1A 4FE7A 4PYJA 5ED0A 3WK5A 1ZH2A 1AIPA 4AP9A 4ZVNA 5K8JB 4NE9A 2VHYA 3EAFA 1YS7A 1VHDA 3R4CA 4XYGA 2YJZA 3FCYA 1NQUA 3PDIB 5ER6A 3W6UA 1BN7A 1QWOA 1XZIA 5JISA 1FQOA 3RYHB 4ZO8A 4TUYA 2Q07A 3JYQA 1GG9A 1N6KA 2VXCA 4WXHA 3ORSA 5CK4A 4NG5A 4BECA 3FR7A 1IATA 1MX9A 1ZUNB 3E8SA 4FP9A 4YB8A 2VDJA 4TUYB 5A2QA 4HNSA 4D1YA 1UPFA 4G8DA 4QDXA 5EAIA 2VPTA 1SMKA 2CNBA 2EDAA 2RGEA 3DBHA 3WLAA 3NHRA 3HL4A 1X2BA 4OHFA 5L40A 3GZTB 1ZRSA 2WD8A 1EFUA 1PW7A 2BUAA 4Y9TA 1PFKA 5H4HA 1KHHA 1NNUA 3D7MA 3TAXA 4TMFA 421PA 4XGNA 1ZMOA 3O8DA 5AW2A 4WA8A 1XA4A 3DXZA 4U2EA 2G88A 4QYWA 1QVWA 3V42A 1P6QA 4AP5A 4BMOB 1I1OA 4LY0A 4BQOA 2P1ZA 2O2JA 4FZRA 4QVGA 1G291 3P9XA 2JS7A 3FH0A 1HYEA 4NQRA 3HLYA 4S1NA 1I1QB 3T34A 4C89A 2VHWA 4D98A 1YVRA 1U3GA 1D5CA 1ZS9A 2ZCVA 3LUAA 2PMEA 3OOHA 4PZUA 1ZVKA 4PX2A 3ZUGA 2XE4A 4XYLA 1SUCA 3R3ZA 4MUEA 1TMGE 3BWBA 3WB1A 1TPZA 2QUKA 2AKYA 2PU7A 1XJ5A 2ONKA 5DYYA 5JSYA 5IAKA 2IF2A 5J2TA 1C7QA 4NZZA 3Q7QA 2ZJ1A 3KSDO 4N41A 3QMMA 5AW7A 3OFJA 4JU9A 2C2BA 2V9PA 4TWBA 4NABA 1XX6A 1I9CA 3RU7A 2EJBA 3RANA 4DNFA 3HEBA 1BS2A 2HA0A 1P7VA 1BS9A 2JJYA 1KEWA 2GERA 1FPMA 2P3LA 1ZSYA 1L4BA 2QPAA 2X4GA 3DL0A 3IOCA 4S1VA 3ELWA 4S0ZA 4BGIA 1YZ3A 4A8TA 2OHFA 4OUKX 2PXXA 4CTMA 5BV0A 2LKDA 5K3EA 4RK7A 5I4CA 3NBFA 1GPNA 2HGZA 1KO1A 1KQNA 2B1RA 4TQ9A 2HMAA 3A3PA 4JC0A 4GX1A 5E95A 3U7FB 5KU7A 2EV9A 1TMKA 5AXDA 4FGWA 4BE7B 3H9JA 1DTWB 4EWLA 3GLRA 1Z4QA 3A1SA 1Z06A 1UF9A 2GX6A 4ZRDA 5FI0B 1V48A 2WFLB 4W8OA 3RRNA 2HU7A 2F1KA 5HM8A 4C7BA 2VVTA 3H13A 1DWOA 1UPXA 3AR8A 3DOFA 3QUCA 2WG0A 4GRDA 1HMPA 4ID3A 2PLFA 2Y9MB 2NU8A 3WL6A 4QC2A 3WQBA 1XQXA 1PNRA 4CM9A 4P3XA 3BULA 1VIDA 4G97A 3R75A 1AKRA 2ZJ8A 1A76A 3BGIA 4BVAA 2B5WA 4AYXA 4NLLA 5DB4A 1XMJA 2F59A 5CT9A 1V6AA 5JZMA 4PYKA 2I71A 4ECEA 2KBEA 3F98A 3ZCUA 5J59A 3NI2A 4YIKA 3MAGA 3Q7TA 1WBDA 4B2LA 4C14A 1G6HA 1LF5A 4Z9FA 3PVZA 4Q3DA 4BLVA 3TTSA 3EY9A 2DC1A 3V1KA 4FVTA 4R68A 2QVXX 4PBTA 4A26A 1Q1QA 3GEDA 3LKDA 4LYEA 4W8HA 3NLLA 4W1RA 3EXIB 4YJ2F 1G3IA 4UDXX 4TROA 4EB0A 2EEPA 4ZRNA 5BN3A 3CXUA 4D4MA 3TVYA 1WLSA 3LHFA 1W0CA 5HUJA 1YDWA 3HBJA 4AS2A 4F45A 4OHKA 3PHBE 1N3BA 4RPJA 2HO4A 3L7MA 4EF5A 3TZCA 3HFJA 5JD5A 3R40A 2EJTA 3FKSD 5AJXA 5HXAA 2IKSA 3K5IA 4HVCA 2O2EA 5AOBA 2B2NA 3KWFA 1E2PA 2XTNA 4DCVA 2OGTA 3KUKA 4FMPA 1AV6A 5CVUA 3C4JA 3EYAA 2JAHA 1LS1A 3JU3A 3OU2A 3SY8A 1GOTA 4O4IF 1AKUA 2H5IA 5A06A 1VE1A 1RJFA 2I6SA 3PHGA 5IVKA 4FMDF 1P3DA 4UEWA 2ZYWX 1V16B 2VBCA 3NCHA 5KNBD 1PJTA 2XDWA 3AO0B 3E5RA 4H1VA 5TS2A 3EGDA 4UUQA 5K0LA 4ZARA 2PO7A 3MRSA 5M29A 3K4PA 5TF0A 1ZEMA 3WLLA 5EJ4A 2Q4BA 3DVAA 1ORRA 3S27A 2E49A 3ZCVA 4L0DA 5JSZA 2EZ9A 3A6PC 4YJ2A 5BW8A 1F8UA 1ONNA 2GBFA 3JZFA 3D64A 3WGQA 3KUXA 1S0UA 5H3CA 3U1BA 2AG6A 2BMJA 1PJRA 2O2ZA 2VHCA 1OGYA 4FQ8A 4PONA 1UDBA 4R41A 1Q0QA 1X15A 5JSZB 4QYTA 1BD3A 5BSMA 1R6TA 3QQ5A 4JI5B 5FEUA 3RV3A 3GDGA 1DADA 2CLFB 4RK6A 1UBLS 3RG8A 2WNSA 2WWYA 2SBTA 4U6NA 4ND8B 1PLLA 2QG6A 4JJ4A 4D4KA 4O3MA 2PGJA 3FXAA 2QQ5A 1TCVA 3RV4A 4QJ5A 1ZR2A 1V1JA 1ENPA 3R6GA 3IEVA 4H16A 5LBTA 3ZDRA 1E8MA 4YMTA 5BXYA 5FBVB 2CLEB 3MCZA 1XP8A 3HADA 4YCLA 5IWCA 1CQZA 2IP2A 1SEPA 3H17A 3JPYA 5F3RA 4TMKA 1HG0A 5IH3A 5KHAA 4K6FA 5TJHA 4BU0A 2C8JA 2E6KA 4C78A 1ND6A 4DSAA 3FKQA 4IJQA 1FB5A 2N9UA 4J3FA 5ALDA 2V7EA 3THYB 3PQ5A 1FTQA 1FU7A 1R6BX 3G59A 1NMYA 2JPDA 4TWRA 4R9NA 1MJNA 3JYHA 4QNRA 3UHPA 3L18A 1GYQA 3R44A 4LC1A 4YRJA 2WAYA 4FIDA 2YXLA 2P7HA 2QGNA 4ZAYA 1N2CE 1X9HA 3QU5A 1N33B 2DBRA 1ZSNA 4DCGA 1AD2A 2CB9A 2XWQA 1W93A 1KMIY 3I6MA 4R01A 5KYKA 1EE2A 1S2GA 3AQ4A 2YFQA 2Y4NA 2DF8A 5KYUA 3HDQA 4IL5A 3PRKE 4DXAA 3QVWA 1PV4A 3S40A 4DR7B 2RHLA 3GNSA 1FYVA 4OXYA 1GGVA 2P30A 1BSVA 1XK7A 1QGAA 1C8LA 2IHTA 1Z8DA 3AP3A 2XB4A 4YN3A 3FD8A 2GARA 1I7NA 4OMCA 3DLAA 3O83A 1G8MA 1YDGA 1LQUA 2VRNA 3N7UA 4U0JA 4FEEA 3V1YA 1RHUA 4JUFA 1JJBA 2NNWB 3GBPA 2ERXA 1SG6A 5I7UA 1ZBQA 2BGIA 2Q6TA 2DUUA 1L3IA 1UUFA 1X3LA 5CFRA 3DBVO 4AK9A 2FW9A 1MEEA 1GPKA 2YHIB 3AVQA 3PRJA 3QI7A 4OP1A 3WWYA 1NJ6A 3UUGA 4IXWA 2MOKA 5JXGA 4OGKA 1JFTA 1K6EA 3LS2A 2EZUA 3SOPA 1IWOA 1MABA 3EZNA 3W7VA 4K6KA 2C5LA 4DA8A 1XQVA 3L8ZA 3KKNA 3QMWA 4DW8A 1HKUA 2XADA 4R3WA 3FDFA 2WVHA 1DJPA 2VDVE 1G4AE 3JQAA 2WKWA 1DC6A 2YMPA 3P9PA 5FI5A 4X65B 1VYHA 3M6MD 4DXDA 4RMHA 5E2BA 2BBSA 1YRAA 2JFNA 4GP6A 5A6VA 3D6VA 2PH5A 2HCRA 2ZSUA 2FPGB 4U8HA 1WUYA 4D4GA 4IJKA 3DQQA 2OCGA 2WZDA 3DKRA 4ZAWA 4XGIA 4BRWA 3STHA 1KY2A 1L3BA 5TSDA 2ILVA 2K7ZA 4KX5A 3FJ1A 1IAQA 1MDFA 1E3WA 1B6TA 3L0IB 1FTNA 5AVRA 2F3SA 3BS4A 1NU6A 1YGPA 2IDJA 1W30A 4ZOLA 4QPCA 3HXOA 2XGOA 3IQIX 4LC9A 4WXMA 4WZAB 4LFBB 4PQGA 4BMCA 4RENA 1ZGZA 5J5AA 4DCSA 3X1XA 4PNEA 1CSEE 2ZUTA 3EAGA 1JHZA 1QNFA 3KPYA 3UATA 2PXCA 3JR3A 4YRPA 4ES6A 1M2OA 2P9YA 2ZRLA 3H65A 3K0AA 4WZBB 3LM8A 5FUVA 4BNHA 1MXFA 2CMKA 4IIFA 2OB1A 4RA9A 5JCJA 1CQJB 1TTHA 4R1NA 5A3VA 1PR2A 2D00A 5TNXA 1L9XA 2C3OA 3QH4A 4HQKA 4PX5A 4RDCA 4LVOA 4LDZA 4DUPA 2BEVB 1TA4A 3FHCB 3GF4A 2A1IA 4G4JA 3FF1A 4URWR 5DHRA 1Q12A 2WBLC 4PCAA 1I24A 2I1QA 1N6RA 2NW6A 1K0FA 1W85B 2VN8A 5TS3A 4W5OA 1G20A 4B32A 1JHXA 3I52A 4LJRA 4PZPA 1FDIA 2D5LA 5C4GB 3GROA 1Q0TA 4ZYYA 2FPKA 2AUTA 5M5BA 3OU7A 4KNWA 4UHFA 3F6CA 4X1YB 1Y9ZA 1HM5A 3OCZA 1A2QA 2NPFA 1QFSA 4AZVA 1KJYA 4EA9A 2A5FA 3EGOA 1V2HE 3AB3A 2OP1A 2FQQA 1A5TA 4RAQA 5EGNA 5CIQA 3ZQKA 2JGNA 2O8NA 1QTIA 3L01A 1KZ4A 1L5ZA 1U1DA 2WHEA 3O8LA 1S2IA 1FP4A 3FMIA 1R1DA 4H7FA 1P1JA 3B5JA 4JLNA 4B48A 1GZHB 3O3MB 2Q3FA 3CX4A 1EFAA 3B1ZA 4AN0A 3COJA 1DWQA 1VMKA 4PRKA 4FI3F 1XU9A 2DZDA 1NBAA 1YIDA 5LN1A 2P11A 2VI5A 4LIPD 3FCSB 4WTOA 3ASUA 4ZVLA 4NQZA 3DB1A 5K0SA 2JIZD 3PWZA 4KN6A 4P35A 5EZQA 1KSFX 2BFDB 3SR4A 5B5SA 2VDQB 2XKAA 2YRWA 2VK2A 1A72A 2BV3A 1BHO1 2G70A 2H2AA 3DCYA 3LBHA 4FR0A 1HKHA 3OTIA 4F3RA 3ED1A 2YY5A 4RMJA 1QGUA 4U9UA 5DYWA 1HR0B 3UJ7A 4FOLA 2CLOB 2PJUA 2V98A 4UU7A 3UKJA 3ZWOA 1PT7A 2RD2A 3VH3A 1DQYA 2C7BA 2RK3A 4I46A 1P75A 3HBAA 1GGNA 5AVVA 1J97A 2GJ9A 1ZJJA 4WLVA 3VR5D 3K0HA 3ACDA 1USUA 5JW6A 3ZZTA 2P9FA 2JC3A 1HTBA 2QAJA 2IZOA 4ACAA 5IS2A 2SKEA 1AKEA 2HFJA 2HRCA 4FSXA 3IV7A 3IESA 3QY0A 3E6AA 1F12A 2Z8XA 4LAFA 4KQCA 4BCDA 3JARA 3ZJ5A 1IHDA 4AO8A 3KFXA 3DLHA 3L49A 4HWRA 4ER5A 2CBXA 2FETA 2XRMA 3Q7IA 3HPQA 3A1NA 4IR7A 4KXWA 1NBMA 4S1OA 5LLTA 1F60A 3BXXA 3E23A 3HVUA 4G5HA 2E4YA 4G0VA 2IL1A 2R44A 4MZDA 2GAFA 4Q21A 2XWSA 3F2IA 5DWDA 2QN9A 3FYUC 2GJKA 4MRNA 3ZGYA 3E22A 1NMEA 4ALMA 4YXWD 4Y18A 1LK7A 1UAGA 1KZ7B 1U02A 4CYMA 4NAHA 4KMRA 5K6RA 2FZVA 2OBMA 1ZKMA 2ZI6A 4BO4A 1G7TA 2JAOA 5B58C 8OHMA 3IMKA 4S24A 5ADVA 4MRMA 1JR2A 5DXJA 3N86A 3G0CA 4LWZA 3IUBA 2Q1WA 4HDMB 4BKMA 3KWLA 3UHFA 2IW3A 4WY8A 3UWDA 1PEDA 3QKUA 3TTVA 2JA1A 4FGSA 2PUFA 3AY6A 3DPIA 3MNFA 1QVRA 1Z7EA 3H97A 2NO9A 2O3QA 5J4VA 4CQNA 1LSUA 3PUJA 2UZ1A 4C7VA 4GC5A 5ICGA 1ZUIA 2A33A 3SWWA 2C9ZA 1FFSA 1PIWA 1EVYA 1HZJA 2C4HA 3IC5A 3MAAC 3P52A 1RZRA 2XUDA 1DLJA 1VP3A 4G5XA 1X13A 4L8GA 4KFTA 4WK0B 3CRQA 5AJUA 5ESWA 2Y0BA 4RM3A 5K3DA 3ZBPA 5CDYA 3GC6A 1D8AA 5BMOA 2C9BA 4AUNA 1G8JA 4UQPA 1W2GA 3Q7EA 3A2KA 1JKFA 4BVKA 1OZFA 3ZU6A 4DILA 2EWMA 1EBFA 1N6IA 1DMRA 1GU1A 1SU8A 1JZTA 1M5UA 2D1RA 3AFIA 4JR2A 5E7IA 4QKQA 1JAHA 3UPTA 1HK7A 1TA9A 2IYWA 1TT7A 4ALLA 4OATA 1G5FA 2FMFA 3AEYA 4DA7A 1LH0A 1VB3A 1Y6RA 3PSAA 4LXHA 5ICFA 2A1UB 4DLTA 3SVZA 5SZKB 4N0EA 1MC8A 1XRPA 2G4CA 5CXXA 5ISMA 4YRGA 4Q7LA 1PNOA 4EGSA 2XNDA 1EUCA 2WPNA 3DMGA 3HGTA 2XUZA 3IODA 5CBPB 2FE4A 3X1WA 1C7FA 3RVKA 2VTKA 5DKFA 1YF3A 2H6EA 4FFOA 1QQBA 4NICA 4Y30A 5ARCA 1J2YA 3RIMA 2XODA 2OQIA 2C9OA 1EK2A 3ZE0B 1J1IA 1ZO8A 2FEOA 4I3FA 4JFRA 3ZHYA 3BJZA 5G4KB 1YOVB 3KKLA 4WCVA 3IILA 3T5CA 4N9QA 1V1RB 2WV7A 1MB0A 1M8PA 2X1VA 4PQEA 1PWYE 1TIPA 1W4CA 2H8KA 5B3AA 3VZCA 4DCNA 4RQBA 3V7NA 4LZNA 5JVDA 1USKA 4YRKA 3C43A 1NDQA 1U0HC 4N5DA 5EMLA 1NNEA 3H6GA 2VSQA 4ILKA 1T10A 3TD6A 4F9EA 1SZCA 5EMHA 1ZMBA 3CVVA 1E2FA 3ZWVA 3OZCA 5M7EA 1R8JA 2HA6A 2H4JA 3HI6A 3AEUA 3GIWA 4F4UA 3VJMA 4D0SA 1G7CA 1P2UA 2IHYA 2RIRA 2W2MA 2ATXA 1Y1KE 1R0XA 2E5LB 1G21B 3OO1A 5AJYA 5AKEA 3RS5A 3I37X 3KLBA 5JCOC 3L07A 1FSPA 1PTJA 2CZGA 2I6XA 4PSKA 3BMNA 4ER0A 2XE6A 2ZDGA 3HTXA 4HKTA 3WK9A 3MBIA 3O5AA 2GD2A 4N18A 1W1WA 2VL7A 1XKXA 4E5UA 4PAGA 4TN5A 3ITDA 1T5HX 4GOXA 1GUYA 4HWKA 1HSOA 1NUPA 4K9NA 2FW0A 4R84A 2IPXA 5CGQB 2AVNA 5C7YA 1X7WA 5IBPA 3HN7A 1QR2A 4WOCA 1H42A 1VZ3A 3OP1A 4LRWA 2CDBA 2IYQA 3CZRA 5TV2A 1OIXA 3EEOA 2ZOSA 1U11A 1LRJA 3F8SA 4JA2A 2W42A 3FB1A 3N74A 3UBMA 3L4JA 1VL6A 2QTWB 3I5UA 1NRJB 2B35A 1QV7A 1KEKA 3I05A 2GO7A 3GFBA 4DZRA 1V7QA 1EH5A 4CR7A 4IKPA 3JSAA 4PZLA 3W78A 1BDHA 2RIPA 3HCEA 5LP1A 2BE9A 3WGHA 4N0DA 1NVUQ 4I5GA 3ZNQA 1ZITA 4MX8A 5EESA 4EB3A 4DWJA 3CC8A 1CK4A 1PZHA 4B87A 1OT3A 3KVNA 1TI7A 4YDRA 4I1YA 4BNDB 4QOFA 3EQ7A 1M1NA 1W8DA 3B20A 2IE8A 2L17A 2HAEA 3J80A 3G5AA 3FCAA 2VT7A 4RGYA 4WJZA 1QO7A 1L7EA 4D6XA 3TI9A 1KK0A 3ZHBA 3C8ZA 3MTEA 2HIMA 4E5YA 2CWWA 4NY1A 2QX4A 4BYMA 3U4QA 5HVNA 3RYIA 3ZLVA 5D6OA 2FEKA 2RHCA 3C5HA 3ZCPA 1RCTE 9MHTA 4JYMA 4K6CA 2P6UA 2QZPA 3EAQA 1D2EA 3C3AA 3F3SA 4XDHA 2JEYA 3CVUA 2V0GA 4TLMB 1SXJC 4KVAA 1WNTA 2Y0PA 4DG8A 2HI0A 1HT2E 5C2JB 1A9RA 5FOVA 1D2HA 2V65A 3KSMA 3OE7D 2JCGA 4HNAB 4KWIA 1ZH8A 4L0MA 5T67A 4MMYB 4MYDA 3UY4A 2C9MA 3MJHA 4WLFA 2PCJA 1QX3A 5HDBB 3N53A 4TPKA 3F6BX 4O2BB 1G63A 2GJ8A 4JR0A 4TLCA 1PYOA 2QLJA 4KWTA 1TEXA 4YQZA 1EDEA 2LW7A 3HKBA 1XNGA 2MMGA 1N7JA 1MB4A 1O03A 3GRRA 2R1VA 3NJ4A 3TMYA 5L4NA 4OU5A 1N2HA 5KQMA 2QGFA 4ZT3A 1F7VA 1I2AA 2BGRA 1O54A 1F2DA 2QT9A 1MG5A 4HADA 1VKOA 2GZRA 3LCMA 4KN5A 4BATA 1YO6A 2R1VB 1C3VA 4MEJA 2Q5HA 3HBMA 4BFYA 4D46A 3K6SB 4JT9A 1TTPB 3HDGA 1FC0A 3ODGA 4JXJA 1XDZA 4IH9A 2UYYA 4M2LA 3W3AH 3GWGA 3EC7A 3EMVA 5TT0A 1T4BA 2WR8A 1JXMA 1RYYA 2G9ZA 2W0MA 3E82A 1OLUB 3MCVA 4MPDA 4U00A 5TEVA 3ZWWA 2ZQ5A 2YZNA 5F52A 4ZHSA 3X1ZA 1SGWA 3A6HA 5H9WA 2HU8A 4C4PA 5KQRA 3CUKA 3OFKA 2FMXA 4OSPA 1XSEA 3EGXA 4D0NA 4GSLA 1EIZA 1CUYA 2GEBA 2ZSAA 4RZHA 4ZV7A 3H1GA 5JQGB 4QVKA 5I8ZA 1KDYA 2O1EA 1Z0FA 3DXFA 3HFSA 4QAJA 1R8SA 4QICA 5BSUA 3WOHA 2VHVA 3B1JA 3CZPA 2IEBA 3I8SA 4O4HF 2DKFA 1P2SA 4GP9A 4LNHA 5BW6B 1HE5A 4RUKA 3LYLA 1GZ6A 4FHGA 4PHGA 1XLTC 2PBRA 1MDBA 5KSYA 3VM6A 4S35A 1FDVA 3R77A 2HDNB 2HA3A 3N1UA 4RVCA 2H5LA 1RM5A 1RW4A 3NUQA 4YH1A 3ROTA 4JBWA 4TMYA 1JH9A 1ZOSA 4DIFA 3FPCA 1WHTA 3D6UA 3T7CA 2TMDA 3DFFA 2ZAMA 1L3CA 2IU3A 4R2MA 3OTHA 4B43A 3AEZA 2HT1A 2OFXA 1BHSA 3T7IA 2GZDA 1IDOA 1I6MA 4WOKA 4B0OA 4WHMA 3B48A 4BO9A 1PGOA 4NAVA 5IBCA 2IZ1A 2GZ1A 2ZIVB 2YQ5A 4PLHA 4U1RA 1VL2A 4AQ7A 3K0SA 1UFKA 2I7CA 2WJZB 3BDVA 1YI0A 3U44B 3LK6A 3TTWA 4AP6A 3HK2A 3A1EA 3WMXA 2BI8A 1RXVA 2HWYA 1Q3TA 5KZMB 2GM3A 5AQ1A 4P7KA 2NXWA 2OVFA 1U3FA 3MJTA 4F8EA 5K7SA 5BR1A 4UMDA 3WMFA 5AT1A 1RAGA 3TZKA 1HV8A 2IDKA 2IU4A 3BE4A 4FLMA 5GV8A 4WZ6A 5FFNA 1G59A 1F20A 1RI2A 1L8OA 1RAFA 1SPBS 1W7AA 1ODFA 1CDZA 3NWPA 1I2MA 1WTCA 5PNTA 3G49A 2DUJA 4W5WA 5JTTA 3L7CA 1KVTA 4P0TA 3HVRA 3TLGA 4L3VA 1EFLA 2CZCA 3CZAA 4O5AA 3OJOA 1LLDA 4XFDA 4PC7A 1SBYA 1ENYA 1U5BA 1W2HA 2QNBA 3M9XA 4LOHA 4X54A 5B7GA 2JGKA 3LBNA 4QXAA 4FYMA 4KWCA 2OFFA 1YB4A 3WK4A 4PN3A 1H93A 4Z4FA 4DLSA 1VG8A 3ASYA 2GBLA 1KYVA 4TM8A 2QPLA 5EKTA 1QHGA 4AG5A 5HP4A 3W5AA 3GIDA 5IABA 2X1LA 1NVTA 1N75A 1FVHA 4ZKDA 2OK8A 2DLNA 5K4HA 4R7GA 4OQXA 2R8RA 2BGWA 4JP3A 1XZBA 5F7JA 3KVYA 1XVTA 6ADHA 4P0QB 3F6RA 1ZM7A 2IUFA 3PVSA 5C80A 4EY8A 4A23A 2WMYA 4BZZA 1B41A 4Q9DA 2AG8A 5G02A 4IG9A 1XMPA 1XQ6A 3I4FA 3HR7A 1J8MF 1BDJA 4TS1A 5AK3A 1KY4A 4MB0A 1C14A 4GW3A 4K9DA 4WKOA 1G5IA 1J7KA 3R3HA 4N01A 1H8EA 3E9ZA 4EMBA 1RJDA 2HLNA 2Z3WA 4H17A 4GOKA 3SSMA 2PL1A 3F97A 4H1TA 3AIKA 4Q4HA 5KHLB 1TFRA 2D4AA 3HS3A 4ITVA 3INTA 1TPYA 2PUVA 1UOQA 2WSLA 1Y63A 2V7QD 1ISGA 3QBJA 1G8SA 2OORC 4EMTA 1PJSA 1SC9A 2CNWD 2AI2A 3A2NA 3RLFA 2G36A 4JBNA 1DOZA 2C54A 4HFRA 4NCAA 1T6NA 4DIOA 4K1XA 3NEAA 2OCXA 1LPAB 3KZKA 3HUFA 4JB3A 1GTMA 1E7QA 4Z9XA 3RJ5A 1ZNYA 2I2CA 4ZXPA 2GBGA 1C1DB 3AV3A 1X8KA 2GK6A 4RY2A 3GLIE 4UE3S 4PLVA 4DSNA 2YHBA 3M3PA 4FFWA 3VGJA 4AZTA 3B6ZA 1VKZA 3EPLA 1Q77A 5CNMA 3ESXA 4IVNA 1MVOA 4EG4A 4FGUA 1H5QA 1DGQA 4WXYB 2PMFA 2JBAA 1GGMA 5CPBA 4EITA 4YP9A 3TQRA 3TRIA 5B6IA 1HNNA 4ND5A 1J23A 3LY5A 5T4BA 4RHTA 2X7XA 2XYRA 1C5KA 3F47A 1VSTA 3DMFA 4O6VA 1SBZA 3OTQA 4NH0A 4IDHA 2YVLA 4DDTA 1C50A 1R0RE 2JI7A 3ZJVA 4GEKA 4AMUA 4M1SA 3THWA 4JI4B 3AG6A 4IRMA 1YT5A 3ABQB 1AGYA 5EWLB 1Z8HA 2AXNA 1FRQA 4D97A 4Q1EA 5TVGA 4EP1A 3PC3A 5IX8A 4P8RA 3SBEA 3L7LA 1EZ1A 2NNLD 3H5NA 3U39A 5ALUA 3VPGA 1CJBA 4E3WA 5I9MA 1TJPB 2G8NA 5IT9A 5K3SA 5KVAA 2FZCA 2QRKA 1L5QA 2O1WA 3QE9Y 3GLFE 3Q3HA 4LBYA 1F3LA 2J0UB 4R8MA 4EHIA 5A02A 1VIMA 2CJPA 1Y37A 4JT2A 4CQLB 3EEFA 3T6KA 3VR6A 3UO8B 2J4FA 5K01A 4Y9RA 2WSMA 2Q1YA 2XYVA 2X0RA 2QHXA 5B58T 2YNMC 4RD0A 1EESA 1DRKA 2DWCA 2E5FA 2BD0A 3AVVA 4CQLA 4QXMA 4EJ0A 2EATA 2HNBA 4BNXA 1NW9B 2OO3A 3NAMA 3P9CA 4UNNA 2DFNA 1RWWA 2QAGB 5L53A 4XVHA 2YJNA 4IF6A 2X4IA 1IOWA 1SUDA 3U80A 1LLCA 3WWEA 5FLXA 4TKLA 3KR1A 3VKHA 5FX2A 3S7ZA 1E1MA 3JV7A 1UK8A 3QXXA 4GICA 4MW5A 3VO8A 3ERCA 3IVXA 2Y1OA 4RVDA 4GMDA 3DG9A 2VNJA 2WIFA 3VISA 1JVNA 1U90A 1XMOB 1QZXA 1T3HA 3QVSA 4GF5A 3ZPXA 1M1ZA 3B2EA 3ZS9A 3SEQA 4Q47A 4H4EA 3QX7A 4J4TA 5K4GA 1GZUA 2AX3A 4FI3C 1JQBA 1P1BA 3JD1A 1O94A 3VV2A 4PWYA 2GCGA 5LQSA 5KTRA 3L4KA 1X1SA 2UZAA 3LRTA 1T43A 2QAGC 1RKXA 2C42A 1TW2A 5EXXA 1MO3A 2H65A 1NXXA 1QQ7A 1NTOA 2W6ZA 1XRMA 2IYUA 4NECA 3CNHA 3C74A 3FYHA 5CA1A 4AY6A 1W4AA 2CJWB 1YJBA 2F64A 2YNMD 4YT2A 1BVYF 3QX9A 4MHOA 4LC0A 1RRGA 3A58B 1KDVA 3MXTA 1A3CA 2ET6A 2ZLBA 5FNVA 5GADl 2WU0A 2CUZA 3MWKA 5CA1B 3KKKA 1VC2A 1DEOA 1UINA 2GN6A 4KEAA 2RSLA 4LI0A 4FKZA 2W22A 3WWCA 3GLKA 5DULA 1RP1A 2PX0A 2RGXA 2EG5A 2W7TA 1TLLA 1EK5A 1U7DA 2H1FA 1IXRC 3K0CC 4QNMA 1CUZA 4QQNA 4A4DA 3C8UA 1P33A 5DH9A 1DP4A 1PFUA 1RHKA 3IP1A 4TYYA 2PBZA 3IB6A 4FR2A 1RPTA 3ASZA 4DA6A 1HNWB 5L3VA 2OD7A 2QLTA 4HRVA 4WSOA 3KZCA 4D56A 4DDMA 4X62B 1E7YA 1EWVA 5DEIA 3P4XA 5K0NA 1JBQA 1EINA 1WRBA 1BXRA 1EK0A 1LBIA 1Y4DE 3CLSC 3E1KA 1H0KA 3IKVA 5DFAA 3TIFA 3EUAA 2W2PA 1VBMA 3BD8A 1ZNWA 1DUSA 3PNVA 1T5TA 4KGDA 5F2OA 4B8YA 4BLQA 1NW5A 1OFGA 3H75A 2HIAA 5DP2A 4DT1B 5BVHB 4AZSA 4CDMA 2WWHA 4QU0A 2G76A 3SU8A 3BE5A 4IOLA 1IPHA 1YS9A 3EXHC 3QEMA 5C8DA 3ZY4A 3QX3A 4OM8A 1LSJA 3BORA 2IHNA 3F46A 3T38A 1DBQA 5B4VA 1Y82A 3GFSA 4Q4JA 5IC5A 3DMHA 5FWXA 1A9OA 2CL6X 1SAYA 1LVGA 2ZYSA 2OV6A 3LKVA 3UWOA 3EB9A 5AHWA 2J8ZA 4DG5A 3AVXA 5A5VA 1A4RA 2XH8A 3F9IA 5B64A 1E64A 1ZJ6A 5ICMA 4E1BA 4N6GA 4DLWA 2ISSD 5HZMA 3A6ZA 3LPNA 3CR3C 3RAEC 4C1BA 5BSWA 3FN4A 1KY3A 3JQ8A 3OICA 1XMXA 3C3WA 4MGIR 4YJ2B 3GU3A 1N5OX 1XCBA 2HXGA 2WHXA 2XOEA 4PW0A 3RFUA 3IAM1 4ITUA 3HCWA 4CLXA 1TZBA 3R76A 2PSFA 2WUVA 3JRNA 5KPJA 2GRUA 3A6JA 2NVUA 4NTZA 1HI9A 5CA1F 1SHZA 3RIEA 3HL0A 5JWRA 4LWQA 3K9HA 3E1SA 1PWEA 4E08A 2P9BA 4MLCA 1W5FA 2BSXA 2FPUA 2C94A 2JCBA 3W9YA 3TUJC 1NFQA 1EG2A 3HO6A 4JLPA 4MYTA 5CIYA 4UDOA 1GGFA 3KNZA 3I64A 3NT2A 2W5UA 3TDNA 4WNYA 2A5GA 3HJBA 4CQMB 1A97A 1QGZA 1ZISA 3S68A 5LMCA 5TMPA 3W2GA 2WYIA 4MCAA 4YMWA 2VP2A 4E07A 5CCXA 3S2SA 4L1KA 1FNSA 3U5TA 1W1IA 2FR8A 4MJLA 1XV5A 3JALA 1E2BA 1WX1A 3BSFA 1OHHA 3ADDA 3KOMA 2B2XA 1TMYA 4KCGA 1AX9A 4TTIA 2PKEA 5C3UA 1XNRB 1WU8A 5BYAA 4WDRA 1FFGA 3LWDA 3GPLA 4JBLA 4CW7A 1RBYA 1MO5A 2X8LA 2D2XA 3B6KA 2FKNA 2WKPA 3DVQX 3LGSA 4K6MA 4E6PA 5IHPA 3W06A 2UYHA 2VBGA 3F5DA 3RIXA 2FMHA 2H07A 1Z5VA 2K6GA 3U4DA 3GAMA 1KQ3A 2YUIA 3HR4A 2ZT6A 1OWMA 3NHYA 2NUAA 3CR8A 4XM2A 2OOSA 3AM4A 3DFIA 4RELA 1N0UA 4HY3A 4DFDA 1B3BA 3LZ6A 3FUVA 3GI1A 2CMHA 4MK4A 1GQRA 5DX0A 5EY5B 3PJRA 4MQEB 1HYBA 1DC7A 2OSVA 1SZDA 1QG4A 3OZRA 1XTUA 3KE9A 3KPUA 2R5WA 2YFYA 2D0PB 4AX8A 2V7VA 2QRPA 4P08A 2G9QA 3HB0A 3HKEB 2MTBA 3PQ4A 4QYIA 5L6LB 3N9IA 1JLSA 1N6LA 3L7YA 3AERA 3V4ZA 5I51A 3L0PA 5COBA 3V9AA 3WB0A 5CFOA 1T3SA 4KXUA 4TLDA 4B7AA 4GH5A 3GA0A 2YIJA 4EJMA 3KJZA 3BTSA 5BWCA 5L9AA 5BP7A 1A77A 3HJHA 2NMVA 2C1ZA 1C9MA 1MB3A 3TIXB 5IK2D 3QTBA 5KC9A 4PF1A 2QM7A 1P31A 5FI3A 1TAUA 2I34A 4Z8YA 4IMRA 1L4EA 4JP2A 2WILA 4MS1B 3EEQA 4E1VA 5LXTA 4H3SA 2A67A 3BOSA 5DT2A 4JV5B 2J5BA 2XQGA 3CBQA 2GKSA 5BSEA 2OCPA 1POWA 3DEKA 4IDGA 4FMDB 2I8CA 1JEQB 4DR2B 5HK8A 1OFUX 3CMMA 4P86A 1MC4A 5AI5A 4P3NA 3HKDB 3VJKA 1CUCA 3RVPA 1Z6TA 4NHEA 4BX9A 2VJLA 1U1EA 3GQVA 5EUCA 1RIIA 5JXIA 4UCFA 1OX6A 1DKLA 3HYSA 1FVXA 3RSHA 3C41J 4NJEB 4QOSA 8LDHA 3N2GA 4U9IS 3T5TA 1X14A 4RVUA 5AUNB 5FPTA 5KWEA 1EGQA 2HUPA 2PZKA 3FSEA 1ZN8A 4J8PA 4QTZA 3IJ5A 1M5RA 1PD1A 2B36A 2X2PA 3QFSA 3L8DA 4NZPA 4FFPA 4TMXA 3S2ZA 1X1QA 4ZHQB 3QA3E 4D81A 1CY4A 1CY8A 3SKYA 1EM8B 1GILA 1GPMA 2IGBA 4PQYA 5HIIA 4H0NA 3IJRA 2JKYA 3L4EA 3PPIA 3I1IA 2E85A 4G09A 3AONB 2VHQA 5J40A 3OHMA 1QKJA 2OGUA 4F8JA 5J4KA 2VCEA 3MFQA 3ZK7A 5CDGA 4EATA 2I91A 3DP9A 4Y6GB 2QTZA 4UBJA 2JD1A 3MSCA 5F64A 5JSKA 1YI1A 4BBAA 2VJMB 4ID9A 4C7KA 3GV0A 2O3JA 2ZITA 2P0YA 4AZ0A 2AC7A 3I5XA 4OB8A 3AM1A 1EDBA 1VRWA 1RJEA 3FNHA 2CLLB 4NIMA 2YYSA 4DTIA 1BW9B 2IBSA 1GNPA 3I32A 4Y6SA 1HY3A 4HNVA 4B3MB 1VJCA 2VRCA 4KDFA 4LOKA 4I4TB 1G3MA 2HHAA 2IV7A 2DLCX 4BC0A 1V47A 2BJHA 4W5HA 2VF2A 3K15A 1F2TA 1IZYA 4KPGA 1O1YA 4X1KB 1RYFA 2CXRA 1L7QA 4YGXB 3RIHA 2FWRA 1FYXA 1GSHA 3DDOA 4O2AB 4A73A 1G5TA 1CUVA 2AE2A 4Y3UA 4EX7A 5HZHA 4AN4A 4MVJP 4PTLA 3T9FA 4Q03A 4ND2A 1K7XB 1V41E 3TL3A 3TECE 4X1KA 3C3CA 1DL5A 2ZWVA 1PJLA 2VKQA 3D5TA 1VPWA 1VGQA 1DDOA 3IDSA 4FBGA 4INPA 2ORIA 4GDFA 5IAGA 2V7BA 1XZPA 1IBCA 4J1SA 1ZIYA 1H85A 1UBGA 3EN0A 3Q9NA 1DKQA 1FP7A 5KJ6A 3GLTA 2WSYB 4DSZA 4GKAA 4H4DA 1ODKA 1T4CA 1NJGA 1XN4A 2EFEB 3LLCA 1E1LA 1MO4A 3Q40A 3UMBA 4BCCA 2Q3DA 4ADSG 4TYWA 2Q28A 1INLA 2YV4A 3KOXA 1GTL1 1QP4A 4KR3A 2QL7A 2AB0A 4LXGA 4N8EA 2Z04A 3U7JA 1LVUA 2DLDA 5FWYA 3O3OB 4IIEA 3NJ8A 1BYIA 5I7EA 2A3NA 3ZW7A 3I2HA 3ILXA 5AW9A 3R6WA 4AM8A 1YAJA 4BBZA 1W59A 2A9VA 5MGBA 4CEIB 1A1SA 2CNKA 4PR3A 4R2KA 1V35A 4OFXA 3OWXA 1YU6A 4IFEA 1KR5A 3U7HB 4LQLA 1CF2O 2WRZA 1XU4A 1Q11A 1ZICA 2G1JA 2JGMA 4R0MA 3L46A 1JFFA 2JCVA 3MTBA 4RVFA 5E3HA 2O50A 4C4XA 3B36A 2CXUA 2DJ5A 2IZ0A 6Q21A 3RF7A 1USWA 5EXEA 2ODEA 3UM9A 1R3DA 1Q1BA 1SUEA 3D7NA 3L4BC 3MJCA 3PC4A 2EIHA 2R65A 1E92A 3GBSA 2DTDA 1HZZC 1L6RA 2W43A 3GFTA 1PYGA 2G4LA 2OQRA 3JD4A 4NL4H 3MFYA 4ZVRA 3L8CA 4D74A 1TW3A 3LZCA 1KOLA 3FIUA 3T9BA 2WM9B 3D2BA 1V8ZA 2P3QA 2FPLA 4IHJA 2N1BA 1YASA 3WGIA 4R0VA 3HO1A 2IPAB 2WFZA 3LY7A 4QVIA 4OHZA 2GNAA 2NAFA 1SR8A 3QTLA 2QW1A 5HW0A 3LU1A 4JC4A 1AXEA 4QFCA 2QW8A 2WPDA 1TD9A 4J4HA 4YK7A 3RDPA 2EW8A 4OJTA 1R4NB 1UMBA 1CQIA 4YRRA 3HNOA 4RO0A 4ITRC 2WOOA 1B4DA 4ZWNA 5CB4B 5LNK6 3KUDA 5BPHA 1V9CA 3ZTTA 1IFXA 1U9CA 1UWKA 3UKDA 4KO2S 3BXGA 1N5DA 3LBFA 5CRIA 3ZE7A 2ONZA 1AZTA 4PCVA 3TSWA 1KIAA 5ADUS 4HI0E 2X0EA 2X6RA 3FRJA 3NBZC 3L0SA 3H0EA 3T3NA 1VJDA 3IPAA 3FOCA 3BFVA 4ANFA 4QUGA 4M89A 3C7DB 2X0FA 4TWIA 2J7PA 2CXXA 2GBIA 3O0TA 4HDMA 2H00A 3X1JA 2O8CB 1OSNA 3E5MA 4MPPA 2GHQA 4RPKA 4ZPJA 5HYVA 1K7SN 2A9FA 3PYXA 4FTWA 3CSDA 1F0NA 3BIXA 1SIOA 3ICCA 1E32A 3O8QA 1IYZA 1LSOA 1SWVA 3N2NA 3RTDA 1YQGA 3VX4A 1JQEA 2O8CA 1XR3A 4CF5A 1R0SA 1Q2XA 2BKAA 4PRLA 2P6PA 3X1KA 3WRXC 4O2AF 4OF4A 5EJFA 2QT0A 3T0GA 1C9JA 1T1GA 4AJKA 1W2WB 1KL7A 4XJTA 3F9CA 1XTKA 3QYAA 2II6A 4HX5A 2IUUA 2O0HA 1TVEA 4RJLA 3OIVA 1HDYA 1CD5A 1RI3A 1U2GC 3HA7A 5DW0A 1TO2E 2F43B 3B2QA 4QBTA 5F33A 5KIAA 2AOUA 1K5HA 3GZJA 3KT6A 2VH5R 1PO7A 4IHAA 1C0PA 4ZKEA 4QOJA 4IZIA 4JSRA 1QSGA 3BL5A 1PFVA 3LWNA 2RBGA 3N0WA 1Y8ZA 1ONSA 4FD3A 1KO5A 5G1NA 1T4GA 5F2KA 5EJMA 4RW0A 1KH3A 3OPYB 4YCDA 5CX4A 3U5ZB 4CEHB 3ZV7A 2O8DB 3SDZA 1P9NA 3JQ6A 1EUCB 2QVBA 2XTAA 4J7CA 5LMNB 3P20A 5EVJA 4C07A 1PBTA 4EL0A 1YIOA 2Y1XA 3L1VA 4LW8A 5EZSA 1O5TA 4FE3A 4DVJA 2IA5A 2JARA 3RK1A 1MC5A 2DPHA 1WKVA 4I6GA 3R7WA 1L2TA 1WV0A 3W04A 5JAMA 4IG4A 4M49A 1KGDA 3T1TA 4BQSA 2HHLA 3GJQA 3GEBA 5F1YA 3AKDA 1JP7A 4WLUA 2FFBA 1OY1A 3UJPA 2PMBA 4G5SA 1FBTA 3L0DA 1PR6A 1T91A 2PYDA 4GLBA 3IQEA 2IHZA 1XL0A 3E35A 2NU8B 3OT5A 4FEGA 3JZIA 4IGKA 4FK8A 5IAEA 4ND7A 1JPNA 4ZGBA 5AVKA 5E2IA 2IS1A 3HUTA 4ZYVA 4IQGA 1ISFA 2ZJFA 4KV7A 5DBGA 5ALTA 3ZYZA 3E5NA 1KA9H 4RADA 3ROEA 3ZKWB 1O6ZA 4BBPA 1OJ7A 4C6SA 3K6SA 3EULA 4L74A 3S81A 1R4MA 5AK4A 2M6LA 3VSEA 1JMKC 3EGEA 3OOJA 5EHNA 3AJRA 3ICPA 5B4TA 5IKMA 2KI5A 4KMSA 3C8HA 1YR1A 2XGGA 1QIGA 4RAOA 1UBKS 1IY2A 4JI3B 3HXLA 4ZI7F 3G13A 1DKMA 3AIMA 3DYIA 3KJHA 5CNKA 3M6VA 1UFVA 2BELA 3DP7A 5D6NA 2G71A 3ID6C 2C5AA 1E2NA 4OCZA 3TWOA 3WNQA 2MSNA 2IHJA 4LX8A 5D5QA 3SIXA 1XHLA 4MB2A 3EXIA 4KQ1A 5B1EA 5IXYA 3HU5A 1PR5A 2BCJQ 2FPRA 3SR3A 1XPUA 2H5EA 2ZU6A 1FUUA 1I3MA 2AHRA 3D0KA 3G85A 3K1AA 3K72B 4ODIA 5EXSA 3N39C 2IVZA 4CLRB 1CUWA 2XKJE 3QKWA 2D06A 1LUAA 3UMYA 2MSWA 1EVKA 2O8DA 2DY1A 2CLIB 3KOUA 3UB4A 4UBOA 1M54A 4GPAA 3SIPA 2GDJA 2ENUA 4KPUB 1O87A 4Z1MA 1HFJA 2E4ZA 5JANA 1R9NA 4G89A 5BMVF 2NIPA 2PA0A 4M4SA 1T9BA 3HYTA 1PJ4A 4JJ6A 3OC6A 4O1IA 4ZIRA 4PQRA 3VMFA 1U80A 4LE2A 3DE2X 2X9LA 2W6MA 2B82A 3DKKA 3QFRA 1BX3A 3JWJA 3ROFA 5JBQA 4WERA 1G41A 1ACMA 4NOMA 2ROQA 2POCA 1EVEA 2FUCA 4IINA 4JQZA 3ZCRA 3NETA 4Z4HA 4QT0A 2CXOA 3DFMA 2AN5A 4FOSA 4HFMA 4PSAA 4BVFA 1ADFA 2ZVJA 3ACBA 1H0SA 2ZRIA 1COZA 3I34X 4OBEA 2YYAA 2Z56A 1LDMA 1Z6YA 4BB9A 3FDZA 1H8HA 3RYIB 3QEKA 2W6CX 4H0FA 4DQ0A 6PFKA 4MQBA 3SX2A 4KDRA 2ZE8A 1MZPA 1TKCA 2NYUA 2EJCA 2A5JA 2FY8A 2Z58A 2WUEA 3P0RA 1I3OA 1K89A 2CY0A 2QTMA 3DT6A 4ZTBA 3R0XA 4BNVA 2ZDQA 3PIIA 1MN6A 1SO8A 1ESEA 4RLHA 4WFQA 2QZSA 2YN4A 4ZVOA 1Q95A 2RH9B 1KYXA 2P2ZA 4D9EA 2WG2A 2V0CA 1XKTA 3HXTA 4I19A 1R5JA 2WU3A 2QTRA 4PU0A 4C04A 3NIGB 3LLMA 1ZU4A 4P98A 3PS9A 4KR2A 1SKQA 3WSTA 3CA8A 3D8RA 1HDRA 5EC8A 2FVYA 1UBJS 4JBGA 2R6GA 2WTNA 4B6SA 3S1LA 1C3OB 3MBOA 4PC1A 2H1RA 1FU8A 1LNQA 2FUNB 3C1AA 5H82A 2G04A 3VPBA 1XZMA 4IFIA 4BZPA 1T8SA 2EQBA 1N4AA 4BDTA 4NI5A 4B3DA 3EF3A 4LHXA 1OXUA 1RZVA 1TFUA 3IUYA 1GZVA 1U3CA 1XEWX 1T9GS 1BHJA 1W6UA 1L8AA 2FB9A 4PLWA 2R4QA 1WW2A 5D1HA 4O33A 4AVYA 3TQCA 4YFVA 4WKGA 3V5NA 3AJAA 4IRXA 4R1OA 3ZU5A 1RYNA 1TEVA 2O2SA 3CISA 3K8YA 2LGJA 1L5VA 2XA9A 4RETA 4L3OA 5CURA 4UU0A 4BFUA 4J0FA 1G5HA 3O2NA 5TQ2B 3ZIAD 4PHHA 2UUCB 2YX1A 3T95A 4N3CA 4S04A 1O6GA 1PWHA 3T54A 5LDGA 1P29A 4C5BA 5BQ3A 3WIUA 1K8XB 1Y5IA 2QG4A 2WD7B 2HH9A 2PAAA 3LVFO 5TGZA 3W5UA 5EE0A 4A3SA 5JEDA 2GHRA 3S6JA 2W6ID 2YBEA 2I4MA 4YAIA 1V8PA 3AU8A 1NPTO 4DUZB 1HL7A 1CRPA 4KAFA 1FJ2A 1O95A 1NVKA 4KC0A 3VV3A 5FV7A 3K6RA 3ORHA 1KJIA 3P96A 1L5HB 3K94A 4WOBA 4PZAA 2IXGA 4P7BA 4X7PA 5DEOA 2GZSA 3K1YA 2BRUA 2WHPA 2NTVA 3LUGA 4G1EB 3MUEA 3PUWA 5E6RA 1OAOA 3WWZA 6GPBA 1Z75A 4DA0A 2AD5A 2J5QA 4TXJA 4GPD1 5AP9A 5FWNA 4LJ8A 3HSSA 3JQAD 2W2NA 1YQXA 2DXIA 3SQLA 3QKTA 3LC2O 2O3TA 4XYMA 2AOTB 3G8AA 2QQEA 4AW9A 4AO6A 1MOQA 3KSUA 4M1TA 4YDHB 3OPXA 1Z63A 2CXHA 2X6QA 3EW9A 3ILSA 5IM4A 1PLJA 2CT8A 2PH7A 3FZEA 1C7JA 1KAGA 3PI6A 4JLOA 4TL6A 5CJJA 1YR2A 2H2GA 3FRIA 5I9SA 4A0FA 1PR0A 1H66A 1GL6A 2WTUA 4WGGA 3SBXA 5JARA 2HN9A 4EG6A 3LWZA 2GCEA 4TMTA 5JATA 4M46A 1F17A 3B60A 1MVLA 4DMRA 5H81A 1Z4KA 2UYGA 3FVWA 4F72A 4RTRA 1XRNA 1GL3A 2UU9B 1F6BA 5KOYA 4WFJA 4KO4S 2HQ1A 4EDHA 3V4RA 5ALQA 2SICE 4PC2A 5HTOA 2DULA 3F1KA 4KI7A 2IHBA 4WT7A 5LWHA 5JWHA 3T7KA 1DCTA 1OAKA 3ESDA 5LQMA 2QMHA 3KOOA 5IZCC 4NOKA 3I61A 2RAPA 3IBGA 1W25A 3HBLA 4KAJA 4M7WA 3MCAA 4YQEA 3RK4A 5BWMA 4PGGA 4CCYB 4D9GA 2X77A 3AESB 1D9ZA 1Z0DA 1VLQA 4XOUA 3CUTA 3V8BA 4F97A 3JRWA 4G25A 3ECSA 4ZICA 3WA6A 1QX4A 4NCNA 3F0TA 3NOOA 2PIAA 2QENA 3K73O 4WN9B 4JITA 4N39A 1XO1A 3OZVA 4BV2A 4MQLA 4Z3DA 3EFOB 3W0LB 2QTAA 3IUEA 3ZZMA 1HRDA 4O4IA 1CQJA 1E99A 2JASA 1TYEB 2XB8A 3N8HA 4CODB 4Q7MB 4YR9A 3DV0B 2OT3B 3QOYA 1STOA 2XDQA 5K0TA 4FGLA 1CQXA 4QFMA 4S1PA 3L8FA 4TSFD 5FULA 1G98A 2EX1A 3I42A 2YY6A 3C6BA 1CEEA 2JIRA 4G4GA 2DG2A 3EBPA 4MR7A 4B6FA 1W85A 2WKRA 3FHOA 2JAWA 2A88A 3H2ZA 1WDLA 5ALMA 4EW2A 4ZQIA 4NCHA 3FI0A 3WK8A 1SU4A 4FDLA 4MW0A 3DOIA 4L95C 5ECGC 2X41A 4JL6A 1Y98A 3CX3A 3OD5A 1G8AA 2ZE7A 2W8BA 4Q4HB 3L02A 5IKXA 1NG9A 1MB2A 1OB2A 5DGDA 3U62A 5LYJF 3BXOA 1VBNA 1Z29A 1KI6A 2Z9BA 3CNQS 5ALPA 3C3YA 3DL7A 3N2IA 3NV9A 2W8BB 1ESDA 2RBEA 3AGPA 2OKGA 4HR7A 3GRFA 3NUZA 1CDDA 3IO3A 3DAOA 1N3LA 2NUTA 4D02A 3CJQA 5AM5A 1SUWA 3ROZA 2X1MA 3LDHA 4B46A 3JXEA 2R1UA 2XMGA 3M4NA 5IDQA 3WB9A 1VHJA 2H1IA 2X22A 2ZYUX 3QPVA 4Q3NA 4QGHA 1RKUA 3U13A 4BBJA 3PPXA 1Y7IA 2J6HA 1HDCA 2FAXA 2ZYHA 3PUXA 4RVGA 4ZA2A 3MWJA 4URXR 3NKVA 2G06A 1O5IA 3UGQA 1D5WA 1ISIA 4HX2A 4LZZA 3VNVA 3HV0A 1C1HA 1RWBA 4M9SA 4MKZA 4OYRA 3T3IA 4XW2A 2IU6A 3MMPA 2GF9A 2YYYA 4UVHA 2A35A 2AFVA 4J3JA 2QMEA 3CNLA 1Q3KA 4XGQA 4AQDA 4BX0A 2OLKA 2P78A 1SOVA 4G23A 1OIVA 4DG9A 4DR1B 3THRA 1IHOA 1ZQ1A 4FCWA 1NJ5A 3PU6A 1EAMA 4E4RA 2W2LD 3TZQA 1R0ZA 1NMQA 1DELA 1LPPA 5AR1A 2XW6A 4L4YA 4MZXA 3E15A 3BUSA 3WK6A 3D8TA 5DTQA 3J81k 4MWDA 2VNSA 4CCWA 2UXDB 3K4HA 5KQGA 4D3YA 3R3SA 2F67A 4TKUB 2MJLA 1GUBA 4MS3B 3RRJA 1IQRA 4HPWA 3E18A 4EZIA 1UBMS 1EFPB 2WJAA 4HWOA 3E48A 4AJHA 1CLUA 1SVLA 2M2IA 3MGBA 5H3LA 3AL0C 1VGVA 5JI2E 4JUDX 3OQPA 2NV6A 1JG1A 4Q7KA 3ZIDA 1SKMA 1Y1SA 5DM60 4GLLA 2O57A 4EY7A 4FFBA 4JVMA 1TUEA 4PZZA 4F84A 2A8YA 3QEOA 5LA6B 3LCRA 4HYQA 2AMJA 4D5EA 2FLWA 2PQ2A 3KKOA 5JO9A 1RZRD 2RGNA 4MUXA 2RJ3A 4KGZA 4X8HA 3G2PA 3BC1A 4P84A 2UUOA 4HDNB 4DLNA 3H42B 5LZ9A 4V38A 5CEJA 2O3SA 1S2LA 2VTDA 3LL7A 5DI3A 5B37A 1Y8AA 1VL0A 2H4HA 4JLDA 2ECQA 3M4ZA 2NLOA 4C08A 2C4TA 3NNNA 1W44A 3RSSA 2HGSA 1UDRA 5BSGA 3RAFC 7MDHA 1CW2B 2ZWIA 3OFNA 4RULA 4DDUA 1KJZA 1LX6A 4AO7A 4L73A 5AFSA 3N2KA 1H9AA 2HT6A 1BVUA 1Y3FE 5D3ZA 5TMDA 4A6DA 1L7XA 4FFLA 4I1SA 2CHVA 1XAGA 3DLPX 2CLMB 2WJ3A 3KVRA 4BAZA 4EEXA 4F4HA 4P4SB 1AK1A 2ZBVA 1SKAA 4J6FA 4MV7A 1K2WA 1D1QA 3QPUA 4P3KA 1AMUA 2A1UA 4F4CA 4DANA 3R2JA 2OESA 1Z5UA 2C96A 3IUMA 3LVQE 2E4UA 3ORQA 4RS3A 5DJ5A 5AKJA 4BUZA 3G5LA 3DUFA 1E9VA 4NYMQ 2XQJA 3W9SA 5ALXA 1CBUA 3K5PA 3EFBA 1LPNA 4KQXA 1EG7A 5SV2A 3STUA 1ZUWA 5BSVA 7ADHA 2F17A 2Q5FA 4UUNA 4XSVA 5ALRA 4ZC8A 4B2IA 3DEFA 1CCWA 5AM3A 1SVKA 4BNTA 1OLXA 3IAEA 3AUKA 2OTCA 3QU4A 3CTMA 4TYQA 1U0JA 1XZ8A 3MMSA 4XB2A 1WXFA 1OKKD 4XWGA 2NUBA 2QD3A 3GT0A 4IUDS 4IVQA 1XEAA 3TRFA 3PL5A 4AMBA 5JJIA 1KH2A 1MVNA 1REQB 3VFDA 3UXHA 1F8YA 4E14A 4ZYWA 1JE0A 3D4IA 1FDTA 1K6IA 4IV5A 5KYWB 4DS3A 2FHSA 2WIJA 3CHYA 3CRZA 3VO1A 3RTEA 3AUSA 2OHVA 4B4VA 3C87A 4DXHA 4G1FA 1VG0B 4B2YA 3C3EA 5AKLA 5HQ3B 4EEZA 1BNCA 3ISJA 4PLTA 4NV3A 2HRZA 1E1QD 3TG8A 1SB8A 1GD1O 3MRTA 1ZFNA 5AI8A 3TW0A 2UUPA 5F77A 4WNAB 1BHQ1 4EHNA 3Q0IA 2R7MA 4RJJA 3DMRA 5ICCA 5IJZA 2HF8A 1TK3A 1FK8A 3U81A 1X0VA 1KKUA 2B98A 3QKIA 1R15A 2NM0A 3B1YA 1KEEA 3H3XA 1W1UA 1S7GA 3ABZA 1I3CA 4G9GA 5HRCA 1WKBA 3V3KA 4NCIA 3RHSA 3TVDA 1LJLA 4EH1A 5IYZB 1U1FA 2ZRHA 4MS4A 1W88B 3AG5A 3QVOA 4UZEA 1MJGA 621PA 2B8WA 4FGJA 3BA1A 5EMKA 3A6FA 3UAYA 1S5PA 2WU8A 2GASA 2HMTA 3G0DA 2HA2A 2RGWA 1UP6A 4FFNA 1QUEA 5A4KA 4B34A 5CYFA 1ZHFA 2AXEA 4HX9A 4K40A 1Z5OA 1N57A 4NZ9A 5FPHA 5AUOB 1XZHA 2ZI7A 2VK4A 5IUJC 1EWYA 2QE6A 4YY3B 2VT6A 1KSGA 1XJQA 3H9CA 2XF8A 3EH2A 1NGSA 1DJNA 2F1IA 1YS4A 4UC0A 3U4GA 4BIIA 3WGYA 2YVAA 3QRWA 3HU2A 1Y3CE 1VMDA 1QBGA 4AS3A 4EB6A 4JJAA 4P4GA 3D8UA 2IY7A 2Q27A 1NUHA 3GEPA 4HBGA 2COKA 4HPJB 1IEXA 4O2BF 4REMA 4JQYA 2QUHA 3E61A 3NFYA 3RSQA 4L4ZA 4QQRA 3HYRA 1A2OA 1XTZA 5B1DA 3GK3A 2PNFA 2ZI4A 4CFYA 4RGVA 1NYRA 4HLNA 1FS4A 4PNZA 3PXAA 1N36B 3KJQA 2JBWA 3I30X 4PPQA 5DASA 2PJDA 3B53X 3T06B 4PWZA 4UU8A 4DJDC 3AOGA 3LUKA 3ICOA 2PMKA 4N5IX 5LVAA 3ESZA 4B7CA 3PC8A 1K6MA 2IH5A 2Z83A 4U7TB 4WFKA 2F62A 5E8RA 3UUFA 3QWHA 1IH8A 3BCHA 5BURA 1S9DA 1Y9EA 2X2EA 4NCBA 2QX9A 1QKKA 4TSRA 4QRIA 2Y1LA 2IZ7A 4N3AA 1JNYA 1CY0A 4FD2A 4RNDB 3M83A 4NOLA 1C30A 1EB8A 1RWVA 2VDUE 4CL0A 5IN4A 1S9HA 5C1DA 1X87A 2AQHA 3DZDA 1DIBA 1TADA 2XT0A 4JP5A 5BN1A 3ZZ0A 1UK6A 1Z4LA 3N2ZB 4MAFA 2GWRA 3B52X 3PDWA 3C1TA 4B3SB 4Q3OA 2CHEA 1R88A 3AX6A 3ER6A 1TGYA 3QA9A 1VJ1A 3FPSA 3SHQA 1HNXB 2XR1A 5JMTA 5FP0A 4BLOA 5LQKA 1T0JB 4WWHA 5H68A 1ZIXA 4GXTA 4KHPB 1HETA 1XZKA 1PFYA 2ID7A 1XWIA 1YE3A 4MA0A 4O08A 1RRFA 1M5TA 2C2HA 2O1SA 2V6BA 3I2FA 2HZ7A 3OHSX 2I4OA 1P4RA 2GEFA 3PJGA 2ZZKA 5CG1A 1OFUA 4BVJA 2FSVA 2V96A 3H4VA 5HUQA 1HQKA 2OBBA 4KBFA 3O73A 1YUNA 2CSUA 2GZAA 2FN4A 4GVXA 1QG2A 1QGED 3TH5A 1Z74A 2HDOA 3SJAA 2NACA 1Y8RA 1OA1A 4TTRA 3BB3A 3IOEA 3GAAA 1ZK4A 4WBNB 1FF9A 4NEHB 3G9XA 4H60A 4ZQBA 2Z95A 4ZHQA 2G09A 4A27A 1DBSA 4DB4A 4OXQA 2OHXA 1G16A 3QNMA 2DX7A 4WLNA 4AF7A 4UXIA 2N75A 4Z99A 2O0JA 4WBNA 2VOJA 4QUAA 2EGUA 5HOQA 1QIHA 3BFPA 3QQPA 4GMGA 3DXYA 3A9SA 4LF9B 2V6FA 4DCOA 4NONA 1YHZA 4YYZA 2J5XA 1RI4A 2JH8A 5E2AA 4YBZA 3UIEA 3OSUA 1WTAA 2IYVA 3DM5A 1H5NA 1WBJB 2QM3A 1KFCB 1IE3A 4X00A 3E2MA 3NDPA 1Z5GA 4IDBA 4LY9A 1Q44A 4BNKA 4EKYA 4TZKA 4TRRA 1ZK3A 5CLIA 5C8YB 2C2MA 5T4EA 4N65A 3FPEA 1IHYA 2CLDX 2F55A 2WTBA 1WMBA 3M6UA 4DMHA 1F2TB 2HMSA 2JGIA 2YASA 3ZVKA 4P3PA 3STWA 1ORTA 2PFKA 3AXSA 4OIFA 2EWWA 2CBZA 2O6HA 4KU4A 2R66A 2OO5C 3EUEA 2VHXA 1X92A 2H5JA 5LMZA 1AQJA 1OYWA 1O97D 4WZAE 3UT6A 1JECA 4GBMA 2OENG 2FPIA 3C16C 2IITA 4NS1A 3RADC 1YZQA 2FPXA 3ML1A 2GPTA 3TR6A 3WHLA 1KXZA 4Q48A 4CFSA 1FQJA 1SKUA 2I3GA 2CEKA 2G4VA 1SURA 4KIUA 1CP2A 1X1DA 4H15A 3T4XA 2WDZA 4WBNF 1Y1LA 4GKJB 5AVZA 2R48A 2MHCA 1QLWA 5LP6C 1J00A 3OPMA 1ZL2A 4QG3A 3EW7A 2MR6A 3JWGA 2VYNA 3HLKA 5ALWA 1PL0A 3N07A 5BT8A 5GIOE 2ORYA 3DO8A 4DV0B 3PNSA 3UG6A 4WRRA 4GGOA 4ZAFA 3AHIA 4X97A 4YMVA 4MUBA 1TJ3A 2IYXA 2MSKA 4MKIA 3TLXA 1EX9A 4Q3AA 4KFSA 1SC6A 2WUWE 1Z22A 1J0EA 2AG0A 3C6YA 3GVHA 4QX6A 1GVNB 3UFBA 4XQ9A 2QTVA 5FPPA 4A10A 3BK1A 4MWGA 4JZKA 4PNPA 3NHJA 4R9SA 3TI7A 2PUEA 1XZDA 3R0QA 4B9AA 4E5NA 1TEZA 4DLBA 2KWIA 1GUAA 3BJEA 4P22A 2QTVB 3T3GA 5KTTA 1IONA 3OCUA 5CFQA 3H2JA 1XCPA 4W7IA 5EYPB 4CMIA 4GYKA 1OE0A 1OUMA 4IQFA 2B37A 16PKA 1DQSA 1KVSA 4I8IA 3O8NA 3DZFA 4B71A 3DC2A 3Q0EA 2YW9A 3PDJA 3WWDA 3HY4A 3ET5A 5D3MB 3EGWA 1I6KA 2BMAA 3M49A 3Q85A 1CUBA 1IULA 1DAFA 4YHBA 3U7RA 1NR5A 4QGFA 1PS0A 3ZE9A 3ZZNA 3A32A 5K05A 1VPDA 2FQWA 1W4ZA 1VCOA 3NM4A 1G2OA 2PZFA 1DU4A 3FLAA 2BTEA 4HOYA 4IDQA 4DOMA 2NVWA 4HAXA 3BH6A 3DTYA 3E7XA 1B8VA 3BXPA 2WMOB 4FN4A 4INJA 3U9LA 4EHBA 5KX5A 2O8FB 1TJNA 2PUAA 2OCLA 1V5WA 3KYDA 3Q8KA 1KO4A 4EHFA 3E2IA 5EPEA 1JLMA 5FORA 4D42A 3OQOA 4LUCA 5EKDA 3B70A 3PCRB 3LY9A 1M2GA 2XUFA 1Y89A 3GJYA 1D8TA 3O74A 3MYYA 4MOWA 1Z6AA 5LQNA 2F9FA 3O4HA 4GXRA 5BN5B 1CUJA 4F85A 2P2CA 3PP8A 1EWTA 1ZIOA 2E82A 5EQFA 1M10A 4HH0A 3WTBA 4W5NA 4XIFA 1QYXA 1RZ3A 3FWNA 3N8KA 4LMAA 1AHHA 2K4MA 3PR2B 4K9QA 4OLHA 4G85A 3IMGA 3YASA 5FT9A 1PBNA 1EVJA 1U7XA 3LPAA 3ZD9A 5BRAA 1PL6A 3AI7A 1ECLA 1SELA 1WE2A 3FBTA 3L8GA 4KSYA 5AI0A 1DARA 1PSDA 1ZCBA 3A9WA 5DNAA 5J2TB 1J9EA 3NWOA 2BZ0A 3TAHA 3D6FA 3DKPA 2OXTA 5KNCD 4P4UA 1DIAA 4FDTA 1J90A 4NPAA 2H2IA 2ORED 4BNGA 1SUFA 4GO1A 4ENUA 5AW4A 1XQYA 5CYPA 4WXRA 3S2EA 2I78A 4HTFA 1TYAE 3T52A 5BSKA 1U81A 5FHQA 2E5WA 3CCCA 4KVGA 4TL8A 1QVVA 3CMCO 4MVCA 4PR0A 5I4BA 2CYBA 3DWFA 2IODA 4LHZA 4MINA 3G6KA 1BEEA 4YLEA 4CMBA 1NUTA 4XRGA 1YQEA 1M6WA 3O4VA 4L15A 4Q01A 3PEWA 1UBSB 1M2JA 4C4RA 2FDRA 4KQKA 1VE3A 4F06A 4LA4A 2PG3A 4XKJA 2WIGA 1DAMA 2YH2A 3RRXA 5LSAA 3LP8A 5AJHA 5CJPA 1CE8A 4H31A 2EKLA 5CVVA 1DNPA 5AM2A 4ZK6A 4H18A 3A2LA 3NB0A 1XB2A 2MT9A 2VNIA 1T0IA 2XT6A 3H11B 1IEQA 3JPWA 5D5PA 1TYZA 2PVSA 3KHSA 3B13B 2J0EA 4TS3A 1NSFA 4BP1A 1GFSA 4FGZA 4HN4B 3A05A 2E4VA 4LRSB 2G9NA 2BKVA 1NASA 2V9CA 3H1FA 1AV7A 2RH5A 2WYOA 5INTA 5DLPA 1RQLA 1QPZA 3KZMA 4QU9A 1J22A 1Y7TA 1Z3CA 2YNMA 3D8NA 3EQ2A 4EKNB 5T3UA 1RAEA 3OEED 4KLCA 4CG0A 4Y6QA 2RMKA 4I6EA 4KBGA 1M72A 4DVGA 2OYCA 1FX1A 3M5PA 1CZLA 3ES9A 1Y42X 3LVRE 4JXKA 4LX0A 4JAVC 4PTZA 5J2TF 4CUJA 1BQ3A 3MN1A 4ON9A 3FOBA 4QEZA 4PYQA 2F8MA 1IJKA 5CVDA 7GPBA 1SUPA 3N0TA 4UTZA 3VR2A 5JO0A 1ZA2A 1BG6A 3VU9B 3LFTA 1DB3A 3H04A 1FVOA 1NMXA 2C2ZA 2YHUA 1WCV1 3U7QA 3JVUA 4PRYA 2HV8A 3V2GA 3WKCA 4B7XA 4RANA 2GN8A 5EZYF 4UULA 4XPIB 3JX9A 2JI4A 2VUHB 2HCTA 1H2HA 1YVUA 4HO1X 5CDUA 1YZUA 5AI6A 3HJAA 4ZD6A 2P9CA 4HF7A 5EVCA 4UUOA 2NU9B 4C76A 2QTGA 3CS3A 4RJTA 5BYBA 5JDCA 2VATA 3H2HA 3NJRA 2NP6A 3L04A 4ENRA 3LK7A 3W2IA 4UOQA 1SB9A 1E58A 2VA8A 5EE1A 1M7GA 4ARAA 5J43A 5EG5A 1AA9A 4N5LA 2FRDA 3RWBA 1PG0A 3RRBA 3IRVA 5B55A 3PQDA 2GCIA 1PDOA 1XRJA 2ZSBA 3C3BA 5J9FA 2OOKA 2FR1A 5E3IA 5LZ8A 1MIHA 1E1RD 1F0KA 3PE6A 1JR4A 1GA6A 1RQPA 2BBOA 2ZETA 4HEA1 4RV5A 2QY6A 3GN1A 5EEGA 4AJLA 1OX5A 4OJQA 1U0GA 2C7GA 2ZP1A 3DOUA 3TL2A 3FOEC 5CM8B 4EDFA 5KO2A 1MIOB 1WV1A 3TEMA 4BTVA 4LOLA 2WHRA 2BONA 5E1DA 5JBIA 1ZD8A 5TPZD 4FFDA 3Q87B 2EL9A 4BLPA 5FWXB 1E5DA 2XNDD 1NFRA 4BUCA 4YRCA 4Q12A 5IANA 5J58A 3E84A 1V25A 1W0KD 2HR1A 2JKVA 4TLBA 4Q93A 1T9KA 3VQTA 4HXEB 1ESMA 3H8JA 5A3SA 1P62B 1KARA 1TJ5A 5TQ0A 1DV1A 1DXQA 3IEXA 1YMUA 1AK9A 4I2VA 3MEQA 1E69A 1QCYA 2VTEA 2GYYA 3LP6A 5DLEA 4YUWA 1TVMA 2O2YA 2FFHA 1H1LA 2V8OA 3M9LA 1ZKDA 2C4MA 2YC4C 1JDBB 1FFHA 3FPJA 2GWHA 1Y33E 3MAJA 2ADOA 4Q3CA 3N3BC 3QM1A 1O9HA 2DWPA 2PX8A 2RAFA 3D6AA 3AFGA 4TTVA 5C1IA 1V3QE 5AHRA 3WGUA 4DC1A 4CL2A 1E77A 1S1MA 1G5PA 1ZNXA 3THOA 3BQNB 3R41A 3UKOA 3FBWA 2E0IA 2JRCA 1I7LA 3P4YA 1BKDR 3WGKA 2JA2A 2PUDA 5A4MS 2QRVA 1G8GA 1A2BA 4GBJA 4C6HA 4C5AA 3U60B 2WUDA 1TCBA 1DBRA 3CUEF 1KBZA 4Q37A 1QO0D 1TC2A 1YZKA 3GJZA 2FDCA 5CP8A 4I4NA 4XCVA 3GCDA 1P0FA 1DX4A 5KTYA 1E9DA 4OH1A 2F3RA 3L8YA 5DSZA 1IJEA 4PAMA 1IPEA 1N6HA 2AFHA 2OWDA 3BPSA 4JS0A 4GL4A 1TUGA 1VTKA 2HWWA 8GPBA 3TAUA 4JJFA 3C0KA 3VX3A 3B7WA 3BTVA 3FGNA 2X8BA 2H1HA 4GRIA 1HDXA 4CKXA 2I4NA 4I5EA 3GFQA 4FX2A 1DX6A 2OBFA 1KK1A 2PD3A 4D9MA 3KEGA 4OJKA 5FBQB 1JG2A 1JG3A 2G6BA 4YT5A 3RAPR 1KEVA 3OZIA 4KXXA 3T5DA 4V0MA 2FW6A 3GH3A 4IIXA 4X94A 2AVDA 4TV8F 2HW8A 2DQSA 3ZZ1A 3K2EA 3U3RA 2ZZMA 5DIFA 3N8NA 4OKNA 3D02A 4S12A 3VZBA 1G3QA 1EJ2A 3TKYA 2PL3A 4DMCA 1KJ8A 4JI0B 5I8PA 2H0AA 5CFMA 4PO9A 4RZIA 2V7GA 1DAKA 2YHIA 3W4IA 1WMEA 4FHEA 3WLIA 1KR2A 4JYPA 3EHEA 5EJ9A 5HJ5A 4KRFA 3P8ZA 4CTOA 1NMZA 4I66A 5EE3A 3EDCA 1M67A 4KMOA 1SXPA 1P3JA 3QLUA 1JAIA 1MAVA 3LUDA 1WCYA 3WJ2A 1JHPA 2IXEA 4JQOA 1KSJA 4FEYA 3I9MA 1FRNA 1Y1RA 2PS0A 2CFIA 4PEVA 2A9OA 5JZ9A 2JFZA 4CM3A 4MVJH 2H1VA 5E7JA 1JYEA 4HDAA 4AMZA 5LU9A 4WVFA 2YZKA 4U3JB 3GEEA 1IL0A 3L9XA 2KSQA 3TQTA 2E37A 2TMGA 4HQOA 1KNXA 1QOZA 2QV7A 2HA4A 5DNCA 2V58A 4BCBA 1QH8A 3WLPA 1NVMB 4FC6A 3OF5A 2NGRA 1K3UB 3K6JA 2PRIA 4XFKA 1EBBA 2M98A 3FZYA 4R1QA 2QLFA 3CH5A 5DI9A 3U31A 3L1KA 1QO0A 2QMOA 4ZOLB 4DNQA 4HGYA 1Y4ZA 1SKBA 1OWOA 3KAJA 1G0OA 2AJTA 3QLUC 4HL6A 1PWXA 1WPQA 1D6JA 4IAOA 5JPIA 1JVBA 2Z9DA 1JMYA 3UG7A 1RM0A 1EAYA 3M1YA 4LY6A 4L8YA 1GN9A 5A03A 4YCMA 2ZW9A 4ML3A 1XBTA 3B51X 3EMBA 4I3GA 3ZK8A 5I5EA 4M9RA 1ZVVA 2C82A 4UDYX 2EBFX 4DEXA 4EI9A 3VKUA 3BFKA 2F8TA 1O8BA 2RHMA 4LPSA 3T94A 3V3TA 1CB0A 4OG2A 5YASA 5EMNA 5IHXA 3NIBA 4B6OA 1I4LD 3ZC3A 4FUQA 4ZOCA 1XA0A 3F3MA 4LZWA 4P5EA 4P80A 1ZJWA 3C48A 1AHPA 2P41A 3D5EA 3C3PA 4TVKA 4UTRA 4P82A 3DV0A 4ERXA 4MKFA 1Y5NA 4I4TA 4R81A 3ESRA 5F21A 2DKNA 5ALKA 4IJ5A 5AKGA 1KJJA 4NBWA 4MWBA 2MINA 4X6YA 3DQPA 3STVA 1HTWA 5C8VA 1R8QA 2BFBA 2ERYA 4RY8A 121PA 1BU8A 1LXCA 2OV8A 1Q15A 1E2UA 2NYRA 1UCFA 4LDRA 4EGAA 1CEXA 2BGKA 3TOZA 3LAWA 2DBVO 3NVKI 1H2RS 1I9GA 1JS1X 1L4KA 1V9SA 5KHOC 3OE4A 1XQWA 1YR8A 3DBRB 3I6YA 5DYNA 1MHTA 2D1TA 2BJVA 2PX5A 3SGLA 3VPAA 4BE9A 5F2NA 3AC0A 5JJKA 1NF8A 3CSUA 1KVUA 2F4VB 1IOLA 3MJEA 4HMQA 1LS6A 2G67A 2A0WA 2XCOA 1NM5A 4E03A 3DBRA 1XTRA 5JU6A 4CJXA 1ISRA 2IEIA 2P4QA 4OREX 3TGWA 4NJMB 3HP7A 2AN1A 1WQ4A 2I3ZA 1VB5A 4XPZA 2HY7A 2QUJA 3H7AA 3OM8A 2DSTA 3RSOA 2VQ6A 3F3YA 1ULZA 4O4LB 3JWPA 3PHCA 4Q5IA 4RORA 3EZ7A 4UKDA 5EMJA 4KZKA 1QONA 1YQDA 3R3WA 4V0RA 1JQKA 3COYA 4V3BA 4CIXA 4EECA 4EJSC 3AVOA 1ISPA 5LC1A 1U6KA 1O08A 2ZPUA 4A8JA 4IJWA 3WYBA 1YH3A 1A8SA 2DSNA 4JWKA 1JFFB 4FE4A 1RKVA 5C8YF 1PUJA 2Y67A 4UMEA 2VYQA 1OXKB 3KEQA 1MO6A 1DPGA 4M1ZA 1E2LA 4H6WA 2AEFA 4PVCA 2QKYA 3VC2A 5ICEA 5DTIA 1CPYA 3A2MA 1MRNA 2XOXA 2Y05A 3PNQA 3KQUA 3PKIA 1ZW6A 3GO4A 3H19A 1GAWA 5FFFA 5B3JA 1U2QA 2GXAA 2JRLA 4HDRB 3JD2A 5TJ9A 2G72A 4NXNB 4Q24A 5FNVF 3AZQA 1E66A 1GNRA 2G08A 2WV9A 3P2MA 4I08A 4LCEA 4EO7A 2XAAA 1PV2A 2R47A 3VC3A 4MVJD 2OYRA 2P9QA 5FBWB 2IC5A 2GPJA 4GPBA 1AGRA 1JAXA 4LXTA 3STYA 2FWNA 2C3YA 4AIRA 1MF7A 5EIFA 3QOXA 3A1WA 3OZBA 4LE0A 3JAWA 4NBLA 1U8YA 2ZR8A 5C7OO 6LDHA 2VDNB 4PSCA 1ZCZA 4I55A 1JR3E 4MQ6A 5DWQA 5C46F 1M2WA 1W73A 3R74A 2BI7A 1OLOA 3ZVLA 3PITA 5BOSB 3IULA 2QL5A 4PLGA 4KO3S 4N5MA 3OZAA 1JE1A 4FFBB 3S2GA 5SYNA 1W5SA 4FNOA 5ABPA 3H2GA 4UQLA 2PUHA 1MPXA 3EPKA 4XIIA 1K27A 2CZQA 2IX9A 1UAAA 2NX2A 5LDHA 1J2RA 1NOJA 3MT0A 4P4LA 3RB8A 2JLXA 5THQA 4XM1A 1NUSA 2XYPA 1GSOA 1E5LA 1M7BA 2ZROA 3FIJA 3BK7A 3NTOA 4GYYA 4A2CA 3AGQA 2KLBA 3OKFA 2ANCA 2FJPA 2ZBDA 4TRMA 1X1CA 2VJQA 4LJKA 2GJAA 1WB5A 1K7EB 2PR7A 2IZZA 3C6KA 4WECA 5JCXA 1R0LA 7REQA 2Q9AA 3H2YA 4Q3LA 3T1YB 1GT91 5EIXA 4PZCA 4BFVA 5IXSA 1WO8A 4GWLA 3FG9A 4KAAA 2ZIUB 5ANRB 4XVQA 1JU9A 2ZWOA 3PGJA 4L28A 1YFLA 4GI1A 1B3RA 1L4MA 2KLHA 4UNPA 4ETWA 4RTNA 2AOUB 3KE8A 4YMLA 2O8EA 4U5XA 1QZ3A 1HORA 1E3LA 2ZUBA 4N47A 2SECE 3DBLB 4RD3A 1J49A 1VP9A 4IKOA 3WL7A 2VDMB 1NF2A 4I4IA 3WQSB 3ZYCA 2O8EB 4BQEA 5AW1A 3MWFA 4UAVA 3WRVA 1T3TA 3X1DA 5B2EA 1WOYA 3BXFA 4DV5B 1N25A 4NNOA 4OQZA 5JNVA 2HSWA 1MA0A 5HFAA 4MV3A 4FNMA 1OWPA 1RQ2A 5A5DA 1V1RA 3JR7A 4JEHA 4DDKA 2XUGA 3BMCB 3RS4A 2JHCA 3ZGXA 2W37A 2M1XA 2OYSA 2PGOA 3QVMA 5AJTA 4E2YA 1N0VC 4MP6A 1MP0A 2NXCA 1U28A 3QVKA 5H8WA 3QFTA 4MJ3A 3ME5A 2W11A 5EOVA 3ZE1B 4XUGB 1DTEA 1H2FA 3RKSA 1VSQA 4BS9A 1D04A 5CEFA 1UOOA 1EXDA 2BM8A 1V5EA 3F5MA 1Y0BA 4ARSA 5C52B 3QPAA 4LHYA 2ZXUA 1DC3A 1XF9A 3U56A 4J0KA 4HEHA 1L6IA 2E3JA 4F56A 3UZUA 2PMCA 1T2FA 1AS3A 1K4YA 1PK9A 1UP7A 1TLTA 2M9MA 2VF4X 4L85A 4BJ5A 2DCUA 3U3ZA 4Q0MA 1E3JA 1KP2A 1P6XA 2FWAA 4XM0A 5EJAA 2QZ4A 1UR5A 4M9CA 4G8CA 4NBKA 2ZT7A 4YLYA 5A5FA 1Q91A 3H1AA 1DE0A 2ASVA 1Q1AA 2DHEA 1V4VA 3R7SA 3H4TA 3TRJA 3TKAA 1NBWB 5EZYA 4BQNA 3J7AC 2GPBA 2DHDA 4J2OA 1RWMA 5BXQC 2NU6A 1DRWA 3IP7A 3M4JA 2WLSA 4Z1OA 3L6BA 4ND1A 3GJ5A 4WEOA 2EKPA 1P0PA 1O94D 4PRZA 1KEEB 3Q5EA 1K7YA 2NO7A 1HQYE 1PR4A 3N6XA 2OZVA 4TXLA 4DA4A 2NU6B 1FNCA 1K68A 1OA0A 2PWZA 4FOPA 4NZNA 3ZNOA 1Y34E 3OQIA 3DDUA 3SSNA 1VKRA 1SBTA 2ACWA 3A14A 3A8TA 3KQMA 2ZQZA 3L8MA 3PC8C 1GHTA 1W35A 2ZRFA 3O1LA 4IEEA 3WX0A 3UAZA 3IHWA 3ZE2B 3MPUA 3TGLA 3JASB 3GRAA 1T4DA 4KR0A 3FOFC 1QFXA 2V7PA 4M1YA 3T3OA 2PT7A 1WEKA 3NXKA 5IJ0B 1YJ5A 4G0WA 4WN3A 5FL3A 3LQFA 5AKKA 4BNDA 2YQZA 3G9QA 5DNDA 2DPGA 2C7VA 5FOUA 3WP0A 1PJAA 1GNSA 1QGDA 2KQUA 1NR7A 4AG6A 1I51A 1HDIA 2C58A 2O7VA 3F9RA 1QAOA 1XYGA 3MB8A 3MWGA 5E9JA 4WLOA 2FP4B 1FXWA 2BHNA 1S2MA 2BGUA 3CKYA 4REQB 2I1VB 3UGJA 2Y68A 3LQQA 2VRWA 1V8DA 1L4YA 3NWBA 3UMVA 4HZUB 3USCS 1NT4A 3A4YA 4BHTA 1WETA 2OPHA 3H9EO 2FN7A 2R7LA 1DXOA 1W4LA 3A4TA 3P0IA 3QLVA 4KGXA 2I3DA 2WA1A 1J6UA 1OYOA 4O2LA 2ZIXA 1SVIA 1ID8A 3KR2A 1R6XA 1NOKA 4W5TA 4MWEA