4DLRA

H-ras peg 400/ca(oac)2, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlrA00
3VNVA 4V0LA 4MYHA 1A82A 1ZUIA 3KXLA 2IF2A 2CVFA 4BEJA 4KYUA 2ZYTX 3Q5DA 4DCUA 1CJVC 3K9LA 4PQYA 1PUJA 2QNRA 4FMCB 3LBHA 3THWB 4GOXA 1JQJC 2Z5FA 1UBEA 5EXPA 3FGNA 1II0A 4I1OA 4E03A 1ZYUA 5B58C 2BC9A 2D7DA 2H1LA 5JEEA 3KJIA 1NLFA 3TBKA 4P4UA 2PZEA 4YONB 2AXNA 1U0HC 1E0KA 4EKDA 4B71A 1W5TA 1LY1A 2C98A 4URYR 2J46A 1G8GA 2WAYA 1VCNA 5CYPA 1Q44A 1ZM4A 3I8SA 5GVRA 1LS1A 4DCNA 2VRWA 2RHMA 4ZKEA 3DM9B 2ONJA 5KNBA 2BEJA 2MSEB 2AR7A 4IDPA 4Q21A 2ZPTX 2REXB 5A4JA 4PC3A 1KI7A 3RS4A 3SR0A 3OIWA 1BO6A 2CCKA 5HKKD 3QG1A 3T61A 4DCSA 1XBTA 1FUKA 3WXMA 4DLUA 4YMVA 4UXHA 3SJBA 4FWIB 2GJSA 1UFQA 2N42A 4CEHA 2ONKA 3IEVA 2NMVA 4A36A 1GWNA 1E1QA 4LBYA 2GZHA 2E87A 4ASUA 4EDHA 4X8OA 3QBVA 1Z07A 2V3CC 1LF5A 3IGFA 3OZXA 1II9A 3B82A 4QBFA 3PFIA 2YKGA 3GJXC 4G5GA 4NCIA 1NVUQ 4XSHA 2IYTA 4DZZA 3GJ5A 2XTNA 5D3MA 3NH6A 4KO8A 3TUJC 3A1TA 1W4BA 2VL7A 4QJ4A 1LW7A 3QKSB 4P31A 5E7MA 3SQXA 4B6FA 1Z0KA 2W6IA 2CJWA 1IONA 3H84A 1Z0JA 2NO1A 3F5FA 4XD7A 1MR3F 2RAPA 3ND8A 1Z6TA 1OH6A 3QENA 3CF6R 2QMOA 1KI2A 2QE7A 3ZVMA 3B1ZA 4LJ6A 1N6PA 2ZI6A 5JBQA 4LGMA 2FDCA 1OE0A 1CR0A 4A0HA 1CP2A 1CR2A 3F0TA 2WSMA 5TMPA 5TARA 4LV5B 3BFKA 3VMFA 3UANA 1HURA 2KBEA 1FL9A 2YWGA 3JVUA 3TGPA 2H92A 4UNQA 2ZJOA 3A1SA 1I2MA 3RAPR 3G5UA 3WHLA 1AKYA 1P62B 5JRZA 2E9SA 1HQCA 2HYDA 4UNPA 3EX7C 4WAUA 5FBVB 1SVOA 1AIPA 1G7TA 2HXYA 1TEXA 3BORA 4ASUD 4ZDIA 2BBWA 3GCGA 2IXEA 1OXUA 4XTCS 2VBCA 4F4CA 3BB1A 4B2IA 1P9NA 4NYIQ 2IYLD 5GJCA 5F3WB 3N2EA 4BLOA 3LBNA 2PCJA 3LLMA 4DB4A 2B8WA 3GJ3A 1XD8A 1GG2A 4GT1A 5JHGB 4H1UA 1II8A 1IJEA 5B2ZA 4JLMA 1PJRA 2WKRA 3A58B 1LS6A 4XD7D 1RE0A 3OEHD 2GEVA 1ZRHA 4LJ8A 1YVDA 1P9WA 1WQ1R 4QXAA 4CVNA 1U8ZA 2XEXA 5CJPA 3FB4A 2OO7A 3HU1A 4D6PA 1KMHA 2ZR9A 4PPQA 3C16C 1K6MA 1GNRA 1NSFA 4CF7A 2WOOA 4GZMA 4PO1A 1GITA 1NY5A 2HF9A 2C8VA 3U3KA 2IYSA 1FPMA 4IOLA 1L8QA 4V03A 4ESHA 1W5SA 2C03A 1FP7A 1HV8A 2C9YA 2AD1A 2OILA 4GFDA 4JLNA 2XXAA 5JJIA 5E3HA 2WWXA 4Q4AA 3AF2A 3Q7PA 2VP0A 4TQAA 3OIYA 1P4SA 1C1YA 2DWQA 3OESA 3WYGA 4B33A 4OQFA 3TUZC 2ZE8A 1VECA 5CM8B 2FF7A 4TL9A 4N3NA 3L43A 4TYPA 3CM0A 4ILEA 2GVZC 5H68A 1XFAA 1WA5A 3LXRA 5F9HA 2ZUCA 1DBSA 2GCOB 1AJEA 1P72A 4W7SA 3VR4A 2PEZA 2QAGB 3N5CA 3OIUA 4KFUA 3T1VA 4BFSA 2A9KA 3BAFA 3HR8A 4QGHA 1RPZA 4JS0A 3GLFA 1W0KD 5UKDA 4OK6A 1F2TB 2WJYA 1NBME 3CKLA 2D06A 4MRPA 4BFXA 4D82A 1E2MA 2WWYA 1GL7A 3MMPA 1L4UA 2J1LA 3ICQB 3GLHB 3W34A 2X19A 1E2LA 1R0XA 2ZSEA 3A4MA 1P2TA 4HB2A 4I99A 5FBQB 3WY9A 1SXJE 2NG1A 3K0FA 2ZRPA 3MD0A 1AK2A 3NIBA 3D7MA 4EQ6B 2KSQA 4KXFB 1IAQA 1TEVA 2DWPA 3AUYA 3LXXA 1N6NA 2R6AA 1L4YA 2EFGA 1UKEA 1D5CA 3LFUA 2H8KA 2XTMA 1YRAA 3U7HB 3OE7A 1LVGA 5CDFA 5HZKA 4DLWA 4QGFA 521PA 2FSHA 4HDOB 2CEAA 2CLDX 3M6AA 1G20E 5EE1A 3X1DA 4C0LA 2LKDA 4LUCA 4AY2A 2O8EB 1Q3TA 1J90A 2W83A 3QVVA 2DR3A 1KO4A 2W2XA 3IHLA 3OF5A 3F8TA 3SFZA 1MO4A 1I4DD 5GADl 4FIDA 1UPTA 4YC7A 5SZKB 3R9IA 2XZLA 3SI7A 2QAGC 1N6KA 2B8TA 121PA 3EARA 3C15C 3PEVA 2QPOA 1K8RA 2AHOA 1Z06A 3HWSA 3IO5A 2FSFA 3KXKA 2ZXUA 4HLUA 4D2IA 3H1TA 1NIPA 4JLKA 2UZ3A 2JJ8A 3K0CA 3TNFA 4XVUA 2HJGA 2ATXA 3W8NA 3KL4A 1RJ9B 3EIQA 3WNBA 2XAUA 3PENA 4F4JA 1S1CA 1H8EA 2NO9A 1ODFA 5KNDA 3E5HA 2BMEA 2N1BA 4M2LA 1N5LA 3E2IA 3H0KA 3BXZA 4B48A 4NCNA 5FR1A 2BM0A 1VDZA 2PJZA 1TUEA 1XMVA 4DWJA 4EFMA 5C4MA 2JJ2A 4A6XA 1FUUA 2ZSDA 3L0IB 4PC1A 1XNJA 3RNLA 4OQLA 4KFTA 4Q00A 1E2EA 4MGIR 3LO5A 5LPNA 2QMEA 3DO6A 4C3ZA 4ITRC 5B57C 3K09A 2PT7A 4HAWA 1Q0UA 4NCKA 3WRXC 3EG5A 4GNKA 2F55A 1A2KC 2BBOA 2FFHA 2R6FA 4LCBA 1WE2A 2TMKA 4FCWA 2EWWA 2F7SA 3DZDA 1UBFA 2OXCA 4TL8A 3QKUA 2DPXA 2V6IA 4MITA 1E1RA 4F7WA 4DLTA 2WICA 5DI9A 2ZETA 3DOEA 2ODWA 1TQ4A 4C2UA 1BMFD 3LLUA 4IHQA 4ARZB 1IXSB 1NBMA 1TU3A 2IUUA 2IXFA 4B3CA 1KGDA 2Q3HA 1TUIA 1WRBA 2A3RA 2CK3D 4FW9A 4LJ9A 4KBFA 3RVBA 2RKOA 1XF9A 5BYJA 4EPWA 2GXSA 4TT3D 1UAAA 1P2UA 1CLUA 2O0JA 2CHGA 3SE0A 5EZ5A 4LV6A 4DUGD 1QG2A 2ZANA 1EX7A 4JIMA 4M4SA 3H2YA 4JLOA 3REGA 4MDFA 2YV5A 1T6NA 3NEYA 4HAXA 1XXHB 4BLTA 1QHYA 3LBIA 2B6HA 3LX5A 2BOVA 4YDHB 1EWRA 5H70A 5CIWA 4DDUA 5JMTA 5EUMA 2JLSA 1R0ZA 4AYXA 3B9PA 1OXXK 3R9XA 3WBJA 2VSFA 1VCIA 4E09A 2GKSA 1FX0B 1WMSA 3RS2A 3LY5A 4DBLC 1NIJA 4HAZA 1OXSC 2C9OA 4JLVA 1GDDA 2OESA 3GPLA 3ZD6A 3BH6A 3WP0A 1T5IA 1W7AA 1EFHA 2FEOA 4PZYA 2J7PD 1ONBA 4AC9A 2O8BA 4M1KA 4QOSA 4V0NA 3HYTA 2JATA 1Z83A 3NWJA 2IA5A 4Q9JA 5EUQB 1G17A 4YLGA 5JRJA 5CYOA 1RRCA 3GJ4A 3WYAA 1NLZA 2VHJA 2JJ1D 3Q3JB 4XTRA 1RKBA 2Q0HA 2WMOB 4I1VA 4US0R 2ZUBA 4B3XA 1U98A 4URXR 1XEXB 2J9RA 3X1YA 4C0HA 3FDIA 1IQPA 2FX3A 1TTTA 1HTWA 1NSTA 2R6DA 5G40A 1KZ7B 1QHNA 3K9HA 4IOMA 3ND9A 5EP4A 3BS4A 1N0UA 4KFRA 3A36A 1E9RA 3CNLA 3W6NA 4KVAA 4LJ7A 4A8JA 3KJGA 3CF0A 1N6IA 2P65A 4DRZA 4LYHA 3RRNA 3CR7A 3VHXA 5J40A 2A5GA 1BIFA 3FKSD 1UKVY 1XTKA 3UWOA 2GEUA 1U2RA 2ZR0A 1CIPA 1KNQA 1WP9A 4RZ2A 4CEIB 2OG2A 2QENA 3R7WA 1KO7A 4PPFA 1IM2A 4R2IA 2BKEA 1KDRA 1XTSA 5DIFA 3TMKA 5JSZA 4O2RA 3NTUA 2WVJA 5L3QA 2XOKD 3ICEA 3TLXA 4Z51A 1L7VC 2ZTSA 1HE1C 2IT1A 4UJ5A 2AWNA 2LWIA 1R4AA 1EGAA 1MOZA 4R71A 4ON9A 1G8FA 3UKDA 5HTKA 2ZJAA 4LBWA 3ZJYA 4MYCA 4BFUA 3LNCA 1HY3A 2ZYUX 1HEIA 2HXSA 5FOWA 2F9LA 2ZI4A 3UIEA 1W4RA 5IHPA 4CEJB 1M7BA 5K8TA 1CULC 4OQXA 4TQUS 1KI3A 4PX9A 1LB1B 2ASEA 3GEIA 4TLCA 2CLSA 2NZJA 3CWQA 4B34A 4B47A 4D26A 3K70B 4HDQB 2J0SA 1XTIA 3AVOA 3I5XA 2QZ4A 3RLFA 4HEJA 1Z8FA 1G5RA 1M7HA 4HAVA 1O87A 4MQBA 4QG7A 4C7OB 3KTAA 1P75A 1JAIA 5SZJA 5J47A 1OH8A 2OEPA 1LTQA 1ZP6A 4C4PA 2IUTA 4Q1BA 3B7GA 3T34A 1KO5A 2HJVA 5E7IA 3WMFA 1FMJA 2J0UA 4RJLA 5DGXA 3PUVA 5FPHA 1E79A 2AXPA 2WWHA 5HKKA 2DFTA 4KLNA 3OFND 2W00A 4GBMA 3CIOA 4ZPXA 3ZZ0A 2XZOA 1Q1EA 3HPQA 4JJKA 1XEWX 2ZE5A 3THXA 1PVOA 1CXZA 2OUKA 4PHHA 2QPAA 4HYYA 3GP8A 4PC7A 3B8HA 1FW6A 5KSPA 4PHTA 5KO2A 1UM8A 2G1JA 3R8CA 1NKTA 4HSEA 3SHWA 4ERNA 1DAIA 3KQNA 2JLVA 4O2LA 1ZM9A 2A5FA 1KO8A 1MKYA 2RGGA 5BN3A 5JLJA 5P21A 1TF5A 3U3MA 2XX3A 3CNNA 3RSLA 4UNNA 4RFSA 1UDXA 1G6HA 4IKEA 3RWMB 4JBYA 1ZUNB 3DDCA 1NJFA 5JWHA 5JFGA 3R8FA 4BZXA 1E2HA 2ZAOA 3S1AB 3RRMA 2CJWB 1XPRA 5F2EA 2QEQA 1H8HD 2OCYC 1YZUA 3CR8A 1P3JA 3DMDA 2ZRCA 3G82C 2JEOA 1YJ5A 1HUQA 1AQYA 1F6BA 2BBTA 3I73A 2XZPA 2Y8EA 2N46A 1NKSA 4PO8A 4QBIA 3CPJB 5AK0A 3WMGA 2JLXA 3QVUA 3ASYA 1DO2A 1G3MA 1X3SA 3U44B 2CHVA 3X1XA 2ZJ5A 2MMCA 2W6JA 5JJLA 4PANA 4C0QC 2D3WA 2KB0A 2V55B 2NOAA 5A0FA 2DB3A 4PXAA 2ORIA 1UKYA 2H57A 3GJ8A 1A5TA 4W9MC 4B3GA 4B2PA 2EYUA 4CW7A 1YZLA 3W3ZB 4GMDA 1SVLA 2GILA 2OCAA 3VTKA 5M04A 4EPTA 2VHTA 1KIMA 3MCAA 3OIVA 4JKIA 1S2MA 4QHYA 2W0SA 4TSFD 3FE2A 4LZZA 1GRRA 2CXXA 5IDVA 3AF1A 1OB2A 5FBLB 3X2SA 2PCLA 4LHVA 5SZHB 2O8FB 3EWSA 3EZ9A 4HZUA 3QPWA 1IBRA 4MKFA 2J87A 4MYUA 3GEEA 3KJHA 1CKEA 3EC2A 2ERYA 1TQ2A 4G5QA 2VP4A 3U7GA 1II8B 5CIQA 3I1FA 3OEEA 2NO0A 1IJFA 2C5LA 2FPMA 2GXQA 1I2DA 1GFIA 3SJCA 4IDOA 3CRVA 1N6HA 1ZM3A 5ELXA 4NL4H 1DE0A 1G19A 1XTQA 1Z6AA 1RW4A 2HT6A 4KI0A 4U5XA 2QA5A 4A2WA 2ZRGA 1W2HA 3BE4A 5FTMA 1RZ3A 3KFXA 4UXJA 1N6LA 4YDSA 4AURA 4FCTA 4LC1A 2D2EA 1QHIA 3DM5A 4U02A 4YXWD 1S3GA 4AYWA 4I81A 3FOZA 4A92A 2QU8A 4ZCIA 3A6PC 3I62A 4ZIRA 4TMTA 2AK3A 4IXNA 4NCJA 5FPSA 3W3AA 2DWOA 1KSHA 2ZRBA 1AGPA 2GJAA 4PTLA 5CK5A 3QNUA 1XP8A 4BLPA 4G5OA 1NMYA 4RY2A 1UBGA 2J5XA 2OSBA 5IF9A 5G53C 2YC2C 3R9WA 4OI0A 1KI4A 1XJCA 2QM7A 3NBZC 3NEJA 3P20A 4LC0A 1Q1BA 1JBKA 3KQUA 5DO9A 2W2VA 4HLDA 3SQWA 4GP6A 4A4DA 2ZI5A 3LX8A 3L2OB 2HCBA 5JS8A 1VKJA 1FQJA 4RFVA 3ZYCA 1DPFA 1W0JD 1ZINA 3GFTA 1R8QA 4V0OA 3SYNA 2Z6VA 2W6ID 2DHRA 5AUQA 4FMDF 4Q4JA 1KHTA 4IJMA 2ZM5A 5J4YA 4ZKDA 2QE7D 1H65A 1R0YA 3AF0A 3MFYA 1QBKC 5KPJA 3GLHA 3Q8XB 5DNYB 2WIBA 4L8GA 4LJYA 4EPYA 4QBGB 2OAQ1 4GOKA 2ZEJA 3KKOA 4DLRA 2G0NA 4IVQA 3EZ2A 1AZTA 5FBRB 4C0SA 4N1AA 3GLIB 1E0AA 1AQUA 1X1SA 4US1R 1R0WA 1GRNA 2Q21A 3OE7D 3QPUA 1YR8A 5EE9A 4G5SA 4YXWA 4H1VA 1U94A 1P9RA 1NMZA 3AEZA 4Q48A 4Z8XA 4BFZA 1U99A 3QXXA 3L8ZA 3SHFA 4UQOA 1BS1A 2PJRA 2CVHA 2ZJYA 4LJ5A 3U60B 2KWIA 3MSXA 2ZROA 4DLSA 1NLYA 4DDTA 4KBGA 2R8RA 2IS4A 2FG5A 2ATVA 2H16A 2F43B 2REBA 2ZS9A 3J81k 2GRJA 2BCJQ 2PX0A 2ZIAA 3CB4A 3MJHA 4URVR 1US8A 5DE3A 1F2UA 1OH5A 5DYGA 3WYFA 4A0RA 3PV0A 4B3FX 3SYKA 1OIVA 4TZ6A 3NHBA 1K5DA 3WHKA 2IXGA 1FTSA 4GL2A 4M1TA 2P6NA 2WV9A 4PQRA 4HB0A 4B74A 2GK7A 3CONA 2GZDA 3OEHA 2FMXA 3QEJA 4PHFA 3QSYA 4DSTA 2C99A 1E9EA 4NBSA 1P2SA 1N25A 4JBWA 4MA4A 5FOSA 2ANCA 4WXRA 2VLIA 1ESNA 3KXIA 3RSOA 4EPXA 4IVRA 2A5DA 5CITA 3CX8A 3OAAA 4RCYA 1Z2CA 3VNUA 1XMIA 1KI1A 3T1TA 4DCVA 1BH2A 1ZCAA 5FPTA 4RSGA 4HAUA 5FTNA 4M1MA 2NO6A 2VEDA 3IIKA 2IYXA 1YU9A 2GHIA 221PA 1P2VA 2Q9AA 3QQ5A 5AWFC 3RS7A 5L8VA 4WOPA 3FKQA 1ESMA 2QT1A 1XZQA 2KE5A 3U2QA 3MUFA 3KB1A 2Q3FA 4LSGA 4A6PA 2DBYA 2XNDA 3B1XA 4RKFA 3SBEA 1OIXA 3VU9B 2FEMA 3I61A 3BFXA 2AKAB 5FTJA 2VF7A 4BASA 4RKEA 3I72A 3KDSE 5CB8A 1QRAA 1AN0A 1KZGB 1VG8A 2IF0A 2CE7A 2O0HA 3RDPA 3ZS8A 4BQSA 3BBPA 3GQBA 4F4IA 1LFDB 1YRBA 1YZGA 2ZITA 3FFAA 2IX3A 2D4HA 1YZTA 1TF2A 3TR5A 1DG3A 3KQHA 4W5JA 1DTSA 3B1VA 4WZAE 1UF9A 5EE5B 4Q9HA 3IBGA 2H17A 1CJKC 3AUXA 4XIGS 4TLBA 1P6XA 2FN4A 2XSZA 1OB5A 2XGJA 5HCNA 3DEFA 4AKEA 1R5NA 1YHNA 5DSZA 1IN6A 5G3YA 3AQ4A 1FMLA 1XTRA 3IDQA 1M34E 4TQ9A 3B5JA 4FWTA 1BKDR 1QHSA 2X8AA 4PSAA 2CL0X 4KCGA 3NC0C 2G88A 4GP7A 4CGZA 4FINA 1SGWA 1NMXA 4Z8YA 1D6JA 2X2EA 4B3BA 2WJGA 1ZIOA 4M9SA 4QJ3A 3GLGA 2J0VA 1GVNB 2FFBA 3HU3A 1G8HA 3MWLA 4OKSA 1X8LA 4UNSA 5DN6D 3HYRA 4FN5A 3T5DA 4U00A 1QHHA 2IUSA 4KYIB 4ZCMA 2BHRA 2UKDA 4H9GA 1AA9A 1FZQA 3PEUA 1IHUA 1WB9A 1SXJA 4NU0A 3PCRB 1KO1A 2KJQA 2VP9A 2PH1A 5FPYA 1F5NA 5JCPA 4M9XA 3AVTA 1YQTA 2JJ1A 1R7RA 5BYKA 1CJTC 2GF0A 2I1QA 1GKIA 1ZJ6A 4LX0A 2CBZA 3T12A 4ZV4A 4QFMA 2O5VA 4DT1A 3AP1A 5JECA 4AKHA 2G0TA 1COWA 1XEXA 2IK8A 4RZUA 1CS4C 1KYIA 3QKRA 4YMWA 2WJVA 1DADA 1E2GA 3QE0A 5KHOC 1I4TD 2WJIA 5LD2B 4NMMA 2FH5B 2QUZA 3OHMA 3FMFA 4ZDKA 3EW9A 3U4QB 2OXRA 1GKYA 3BRWD 2QTFA 3EPKA 1WF3A 5AJYA 1Z6YA 4UKDA 2FJUA 4EFNA 4GZLA 1BOFA 3CW2A 3VKHA 2Z43A 3Q5EA 1KI6B 2XJ9A 4ABYA 2HV8A 4JVLA 3TVTA 4PAMA 4Z1MD 1NG9A 2GBLC 3ZIAD 3RRYA 5DN6A 1A1VA 3I92A 2Z4RA 5CM9C 1UEIA 1G5TA 5L3QB 5FTLA 5G41A 2VF8A 4M22A 1RRFA 1X1RA 2PLFA 4RD4A 2OBLA 1UBCA 4MRRA 1DO0A 1G8YA 4TTPA 1G8PA 2JDID 3KKNA 1KI8A 1U0JA 5TV2A 2VO1A 4KV9A 1N6OA 1TL7C 2RHDA 2WSSA 4RD1A 4WVFA 1BMFA 1DAHA 1RFLA 1OHHD 2P3SA 4M9ZA 1TMKA 1JXMA 2DYKA 4W5WA 4LPKA 2YWEA 2AFHE 4AKGA 1WDTA 3VR3A 4RD2A 4TT3A 3PUYA 4OHVA 5DYIA 3DVLA 5KTYA 4GSYA 4EPVA 4Q1FA 2W0MA 5FI1B 5KDDA 2NIPA 3AGQA 2ZS8A 3QXJA 4EAQA 1RRGA 1EX6A 4KODA 4Y0VA 1W46A 5FI0B 3PVSA 1T3HA 1T0JB 1R5OA 2NPFA 3EZ7A 4LHYA 2ZRNA 4JL5A 3A37A 1ZC4A 4P4SA 2YWHA 1XTJA 5BN5A 2B7CA 4Q01A 3RS3A 1IN8A 1SQ5A 3VR6A 1V43A 4DDVA 2GA8A 1SKYE 1Z0IA 1RC8A 4WXPA 3LV8A 4IEIA 4Z1MA 3VKGA 3ZIAA 3PEYA 1CRQA 1E9CA 1GILA 4KHZA 5L3RA 1E9AA 3HDTA 5AJZA 3THXB 2WPDA 3N70A 2J7PA 5K8IA 3I8XA 3SC3A 4LY6A 4BECA 1C9KA 3HJNA 3LW8A 1JALA 3QF7A 3BH0A 1U8AA 2WSSD 2I3BA 2XJ4A 2ZRKA 3PG5A 4G0NA 3U61B 1N2CE 4D4MA 3CH4B 3AB3A 4A15A 2FA9A 3TK1A 2EFHB 2OAP1 3BFVA 4NYIR 1Z0FA 4TWZA 5C1BA 3THWA 4Q4HA 4Q9LA 5B64A 4TTQA 4B32A 1EK0A 1IY1A 4WA7A 1OH7A 1HQYE 2JLQA 2ZQ5A 3AF3A 2WIAA 4AKIA 3TW4A 3CRRA 3LVRE 3PUZA 3CUEF 4M1OA 2ZRHA 2PL3A 2G3YA 4CYMA 1Q3HA 1NN1A 1Y63A 2WWIA 3IEUA 3IO3A 4I1SA 2WMNB 3IQWA 5DI3A 1QDEA 3AKEA 1PZNA 1NNEA 1HT2E 3KX2A 2LCFA 1J99A 2QN6A 1EFUA 2A78A 2GXUA 4D0NA 1VCOA 3KUDA 3ZLJA 4ZDJA 3AVUA 4DKXA 1OXVA 3QIAA 3CPHA 2XB4A 2ZSAA 2OCBA 4WW0A 3DL0A 1X86B 2GCNA 4IW3B 2V7QA 1RYFA 2GEDA 3EPHA 4DCTA 2YJTD 2QPTA 1Z5ZA 1UKZA 2FFAA 2WOJA 1JECA 1SZPA 3IUYA 5GVSA 3JZMA 3MAAC 2QAJA 2GAOA 4LBZA 2ODEA 3VKWA 1E94E 1MH1A 1NG1A 2BVNA 4RVCA 1KK3A 5L3SB 1G7SA 1BYIA 2ZJBA 2X77A 2Z4SA 3PIRA 3QKSA 4NPHA 1E4YA 1TU4A 5DISB 4YMUA 3LQQA 3OEED 4AG5A 1VTKA 3F3YA 4DB2A 1Q21A 2WJHA 3BIFA 4LHWA 4EJSA 3NVAA 4ESVA 3C8UA 2O8DA 2ORVA 2ZYVX 3O47A 1F3OA 2GJ8A 4IFBA 4R9UC 1I4LD 3ADDA 2AD5A 3VFDA 2JLYA 2HT1A 1P7CA 3ZQ6A 2AL7A 1U0LA 1PLJA 1GNPA 4GRAA 1LF0A 4DDWA 1W47A 3RANA 2F1IA 2IYZA 3NBXX 1DG1G 1KDOA 1E9BA 2NZ8A 4QBHA 5KU1A 4Q7MB 4BUJA 5HPYB 1G9XA 2WM9B 2YOFA 4ZO4A 4ZIRB 3VX4A 5FPKA 2B7BA 1S9DA 4JJZA 4M1SA 4XVRA 1PLKA 2F1RA 3FFBA 4QHTA 1ZM7A 3CZPA 1DS6A 4B44A 4B76A 2QQ0A 2RCNA 3EIHA 1Z47A 3QG5A 2V6JA 2ODBA 2DFNA 2YZ2A 1E4VA 1TADA 2GTPA 1QHGA 3EPJA 3QEOA 4O25A 3FHOA 1OPXA 3CX7A 1WCV1 2QMHA 4MRNA 3QI2A 3D31A 4TYQA 2VA8A 4FD2A 3K0SA 5FUYA 1ZIPA 4OL0A 2EQBA 3W9YA 1OW3B 4Q02A 1XCGB 3AP3A 5KNCA 4PPNA 1GIAA 2VPPA 1FP6A 1JPNA 1HH4A 2VP6A 3WP1B 3LA6A 4L15A 3KKMA 5J4KA 2BBSA 4Q1AA 4LRWA 2IYWA 5HE8A 4URWR 4CZ2A 1T9HA 5JWRA 2WTUA 4X8LA 1Z2AA 1ELOA 1JR3E 3DZ8A 2WHXA 4M21A 2GNOA 5CLLA 4R7ZA 4PFSA 2PLRA 3ADKA 1U81A 1KNXA 4Q5IA 4GDFA 4TYWA 4DLYA 3QXHA 2YC4C 2IYRA 4KSCA 2RGNA 1LV7A 2QP4A 1VYTA 4URUR 1VG0B 1ZU4A 2P5TB 5KPDA 1Z28A 2GDJA 4E07A 2YOGA 5AUOB 4QHSA 1G3IA 4L16A 2AKYA 2ZRIA 1F60A 3I3SR 4MUBA 4JLPA 2FNAA 1E2JA 4JLAA 3P1JA 1XJ0A 2EFEB 3PQCA 3UPUA 2ZR7A 2WJJA 4HB3A 3EIEA 5FH9A 5D3MB 2QGZA 4F91B 3O8BA 4TSFA 2XB2A 4POAA 3SJAA 5CK4A 4OHWA 2F43A 1FFHA 3TQCA 2OT3B 2F1HA 3ASZA 4P0TA 3EZ6A 1US8B 2JGNA 3C5HA 2EYQA 3NBYC 4JSYA 1G7CA 1NL3A 1W0KA 1KAGA 3LQRA 4IVPA 1VPLA 3TW8B 2QAGA 1E2KA 3P26A 4PR0A 3BB4A 4JVSB 4OQMA 2IBMA 4K8OA 1F2TA 2HF8A 1T4GA 4QM6A 1AKEA 1J70A 1XD2A 2AWOA 1ZW6A 1S96A 4HB4A 5IT5A 2IYQA 2ZVQX 4M9QA 1TQDA 1KY3A 4JMPA 3FWYA 4X8HA 2GF9A 3BH7A 4EQ6A 4IDNA 3TQFA 4QL3A 4BWYA 1OYWA 1ZNZA 2HCJB 2WKQA 2FU5C 4ACBA 1B23P 2CMKA 2FFQA 3VR1A 3THOA 5HZHA 3K0EA 3B2EA 4LDJA 2IC5A 3O8RA 4V0KA 1JJVA 2R62A 1YE8A 5EQTA 1S1MA 1X6VA 4V0MA 4B6EA 1OFHA 1DARA 2VP2A 4HI0E 2JLUA 3SU8A 2BMJA 2IHBA 3LW7A 2XNDD 3EZFA 1CF4A 2HLDA 4FI3C 4PPGA 4QKQA 3V4RA 2GWHA 5EP3A 5KUTA 2O8EA 3EXAA 2QGNA 3KFVA 1KJWA 4XWOA 1KOFA 1D9ZA 1VYUA 3Q85A 4A82A 5EXSA 3CRW1 1KJYA 4TL6A 1JAHA 2W58A 3P32A 2ORWA 1JPJA 2WBLC 1XDBA 2YOHA 3TUIC 4JT4A 2H5EA 1W0JA 4JYCA 3GLGE 1SULA 1X8KA 3K0AB 2H7VA 5DHFA 4L4UA 3GLIE 2MMGA 4AWXA 2X1VA 2CLCX 4M1WA 3DPUA 1E6CA 2ZJ8A 4PC6A 1W4AA 1Z6XA 2IYYA 4Q7KA 4Q03A 2ZRMA 1Z0DA 4NYJR 2JASA 3BWDD 5GJBA 1EESA 5HE9A 3TR0A 2XSZD 4JLBA 4BZQA 1GZSA 2BDTA 1G3UA 1KTVA 3LRPA 4P3YA 3BB3A 1C4OA 1G5PA 3NG1A 2RB4A 3C4JA 3M1IA 4Y0AA 5GJWC 2NQ2C 1RIFA 2QG6A 4TLEA 2XXAB 3BGWA 1MRNA 2IYVA 1OFIA 2O52A 2IHYA 1FNMA 2XTZA 2BWJA 5KSYA 2FPLA 4S35A 1GTVA 1JR6A 1TNDA 1DAMA 2BJWA 3GJ7A 4DLVA 1UEJA 4OJQA 2ZJZA 3L0OA 4KSBA 2HLDD 5EXXA 2EVWX 1E32A 1JEEA 2QTHA 1GAJA 1E99A 2FGJA 4QC2A 3V4FA 4S2EA 2QP9X 2R65A 2GZAA 2GCOA 3KJEA 2V9PA 1OLOA 2YNMA 3K9NA 4DEYA 4EUNA 3IPXA 4XJXA 3IQXA 1OKKD 2VYFA 4TMZA 2K5UA 3CZQA 2ZRFA 3FMPB 4HUQA 5KSZA 2G9NA 5AJWA 2OFXA 5BW8A 1KI9A 3AH8A 2OHFA 2L0XA 1ZNXA 1UJ2A 1R5BA 2J7KA 2BJVA 4DSOA 5CDFE 2W2TA 3HPRA 1W2GA 5H8WA 2ZYWX 3QKTA 2H18A 2P6UA 3FTQA 4DUGA 4EFLA 1Z6GA 1CU1A 2WKPA 1MO5A 3NDPA 2CNWD 3QKRB 1OYYA 4I1UA 3D8BA 1S4QA 1SVKA 2C96A 4IDQA 1QF9A 4V02A 2RGNC 3UG7A 1T8TA 3OAAD 2IWRA 5C2JB 4EIWA 4MUAA 3K9GA 4K81B 1XEFA 1W36C 4OHXA 1CRPA 3RABA 3A1VA 3IHWA 1E2PA 1YZNA 3RHFA 3LVQE 1K5GA 3C41J 2A5JA 2Z83A 5FUXA 3UG6A 3GLHE 1NVWQ 4F92B 4OYHA 4B2LA 4LV8B 2NGRA 3GEHA 5B30A 4D0GA 1R2QA 2JAQA 1S9HA 1MABB 4OK5A 1MRSA 5JCZA 3C5CA 1DAEA 2PMDA 1G4AE 3NBFA 1CBUA 2O8BB 1Z22A 5J5CA 2Z0MA 3PXGA 3ZS9A 4RD6A 4NE2A 2VTKA 1JEDA 4HUTA 1RJ9A 4F93B 3THYA 4DC9A 3SFVA 4QM7A 1QVRA 1WXQA 3U7FB 1VHTA 3A1UA 4A2PA 5K8UA 1EXMA 2BMFA 3T06B 3AKYA 4OHZA 4NYMQ 4CDGA 2J59A 2CCJA 1MT0A 4N0DA 4Q1CA 2CNWA 4DEXA 2YINC 2ZAMA 4DJTA 1X8JA 4I4LA 5E7JA 4BFTA 1WBBA 1A7JA 1SKQA 1VYVA 4PAQA 1FNNA 1E2FA 3U3RA 2JCSA 3FMIA 3UMSA 4TZ0A 3FYHA 1KK1A 2WAXA 4PZZA 4YQFA 4P4SB 3AVXA 1SHZA 4Q18A 3R7WB 1XJQA 4MKGA 5FOVA 3WNDA 4BRUA 5JSZB 4G5RA 2ERXA 5BQ5A 3ZVRA 3EASA 4AG6A 5AJXA 3NHAA 3EWAA 3B6EA 2VP5A 4ARZA 3E1SA 3CF2A 3ADCA 2QBYB 1W49A 2NTYC 5HCIA 3SJZA 5LD2C 2ZUDA 3ZVLA 1N6RA 1T5LA 4A0FA 3RC8A 2J45A 4M53A 2EFCB 1NJGA 3TRFA 2FZ4A 1OJLA 3SS8A 4CEJA 1ZD1A 2CE2X 3QXSA 2O8CB 1CJMA 2FGKA 2AFIE 4OQNA 4KLZA 4G01B 5AJVB 1NVVR 2O0KA 4TYNA 4B35A 5JJKA 6Q21A 2QL6A 4MGYR 4G3XA 4D0LB 4C7OA 3IBYA 2GXAA 4C30A 3DMNA 5DLQC 3AVVA 4CT4B 3TIFA 1HT1E 2EFDB 1GP2A 1E9SA 1Z29A 5CLQA 3CPEA 3D3QA 5ANRB 4KITB 4RZ3A 3MGCA 4RD3A 4FMBB 3M0EA 1HA3A 4BPBA 4HZIA 3OFNA 2J0UB 4BRWA 1JNYA 2MSCB 3HP1A 2I4IA 3LDAA 1AGRA 3SNHA 3L0SA 1OFUX 2B21A 3QJYA 1Y3AA 2ZI7A 5BWMA 1M8PA 1KK2A 1R8SA 3PITA 4JVMA 4NYMR 4F38A 3Q72A 2V7QD 1M74A 2REOA 2VQSA 3GFPA 4NTZA 3GJ0A 4P4TA 5FR2A 3PJRA 2ODNA 3A8TA 2QRNA 2RGCA 4TN1A 3ZVNA 4ZI3A 2PZFA 1JR3D 1SVMA 4QNRA 5TB5A 3CBQA 1S3SA 2QRZA 4DIDA 4TLAA 1HYQA 4P33A 1OHHA 4ACAA 3GLFE 4UXIA 4PQFA 1DVRA 4RFSB 5L3SA 5FL3A 1YZKA 4A8JB 4JVNA 1BYUA 3Q9LA 1V5WA 1AS3A 4BEBA 5FFMA 3RC3A 1NY6A 3PUXA 5FOUA 5SZIA 3KQLA 1H8HA 1Q1QA 4D81A 3U6KA 1SVWA 1OXTA 2ZRLA 4Q19A 1E9FA 4Q9KA 4EJSB 3QUSA 2ZI3A 4CEIA 3T1OA 1OFTA 5C4GB 4C2TA 1J8YF 1QZXA 3WRYC 2VIIA 3X1ZA 4II7A 1B0UA 4DVGA 4C0JA 1ZD8A 1Z08A 2FSGA 4OBEA 4HLCA 1RRPA 3V9PA 2QORA 5LDDC 4UNRA 5D3QA 1NVVQ 3B13B 3AM1A 3X1WA 1NP6A 4JBXA 2PEYA 1ZBDA 4URZR 4IDHA 2MSDB 4PHGA 2QY9A 1NRJB 2IEYA 4BFVA 2XNSA 3NKVA 5E95A 1JR3A 3QPVA 3B78A 4PZLA 4XVQA 2IS6A 3B1WA 4CIDA 3T5GA 4DIEA 3FMOB 3ZH9B 1ZNYA 5IK2A 4C0KA 1ZMXA 2WZQA 3UMFA 4WIAA 4LK2A 2FZLA 3K0CC 2O8FA 5IRCD 2V54A 2LKCA 2OCPA 3KTAB 1E98A 3T1QA 3L82B 4M8NE 4MGZR 2GCPA 4D80A 3PR1A 4GOJA 4R2HA 3NC1C 4US2R 1VIYA 2PX3A 4D4JA 2J3EA 4LYFA 4PO9A 2RGAA 4E5UA 4E22A 5J4HA 4XH9B 2IS2A 1IY0A 3EC1A 5J4VA 3TSZA 1ZCBA 3QF4B 3U7EB 3NH9A 3O8CA 1GM5A 2C77A 3FHTA 4A1FA 2RH5A 1CEEA 2KI5A 1E79D 1XPOA 3KKPA 3FHCB 1EFRD 1KJZA 1S0UA 2OBMA 2RGEA 3K8YA 1VIAA 2GJ9A 1OF1A 1G21E 1NN5A 4JL6A 2OFOA 2P67A 2VSOA 4OI1A 4HDCA 4NZYA 4FMDB 4LWZA 1WBDA 1J8MF 4NP6A 2NO7A 2G83A 2QSYA 2ZE7A 4XSGA 1AM4D 5LB4A 4AIIA 1JJ7A 3SYLA 5F9FA 4MRSA 721PA 2PZGA 5JHHB 3UXMA 4Q9IA 3GMTA 1OT3A 1XCMA 4A2QA 5EJEA 3Q7QA 3CRQA 4TMVA 3TAHA 4TMKA 3MWYW 2YWFA 3S1AA 5KOYA 1DEKA 1SXJC 3H4MA 4TLDA 2ZRJA 2QROA 3DKPA 5FOXA 3GJ6A 1Z3IX 3T15A 3IPYA 2ZJ2A 4LOAA 2PMKA 3D6TB 1N5KA 1JXOA 1YKSA 1XXHE 2OFWA 1W44A 1XD2B 3TKLA 2CHQA 3U44A 4MDEA 1XCPA 1ZVQA 2QM8A 1JB1A 3TAUA 3SDZA 3ETLA 4HATA 2IYUA 4Q66C 1Z0AA 2V8OA 1YR6A 3CH5A 4BZPA 2OLJA 1N5IA 1ZC3A 2GAAA 4LJAA 1KK0A 4G1UC 4WZBE 3M4YA 4CEHB 4DSUA 4C9BA 1XZPA 3AVPA 3JZAA 2JLWA 1P73A 3RRZA 2PBRA 5H1YA 3RS0A 1IN5A 1Q20A 3HR7A 1XRJA 4L5BA 2IS1A 1PV4A 5HR5A 2FE4A 3BOSA 4N0EA 3NXSA 4KFSA 4NYJQ 4V0ME 4AK9A 1KKLA 4JLJA 1TF7A 1GL6A 2BIFA 2Q3MA 5GJVC 1FQKA 2G6BA 2QT0A 3QY0A 1G41A 5KSOA 3U3JA 3VX3A 2OV2A 2RMKA 1KKMA 4IFEA 3W90A 3QOFA 4LPSA 3SEAA 4HZUB 2BMDA 4TMWA 1KSFX 1U90A 1XMJA 1AS0A 2AK2A 1DAFA 3WNCA 2F1JA 3W6OA 2GBLA 1QHXA 4NKRA 1YR9A 4QRHA 4YMTA 3K0AA 1ZD9A 3MG9A 1XMSA 4YMSA 1EFTA 2NPIA 4IRUB 1E9DA 4M0LA 4DXAA 2EWVA 1MV5A 2QMUA 1E96A 2Q6TA 2ZSFA 2AN9A 2ZS7A 1D2EA 1T3LA 1DAKA 2F9MA 2DFLA 2C2HA 3IKJA 4PSKA 2IEZA 4Q1DA 1E2QA 1GUAA 1VG9B 3G0HA 2QP3A 3FPAA 1GOTA 2WWWA 1DOAA 3ZQJA 3VQTA 1IN7A 4FXPA 1UADA 3EPLA 3AVYA 2C78A 4LHZA 5AUNB 2HYIC 2P6RA 1T91A 1XPUA 4JL8A 5J4LA 4A9AA 3P4YA 3UK6A 3CO5A 4KVGA 3HU2A 4J0QA 2ZSBA 5JI3E 2ECKA 1NI3A 3CX6A 5TY0A 4D25A 3QBTA 3AV0B 3VU9A 4XWAA 2CL7X 2BEKA 1CTQA 1GRQA 4K46A 1U8YA 2FOLA 4NHOA 4DLZA 4TL7A 1FOEB 3AKCA 3ZZTA 4TYYA 4Q7LA 2FSIA 4IXMA 4Q4JB 1F48A 3WBKA 4QGGA 5CB6A 2GK6A 3CLVA 3LAWA 4HUQB 4IEEA 2FV8A 3U5ZB 4FCVA 3BD9A 2C95A 3SN6A 2YVUA 4Q4LA 3W5JA 5BXQC 4JKYA 2D2FA 2FWRA 4NH0A 1CR4A 1W4CA 2ZI9A 3ONWA 4Z54A 3GLIA 2X2FA 2E1RA 1KMHB 2D7CA 3RWOA 2JA1A 4JT2A 4OHYA 3REFA 4L9SA 1SVIA 1D2NA 3L0PA 5EP1A 1ETUA 2JJ2D 3DOFA 4TTRA 1ANKA 1J2JA 1G3RA 1M2OB 2BKUA 4MKIA 3VAAA 1N3BA 4BLRA 4QNMA 3B1YA 2OZEA 5E4FA 1N0WA 2KBFA 1N0VC 3IILA 3MJRA 2JIZA 4L9WA 4P32A 3SBDA 4PSVA 1GL9B 1SKYB 4FMCF 4Q4AB 3TVDA 5FBWB 1EFCA 1TX4B 2AX4A 3ECCA 4CRWB 4PC2A 1E0JA 4MYTA 3H86A 1O3YA 2R6GA 3BC1A 1QHHB 3CWZA 2OBNA 5KDLA 1F2UB 4LBVA 4MRVA 1D2MA 1RVDA 2RGDA 1MABA 1JQLB 1U9IA 1XU4A 2A7QA 3ADBA 4LYAA 4B75A 1N5JA 1W48A 2WWGA 3GD7A 4B43A 1E2NA 3UMRA 3GLFB 2V1XA 2ZVPX 4RCZA 1OSNA 1VCMA 2CK3A 1JI0A 2HUPA 3N2IA 3KQKA 1G3QA 3K53A 3K1JA 3THYB 3MLEA 1COWD 4XOIA 5FOTA 2FPKA 2J41A 3K0FB 2GVDC 1CJUC 2GJKA 4DT1B 5K8LA 1ZU5A 4LYJA 1G6OA 2DY1A 4Q7JB 2UVQA 2VHCA 4RD0A 5CJ2A 1FTNA 1KAOA 1VMAA 5TDHA 2A5YB 2BM1A 3MWKA 4Q47A 3TE6A 3ZGXA 4B3DA 2CDNA 3U4QA 2DCUA 4O0MA 3AP2A 4KAXA 3BK7A 1ZM2A 4JYBA 4AI6A 4ZDWA 2CL6X 2JIZD 3P27A 1IXRC 4HLQB 2HDNB 1IXZA 4IOJA 1E0SA 1E2DA 1KDPA 5TVKA 3AF4A 1EG7A 2VH5R 4W5HA 4XWKA 3AKDA 2G1KA 4WZ6A 3RS5A 3U3OA 2OM2A 2I1VB 2ZE6A 2WWFA 1XB2A 2VSXA 3LH5A 2IWHA 4AYTA 2ZU6A 4GPTA 1Q12A 1KDTA 1M1YE 5A5GA 1E69A 1SVSA 3I4LA 3TSOA 4BFYA 3W5IA 1OKKA 3T35A 3LD9A 2QBYA 5EP2A 1Q22A 2G77B 5TXGA 4ZI2A 4A0GA 3BJIC 1GKUB 2PT5A 3B9QA 1XX6A 1IY2A 1VG1A 4D4LA 5LBIA 1AZSC 1H8ED 4GMXA 5EZ6B 1G18A 2OE2A 1XD9A 1S8FA 3CRMA 4BFWA 3PEWA 3K70D 1UDWA 1M6NA 3EAQA 2O8CA 3KZ1E 5KYKA 1Q57A 2ZU0C 3L8YA 2Q9BA 5FUVA 3E70C 4WBSA 2D62A 1XWIA 4LI0A 2V1UA 2UZIR 4BGDA 3KKQA 4BLSA 2YHSA 3DHWC 4BE7B 2F3TA 1E2IA 3QXCA 3VR5A 5EE0A 4JLDA 3KB2A 5LB2A 4OJKA 4Q1EA 3GLGB 4NDZA 3CNOA 5AR1A 4C0AC 3C7KA 1A2BA 5EE3A 8OHMA 5FL7D 4D4KA 4TMXA 3UATA 2XOKA 2GETA 1VHLA 2HEIA 2D74A 4OI2A 1SXJB 3AGPA 3TH5A 1KSGA 4ZCLA 1E3MA 2WPDD 1G291 1DELA 1SXJD 3I5YA 1E1RD 2JLRA 1T0HB 4JSTA 1XEWY 3KUCA 4U7DA 1RYHA 4QGAA 4NCHA 5FTKA 5BN4A 3ZD7A 1L2TA 1NBMD 1LNZA 5KDOA 2V4ZA 1DAGA 3TJZA 3A1WA 1NF3A 2ANBA 2R44A 1D9XA 3C14C 4NONA 5JS7A 3AVWA 1PUIA 3LWNA 5JWOA 2J0QA 2QQEA 5JZVA 1P61B 3GFOA 1TPZA 3V00A 4DSNA 1TAGA 1IN4A 2B92A 1W1WA 2P2LA 1NN3A 1R6BX 2BV3A 1XXHA 1M7GA 4Q4HB 1T3SA 3PUWA 4PAOA 2ZRDA 3I32A 4HAYA 1IOZA 4HLUC 1G1MA 4LJ4A 2F6RA 1KY2A 1EWQA 4LHXA 5FUWA 2VHUA 4CT5A 3ZDQA 1U9IC 3B85A 1OIWA 1KI6A 4QJ5A 1FX0A 1G7RA 1J7KA 2GESA 2P5SA 1P5ZB 2P0EA 4OI4A 4X8MA 1KMQA 4DLXA 1G4UR 5DH9A 3U6BA 1TQ6A 5DI3B 4O3MA 2R2AA 3A4LA 1W36D 1G16A 3SOPA 5FL7A 3IIJA 3WMEA 3P4XA 3MWJA 1W36B 4GI7A 1KSJA 2QSZA 3FVQA 2C9CA 2A30A 1Q1ZA 4MKHA 5JEDA 1ZNWA 5C46F 5L3VA 2SHKA 2EW1A 2XITA 3R20A 1ZAKA 2JDIA 1D8TA 2RGBA 4KJZA 3VHLB 4DHEA 2RGXA 5G3ZA 4UJ3A 5JI2E 1YZQA 1QG4A 5IK2D 1OV4A 5AUPB 2ZREA 821PA 2VHQA 4MH0R 5C18A 3UWKA 2F3RA 3RYTC 1SHKA 3EA5A 2A2ZA 2YYZA 4IOKA 4JZKA 5F98A 3SZRA 2R6CA 3W8RA 5DHAA 2QTVB 1ZUHA 2JLZA 2DFKB 4RZXA 4B73A 3FKSA 4BLQA 2O8DB 2BCGY 421PA 2IW3A 3A4NA 4AD8A 2W6JD 1GNQA 1NN0A 2CCGA 1QVAA 4EJSC 2ZRAA 3MRSA 3QF4A 3EA0A 3NDBB 1A4RA 3JVVA 3DKVA 3K09C 3BERA 3AVQA 1GSIA 4R98A 3O8DA 1EFRA 3TSWA 2R9VA 3IIMA 4EPRA 1MO3A 1Z63A 4OK3A 4M1YA 1T8UA 3B60A 2EU8A 2C04A 1G64A 4KU4A 621PA 2QI9C 4MGKR 1PLLA 1NVXQ 4A8JC 1AS2A 1E1QD 1YR7A 2IL1A 2OLKA 5EXTA 3VR2A 3K70C 3ZZUA 1CR1A 1R10A 1HE8B 1P60A 3W6PA 4C0BA 1MO6A 2Q9CA
chains in the Genus database with same CATH superfamily
3VNVA 1CE8A 4PG8A 2QLMA 4E5NA 1GHTA 1SD1A 3CUKA 3D7SA 1QF6A 1U7PA 4L73A 2CVFA 5G4LA 3RYFB 3GD5A 1DQPA 1NC1A 4P36A 5HGJA 4YT8A 4W5OA 5CFOA 2IEDA 4JBIA 5KVCA 2CDAA 3PC4A 1IH8A 1CJVC 3K9LA 4FMCB 3WSVA 1JQJC 4RIEA 1BGXT 1SR8A 1T24A 3FGNA 4RVNA 5AK6A 1GR1A 3VRHA 2B20A 5FYQA 5B58C 1ZYUA 4CR7A 2BC9A 1Z26A 4DBLE 1DCMA 3ZE0B 5KB3A 4P4UA 2DOKA 1X9HA 1E0KA 1W94A 2L2QA 3AXSA 1W5TA 2HKIA 2CZCA 1QIIA 3EUFA 3AMVA 5LP1A 2GPAA 5CYPA 3HXKA 4G4JA 3UJ6A 3OQOA 1WOYA 3EOAI 1BHJA 1TKAA 1ZM4A 3I8SA 4MGEA 4UBOA 5GVRA 4FEGA 4DCNA 4UAVA 4HQFA 1JMYA 2Q46A 3NCHA 2CBGA 4IDPA 3IEXA 4Q21A 2REXB 3GVIA 2Y6UA 3GARA 3H2JA 3PIDA 3RS4A 3DTVA 5A4JA 5MFPA 1BO6A 2WAAA 3QG1A 2PU7A 4DCSA 4WKCA 4BB5A 4YV2A 5E1BA 4MB6A 1NWHA 1PTJA 3ICPA 4YMVA 5JT1A 2GJSA 2VT7A 1UFQA 4UMVA 4CEHA 2EKLA 2ZQZA 3CUYA 2DPHA 3IAFA 4FHFA 2NMVA 3CO0S 3BWXA 3K15A 1OGIA 4K9PA 1M3SA 4NPAA 3HHPA 5BNTA 3CEJA 4EDHA 3U19A 4LTMA 4DUYB 4YMLA 1OBFO 4DA0A 3IGFA 3OZXA 4QBFA 5C52B 1O08A 3PFIA 1J25A 5DGTA 3U3XA 4YP0A 4OREX 1ECLA 2ZT7A 4TXMA 1GFWA 3KS9A 1WUJS 1JYEA 1FYFA 2IYTA 2QHXA 4XSHA 4KIFA 3GJ5A 2XTNA 4B46A 4DG9A 3ND7A 4IUYA 3TUJC 1DINA 2VL7A 3CVOA 4L8FA 4QJ4A 1M2VB 1L7OA 1Q15A 1ZVVA 1Y9AA 1L7MA 4NZZA 4B6FA 2W6IA 2CXPA 2AJ8A 3H84A 1Z0JA 5I4CA 1CUCA 3OZTA 4XD7A 4P5DA 4IV5A 3ND8A 1Z7BA 1RU3A 1Y1QA 1Y8CA 2AYXA 2I33A 3EXFA 3A3OA 1OTXA 3QENA 5HJ2A 4C5BA 1P6QA 4ZT5A 4YAFA 3MMNA 1DFIA 2JHFA 2VYCA 4K6GA 5DK4A 5G1OA 2FDCA 2SICE 5G1NA 1OE0A 1CQIB 4Y2JA 2ZJ4A 3IMFA 5TMPA 2I6QA 4GS5A 1Q92A 1CNFA 1CY6A 2D7JA 2A9FA 3BFKA 2JCBA 2LTAA 1PT9A 1VJCA 3H5WA 1HURA 2KBEA 3VMFA 4DC1A 1I3CA 3UNXA 3TGPA 1U8UA 1TCBA 1WD5A 2RHCA 1PN3A 3EZXA 4XLLA 3ZWKA 3KV3O 1XA3A 1UM9A 1IBCA 4EHJA 3V4VB 2E9SA 3T1HB 2HYDA 4REOA 4UNPA 4Y2TA 1FVOA 4OBXA 2G5GX 3JARB 2H1HA 3ANNA 3TL3A 3L7DA 3VSCA 3F6RA 2ORED 1G7TA 4MUXA 3KG2A 3SMQA 3PKJA 4IWXA 2VDOB 1XMQB 3DYVA 2EKZA 2QL9A 3NYIA 1UQTA 2BBWA 2IXEA 4BP1A 1OXUA 2BE9A 3AR9A 4J76A 4F4CA 3JALB 3S81A 2H5JA 2EX4A 3FWPA 1P9NA 3K16A 4NYIQ 4RPKA 4WN3A 2EZ4A 4D8VA 1AKTA 1YI0A 3N2EA 1KY4A 4K1XA 3LBNA 4BLOA 1OLUB 2PCJA 5BVGA 3LLMA 5BW4A 1GA4A 4NU5A 4EFKA 4DB4A 4P53A 1GLGA 1QP7A 4OV6B 1GG2A 2WMDA 4BMZA 1DHTA 5HF6A 4H1UA 1II8A 1IJEA 2AR9A 1I0IA 4HN4B 2WKRA 1FEZA 2GHQA 4IHJF 4GPZA 3A14A 2WSLA 2VDPB 2CHEA 1RP1A 3NNNA 4WKOA 2C83A 4OJTA 1L5FA 1P9WA 4WT7A 3G8BA 2BTOA 1YRQA 4LXUA 3SLRA 5EJ5A 2XEXA 1RJWA 3C98A 3OSUA 1PV2A 3WLTA 1Y1PA 2OO7A 4YUYA 3PGXA 4D56A 2YDXA 4PGHA 2ZR9A 2Z98A 4HD8A 4OXIA 3STHA 1V4BA 1GNRA 2XMRA 1NSFA 1EX1A 4QLAA 5DMXA 1C3EA 1LX7A 2WOOA 5KAPA 4DPMA 4CF7A 3BAZA 4XCQA 1GITA 2NYVA 4FGLA 4KIUA 1TXGA 3HKBA 3E1GA 1FPMA 1H2WA 5FV7A 1GDTA 2OCIA 1L6IA 1L8QA 3BZBA 4ESHA 2C03A 3CFYA 2WU3A 3Q87B 4QXOA 4JLNA 5LYYA 4P7JA 5JJIA 2NZVG 5E1MA 2WWXA 2IH2A 2HDHA 3CZAA 2VP0A 3ZX5A 2YJ4A 1D4OA 1EM6A 2HEGA 3WYGA 3ZHOA 3T9FA 4B33A 1X7WA 2PKEA 3TECE 4WV3A 1VECA 3BJZA 1OC2A 3TD9A 3CM0A 2G6TA 4PYQA 1XFAA 4M6WA 1O5OA 1ULTA 3NJRA 4HDMB 1WA5A 4H1TA 1JKXA 4R69A 2B8EA 1VBKA 3S8EA 2Y76A 3VNQA 1TA9A 5H3CA 4KFUA 4BFSA 2IV2X 3RUDA 2A9KA 1Z6PA 1B41A 2X8JA 2O1XA 4KC0A 1MT3A 1CDOA 3TIGA 3GLFA 1W0KD 1A76A 1JEQB 4OK6A 3W8FA 1HXHA 3TLKA 3AJDA 4ZARA 5C7IO 3ICQB 5KNDD 1IIBA 3TW6A 3G23A 2X19A 1L8LA 1GA6A 3D8TA 3NDIA 3FZYA 1WVMA 5IKXA 5A06A 3WL4A 2R00C 1AK2A 3NIBA 5WRFA 2KSQA 2FX5A 2I03A 3IP6A 3PI6A 2JGLA 3LYHA 2X1MA 1POWA 2H2HA 4AMGA 4YT2A 4QLOA 3ZW8A 3PNPA 5HIIA 3QU4A 4AB1A 2QZPA 1D5CA 1Z37A 1YBVA 3LFUA 4JI3B 4O2BA 1K8QA 1YRAA 2XTMA 2WFLA 5A7FA 5M2QA 3ISTA 3MYYA 5HK8A 5CDFA 4I1YA 5BOSB 4O4JB 4E46A 2R7AA 1FJ2A 4F6RB 1ULHA 4HDOB 2BDEA 5H7XA 4OUDB 3M6AA 1G20E 3OPXA 5EE1A 4C0LA 2N0SA 1M0SA 4FIZA 3WLLA 4AY2A 2FW0A 3FYUB 1WMDA 3ORFA 3PXDA 1I6KA 2W2XA 2P3QA 3OF5A 4N3GA 3F8TA 5BYBA 2H1OA 2X4LA 1I4DD 3I9NA 1M9NA 2Z8YA 1VLMA 3O4VA 4KQ1A 4OATA 4RCVA 4RETA 4YC7A 3H9JA 5DEOA 2O3TA 1NXXA 1N6KA 121PA 1NJ6A 1K8RA 4DQDA 3VOTA 3ZR4B 5C34B 1AHIA 3KZMA 3OFSA 3RHZA 4E5YA 3HB1A 3KQYA 2QAIA 1LSOA 4WFKA 4QVGA 2CYCA 4HLUA 3AZPA 1J07A 2OZLA 1J49A 2UZ3A 3JVDA 4OHKA 3JU3A 5CDTA 1QDUA 3GPIA 4DNPA 4J9VA 3KL4A 1YTUA 1NXQA 3TEJA 4YGYA 4GEKA 2NO9A 2C88A 3EGXB 2CNOA 1D7OA 3E5HA 4Z9BA 3ZH2A 4U9UA 3RARA 3WLFA 5JNUA 2FMUA 1F0PA 1UAYA 3IPRA 2E21A 3O26A 3GBSA 4IKPA 1CEYA 3ZZMA 1O0SA 1FRVA 2J6HA 2LV8A 2MOKA 3HCPA 1IQUA 4NZOA 1TM2A 2P8SA 2A94A 3REQA 4ZMBA 1TUEA 1XMVA 1DLJA 4CCYB 2I4LA 3IX7A 2CD7A 2ZSDA 3L0IB 3N6XA 3SC4A 3GGOA 1HLGA 4NJOA 1GGEA 1QGOA 2CNLA 4H6XA 2BUBA 4X20A 3ZY2A 4BVJA 5KIAA 4E08A 1R3UA 2G4LA 3HJAA 3SWWA 1JVNA 5B57C 1ISPA 5BSGA 1N75A 4L8VA 5L6LB 3J7TA 4HAWA 4HQNA 3UKOA 2FPRA 2R6HA 4JEUA 1Q0TA 1R4NA 3WRXC 4MDYA 5A7GA 4B6OA 4QYTA 2W2LA 5KX5A 4MI3A 2FFHA 4KDEA 5KYTA 1WE2A 2KW5A 4MVJF 3R6DA 3GT0A 2Y1LA 3GOQA 1S3FA 3HUFA 4J3JA 2O2SA 4TL8A 2DPXA 5F1KA 3WYNA 4F7WA 1RJDA 2WICA 1BXRA 4TUYA 5FLEX 3U80A 2K7ZA 5AFSA 3N8NA 3OI7A 6LDHA 3MTBA 4L2IB 1WZNA 3IAM6 3KZXA 4YLEA 5J23A 4IHQA 4M89A 2WIKA 3ML1A 3OZ7A 3QUBA 4B3CA 1ZMOA 1IOVA 3Q98A 3L93A 3V4SA 3EGDA 4J75A 1CZNA 1V3TA 2ZYGA 1VLQA 1MA0A 2RKOA 1AKVA 2XEDA 3TAXA 3WQQA 2QRJA 3NTXA 3PJFA 2NU9B 4HG2A 2GXSA 2AZ4A 4INAA 4NZ9A 4WH0A 4B82A 4DCCA 3PQ5A 4GMGA 2Y71A 3HDGA 4LOLA 3VMMA 3ZXSA 3AFIA 5K99A 1CQJB 1QG2A 4DUGD 1C2YA 1EX7A 3T4XA 3WKEA 1SCNE 4DDMA 3AEUA 1RBMA 4UU0A 5DHUA 3ITEA 4AO8A 3QUTA 4JC0A 3ZHZA 1T6NA 1XKLA 4G4SO 4B3RB 5L7WA 2PHZA 4P1ZA 5BR4A 4BLTA 2A0XA 1KFCB 4BAGA 3FFXA 4L9RA 1WUYA 1C8VB 3VZRA 1XHFA 3K92A 4C6SA 3MTAA 2B4TO 5BMVF 1UBSB 1D1TA 3U9TA 3R41A 1PHPA 3B9PA 5FOQA 2VSFA 1UWCA 2YHIB 1FX0B 1SC6A 3LY5A 2HSWA 3INGA 5CAEB 4HAZA 1PR2A 1TC1A 2C9OA 4JLVA 3RYIB 3SP1A 2OESA 3GPLA 1GA1A 2AJTA 2BR3A 3ZDDA 4RM2A 2WC1A 2GYYA 3BH6A 1T5IA 2IUFA 2O0LA 3VGJA 4LVUA 4NLLA 2RK6A 3DPSA 3NVMB 5FP0A 1EFHA 4W63A 4YMHA 4RHTA 1DQYA 2I22A 3IP3A 4CG1A 2H1CA 7GPBA 1JTEA 1U28A 2CLHB 1R0LA 1ITZA 1YR3A 3JQ6A 1H1LA 4NSNA 5CFQA 4WMLA 2H1RA 3NWJA 5EUQB 3ZKAA 1VHDA 1R00A 1KR5A 1RRCA 2QMQA 1X13A 4F9EA 1NLZA 2IZ6A 3Q3JB 1PS0A 4MR8B 1M2GA 3D3WA 1QIDA 4I1VA 1HFEL 1NBWB 4B4DA 1LDNA 2WDZA 3KOOA 2FSVA 5KKAA 1DLIA 3FVRA 4I9FA 4L28A 2Q4DA 3B5IA 1P9OA 3VSBA 2ZPAA 1I7DA 1QU3A 1QHNA 1ZXLA 1XCLA 2RI6A 2P5YA 2QNBA 3JQGB 4EK9A 1GADO 3BS4A 3ORQA 4RADA 4KFRA 4EUKA 4GLJA 1PVOA 4G5FA 2GRUA 5BVHA 4LDAA 1PDVA 3R3SA 2G4VA 2YN2A 3NR2A 3LOPA 3CF0A 3OF3A 4A8JA 3LE8A 4I55F 3EHDA 3WDMA 1GZHB 1Q0LA 2X5OA 5C8ZA 4JK3A 2IXAA 3WBFA 3QELB 1VL5A 3FKSD 2FCRA 1QIEA 1NBAA 1ND6A 1PK9A 3E4CA 1U2RA 3LA8A 4PZ9A 4Y1RB 3ROFA 4ENPA 4MQLA 1SK8A 4OBWA 3OTIA 4MTLA 3BD8A 3U4GA 3DFZA 3OA0A 3P45A 3R7WA 5JNTA 1H0HA 1ODSA 4PPFA 1WKVA 4HF7A 4X1OA 1UXKA 3LT0A 1XTSA 1K7YA 3D6JA 4PHCA 5DIFA 3X1KA 2XUKA 2X41A 2EGGA 3O4IA 3RCBA 4YAGA 5JSZA 1TT5A 2QMYA 3DJYA 4BZWA 1OI4A 4QLBA 1WY5A 2VQFB 3LUHA 3KBOA 1IHYA 4MXDA 4JB2A 2BR4A 4UJ5A 1JHYA 3WWPA 4NJMB 4NXMB 3HO8A 1C9DB 2PGOA 2C4UA 4ON9A 3TSYA 3TLGB 4LBWA 3S99A 3LNCA 2DF8A 2Z3WA 3C85A 4DRXA 4W5RA 1EDEA 1EGMB 4BX9A 2NO4A 3EQ7A 3GDFA 2HXSA 1JGTA 3OPQA 4GXQA 2ZI4A 2XQGA 3IESA 5FOWA 1W4RA 4CIWA 2OBFA 1CULC 4OQXA 1KBQA 3WDKA 4KMOA 3PFCA 1KI3A 3PGMA 3W7BA 1BVHA 5K5EA 3UC9A 1PL7A 2EHDA 2GPWA 1Y3FE 2J5QA 3CWQA 3EZLA 3ACCA 1E60A 3ES9A 3IJPA 2Y1KA 4YYZA 5CVDA 5JASA 1RE1A 3I5XA 3TNDA 3UK7A 1QHFA 1YB2A 3P9SA 4OU4A 5ES4B 4HAVA 4PLPA 5K3OA 2OC4A 3LLCA 4MQBA 4QG7A 3T94A 2D1SA 3N6VA 4AP9A 3H5IA 1JLKA 3IAHA 4NI5A 5E1OA 3EFEA 1LTQA 1UQRA 2VDRB 1FP4A 1NRXA 4C4PA 2Y66A 3B2NA 2H1WA 4NBUA 1G42A 3JAKB 3W2GA 3G9XA 3AETA 1YVEI 1ZUD1 2A8YA 3NAQA 1KO5A 2D0PB 2DHDA 3WMFA 4XE5A 2IW1A 3E81A 4EENA 1L7NA 2AXPA 3LK7A 3WGTA 5HKKA 1SRRA 1P45A 4MVJG 3CEMA 3CIOA 4WINA 4C4ZA 2LCIA 1VZ2A 2AFHA 3AJEA 3GC6A 3M3DA 5B53A 4RH1A 1C1XB 3HYSA 1AHNA 1CPYA 3IOMA 1ISMA 5E4YA 3GLUA 4MYDA 1DEHA 2E37A 2OUKA 5CFMA 4RIGA 3CU5A 5HKBA 1AO0A 1K7EB 3B8HA 1JDVA 2C1XA 4Z7JA 3H9CA 3RTAA 2GN8A 5GADl 5KO2A 4WK4B 2G1JA 4TXLA 4GE3A 4EARA 4DL9A 4HSEA 5KQLA 1ZXXA 1GU0A 4OB6A 5D7NA 3KQNA 1IK6A 1KO8A 3VOAA 1CDEA 4W1PA 5BN3A 5JLJA 2GRAA 1TF5A 1ACMA 4K05A 2Q0QA 3CNNA 5JVDB 3V8VA 4M83A 4RFSA 2PWPA 1UDXA 3WKAA 5AOBA 1G6HA 3NHWA 3SZMA 3L7OA 2QN2A 1Y1RA 5F64A 2VDUE 3ANLA 3CE9A 3RWMB 3SF8B 2PGNA 4E1BA 2FFJA 3DDCA 4C03A 3W5DA 1RAAA 3CCCA 4BN0A 3R8FA 1R3DA 1EB8A 4HNGA 3K1ZA 2KM1A 4KW7A 1TJ5A 4UM9D 1A27A 2WF5A 5BSFA 3S1AB 1JG1A 1C4KA 1EFKA 2RJOA 4AJLA 3L8HA 4BMYA 3O2SB 2QEQA 1P77A 1H8HD 4CN9A 1YZUA 1WXIA 3G82C 3DMDA 5H3HA 5JXHA 3O3OB 1GQQA 1E89A 3IBSA 2F17A 3LG2A 4WPGA 4CMIB 3M1LA 1EHCA 3HLTA 1PZMA 2HQBA 3CPJB 3GXBA 2NP6A 5KTKA 3AR3A 1G3MA 3IAM1 3FW1A 2CHVA 2NTEA 4ZZ0A 4OJNA 3GDGA 3OT1B 4D0SA 4PANA 4PBSA 4GI1A 2VF2A 4LF6B 3O93A 5IC6A 5F3RA 4HGYA 1J1ZA 3GVPA 5MGNA 3FLBA 4CM1A 5EKTA 4PXAA 4Z1OA 1ONNA 1ODLA 5LR6A 1AQLA 1A5TA 1ORWA 2O3QA 2ZXFA 3CCFA 4B2PA 1IVNA 2EYUA 1JFVA 3GFFA 4Z4IA 4B3GA 1V95A 1RPZA 1OGJA 4GMDA 2R751 3GH1A 3RASA 1JSXA 5DWQA 3BGSA 4HHEA 2ID9A 2OLEA 4HTAA 5F3DA 1JKIA 1DQZA 3BDAA 3E18A 4MW1A 4ONEA 3V2IA 1AKRA 1P7PA 2QTGA 3I53A 4QHYA 5BMVA 2V7BA 3ZCUA 2PL5A 3B6JA 1JAZA 3U13A 4XJVA 3SS7X 3IVMA 4IQGA 3HEBA 3EUEA 1HLDA 2I2CA 3IH5A 4LHVA 3EWSA 1IRIA 1KHHA 1M1XB 2J3IA 4JC5A 5JFOA 1HG1A 3R9KA 1J20A 5DNAA 3QPWA 5BVGB 3HA7A 3QLVC 3IE1A 2AG8A 3EC2A 2ERYA 1TQ2A 4UMFA 5ER6A 4ESOA 4G5QA 4LF8B 4FK8A 1UKAA 2J0QA 1II8B 5CIQA 4BO2A 3K1YA 2NO0A 2C5LA 1QKJA 4DMKA 3ESDA 1Q1AA 3GCXA 4HAOA 1FZTA 1I2DA 4D3SA 4IDOA 3JAMA 1UP4A 5FA6A 3CRVA 4GC9A 3PICA 4OHOA 3UKJA 1ZM3A 1MBZA 4UQLA 5ELXA 4J8PA 4NL4H 5LQUA 4EG6A 3X2FA 1ORVA 4BDTA 5ICMA 4YLYA 1J42A 2QKYA 3JZIA 4QUBA 4FFNA 1BQ3A 2ZRGA 4TLMB 2DY0A 4YVFA 3F47A 4HAIA 4BXOB 3E3NA 1VIDA 4AURA 1UJ6A 5B1EA 3HO1A 1GARA 1RADA 1SCIA 3GELA 3WI7A 3T3DA 4PE5B 5KU7A 1AMUA 4ZIRA 1P80A 3H4IA 4TMTA 5CDHA 3W3AA 3WQHA 4YRJA 1KSHA 2PJUA 2F3UA 1XAJA 5JYCA 1AGPA 4PTLA 5CK5A 2X8BA 1DJQA 3BEOA 1KE2A 3U40A 4BLPA 5C3MA 4RY2A 4KK4A 2HRDA 2B34A 2OSBA 3ZXXA 2XDAA 3Q1KA 1QS0A 1KI4A 1Y3CE 2QM7A 3NBZC 1G4HA 1E8NA 3CYFA 2VJQA 4UM7A 1JBKA 3VAYA 4BWVA 5JJ5A 1JUDA 2VRNA 2W2VA 5DLDA 3O4HA 3AY3A 3EEQA 5EIBD 1UPAA 3ONVA 4B3JA 4F21A 1G9TA 1VKJA 4EGJA 1U6IA 1W0JD 3OFJA 2O0MA 5BRNA 3EJ6A 4IUCS 2RGYA 4V0OA 4B2YA 5LMCA 1OZHA 1N3IA 5AUQA 4FMDF 4Q4JA 1FS5A 3PJDA 3IVRA 4I46A 4U3JB 4HH1A 1ZSNA 3H9QA 2EQAA 1K8YB 5J4YA 2QMZA 3AF0A 2Z95A 3MFYA 2VDMB 3RGGA 5DXJA 3F5QA 3L6RA 4PLTA 2G0NA 4FHCA 5FBRB 3GLIB 2OUIA 1N5DA 5C1IA 1X1SA 3UAZA 3OTGA 1D1SA 1CD5A 3T5TA 2O7NA 3DMFA 1PI3A 3ENQA 4PYLA 1I0ZA 1SZDA 1GYQA 5ECGC 1XK6A 4QICA 1Q0HA 4JP1A 3BSSA 1KXZA 2SNIE 2YUTA 3IAS1 4QOIA 4H1VA 1P9RA 2VT2A 4O2BB 4AY3A 3A3PA 1U99A 4U2FA 5IULC 3L8ZA 1H0SA 4OLJA 3MILA 3W5HA 4RE5A 1D6MA 2OVBA 3N8KA 4J90A 4UQOA 2PJRA 2NSHA 3RU3A 2ZJYA 3A9RA 2EKDA 4B7CA 3ZBTA 3D0KA 3MSXA 4NQZA 2C7GA 2G06A 2QX4A 4DLSA 1IL0A 1ZSYA 3GRKA 1NLYA 2P9BA 3SX4A 3R4CA 2R8RA 1CFJA 2YYAA 4HNQA 5FO1A 1K0FA 2F43B 3DAOA 4GDMA 5HFJA 1ECFA 2PX0A 1JKJA 2FR8A 2OYSA 2ZIAA 3AB7A 4KAFA 1US8A 2P79A 1F51E 1OH5A 4A23A 3ZE6A 3TW8A 5LOVB 2HBYA 1QQ7A 2EP7A 4RGBA 4ANFA 1K5DA 4W82A 3FBGA 4QOHA 1MA3A 5FI5A 1OAKA 4GL2A 4G67A 2COKA 1H0KA 2WA1A 3E5NA 1YFZA 3OE1A 4B74A 4CLHA 5JDIC 2HO4A 4EW2A 2GK7A 3CONA 2GZDA 4IEFB 4D57A 4QG3A 2IP1A 3PRKE 2BM8A 4NBSA 4QNNA 1N25A 2XUDA 2HA4A 3IFSA 4WXRA 5TE9A 2VLIA 3SM3A 5IAOA 4TXJA 1X80A 2G04A 3DBLA 3V9AA 1L5NA 3Q6MA 5BQ3A 5KWEA 4IVRA 1YJBA 3DS8A 4D8YA 3PNKA 5H4GA 4NXNB 3ENVA 1WW8A 3DMPA 4XUDA 5BW5A 1Y1KE 2VPWA 3T1TA 4DCVA 1BH2A 4LZJA 1LD3A 4RXUA 3VH2A 4CCYA 5FTNA 5CR9A 4M1MA 1PTJC 1JLLB 1Y3DE 5FNVA 3HCDA 3SMVA 4Z3OA 1HE5A 4EEXA 1YU9A 3NJ8A 221PA 1P2VA 1TRKA 3QQ5A 5AWFC 1HG0A 4AZWA 2A67A 4X7PA 3C6QA 3C6XA 4II3A 3FKQA 4QPPA 5IM4F 5A4DA 2KE5A 1XVUA 3C3YA 4GX5A 3H42B 4EJMA 4OHCA 4DABA 4LSGA 1JIJA 4A6PA 4KR2A 4AF7A 2DBYA 2FPSA 2PKQO 3AEQB 1W1UA 3BMCA 5KYUB 1ESDA 4WUTA 2WZCA 4KN9S 5F2KA 4EYSA 3I61A 4BQNA 4GU5A 5KX5B 2WM2A 4MS1B 1Q50A 1LWOA 1WPGA 2R87A 2AKAB 3R6WA 5CTAA 5CA0B 1WXGA 2VF7A 1H5UA 5DXFA 5E8JA 4OJMX 1Z18A 5GOZA 3KDSE 1JDJA 3DEHA 3OFVA 2XXAA 1O5IA 1WS6A 1VG8A 1VPDA 3RDPA 1LBHA 1MC1A 4BQSA 5HQTA 1CK4A 1M72A 1LFDB 1YZGA 2HOQA 1TCCA 2DKOA 4HH0A 2R86A 2D4HA 3STYA 4JI7B 1TF2A 2V7PA 1GPAA 4IR7A 5JXIA 3H2BA 1P39A 3EGDB 4OXQA 3IUNA 1BX1A 1PFUA 2XDQB 1DRWA 1K27A 2BZSA 3AUUA 3T1YB 2KS6A 3DWEX 3E9ZA 3AUXA 1K7CA 4N54A 4TLBA 4GOLD 1OZFA 2ETXA 4BP3A 2XSZA 3PYMA 2XGJA 3VOBA 3N0RA 1R66A 5JUWA 1DIAA 1AY0A 1M2OA 1QH9A 3FPSA 3BHIA 3JQRA 5TEWA 4UFPA 5A5FA 2G67A 3FPHA 1FMLA 2B0CA 3SG0A 3B5JA 1BKDR 4PSAA 1DJOA 2CL0X 3NP9A 4E30A 2G88A 1CW2B 4INJA 2IOHA 4HQKA 3ZWNA 3R3JA 1ISGA 1SGWA 1OX6A 3HXOA 2I91A 1ZGGA 1I7QB 2X2EA 5F5XA 2WJGA 3H4TA 2J0VA 1KARA 4XD2A 1I6MA 1X8LA 1ZXBA 3HYRA 1FRQA 4FN5A 3T5DA 2IUSA 1WD7A 4MPPA 1OU4A 2Y27A 3GIDA 3L7AA 2LXNA 5C7LO 4H3SA 3V42A 1C7EA 1WB9A 2VP9A 2ZJ7A 2PSDA 3GMSA 8MHTA 1SXGA 1DTEA 3SICE 1XWFA 4CR6A 3TM5A 1H66A 1PX0A 1H1LB 2GN1A 4MR9B 3AVTA 3OPVA 1UPUA 5KBYA 2PM8A 1R7RA 3OOEA 2VZ8A 5BYKA 1ZJ6A 2WKWA 4IIJA 3SM9A 3PQ4A 1W5EA 5TGDA 4QFMA 2WI8A 1WZCA 4QARA 3DLBA 1H2FA 3QM1A 4IH4A 1Z75A 4D79A 3F67A 4KG7A 5T67A 2RG7A 2JH8A 4YMWA 4R2JA 3LT2A 5C7YA 3VYTB 3G2KA 4BMVA 4K1LA 1QGUA 1E8MA 3PVCA 1UUFA 5KHOC 1RZVA 1WM1A 4GHWA 3RC1A 1UL1X 5K51A 2BTEA 3PFNA 4OEHA 1HKUA 5BVHB 1F12A 2FH5B 3TINA 1RQPA 3FMFA 4MQEA 2ZVJA 1Y42X 2PBFA 3PDJA 4Q4DA 4QDKA 1ZBQA 5J2TB 1PFWA 2H4HA 3BRWD 2VP3A 3C7CB 5AJYA 1Y7TA 3K5PA 4ETIA 5KVVA 2CKMA 2ECOA 2Z8YM 4NF2A 3JYOA 4KGVA 4PLZA 3JRWA 3L1KA 3EN0A 5KWVA 2Z43A 4M46A 2KPOA 3UMBA 4LRYA 3WGUA 3EGWA 3OA2A 2Y0CA 4OQDA 1UINA 3TI9A 1JAXA 3LRXA 5I5EA 1UXGA 1VHWA 3BIOA 3WQBA 3EA4A 3I0MA 2PK3A 4ZYVA 3P2MA 2BH2A 2GBLC 1JZTA 2B1JA 4IICA 3I92A 4RVDA 1VA4A 5CM9C 1JH8A 5FTLA 4C7VA 1RRFA 2PLFA 3A0RB 1K4KA 4OB8A 5BNWA 1UBCA 2P2DA 4ML3A 3OM8A 2J3MA 5TV2A 5JATA 4IZ6A 3TNJA 4IUDS 1DAHA 1RFLA 2RH4A 2P3SA 3C7DB 3EY9A 4OM8A 3QOYA 5JVDF 4YR9A 2HSGA 2XQFA 3I5AA 4WNYA 5D5HA 3VNAA 3AIOA 2F90A 3DVLA 5EJGA 3ABRB 1P4JA 5KTYA 1A0OA 4YRIA 1U7XA 5KYNA 1G9SA 4Q1FA 1NXSA 4M0MA 3G9QA 1VDMA 1T9ZA 3R8XA 4EAQA 4UM9B 1EX6A 3NBMA 2IQ5A 2I29A 3H2KA 3NM4A 4KODA 1V2GA 3WOHA 1A7KA 1VA5A 4D9MA 3N58A 3ETGA 1T3HA 1T0JB 3PVSA 2O8VA 3C6BA 1P1IA 1GAEO 1R5OA 3BTSA 2YZKA 3DXFA 1XTBA 3Q2OA 4BNWA 3V1KA 4YTEA 1AGNA 3IP5A 2B5WA 1PT6A 2PDAA 4IWYA 4LYDA 4K6OA 3A37A 4CL3A 1YJ8A 3QV1A 3NUZA 3JQDA 2WB4A 3DC7A 4Q01A 4LDZA 1SQ5A 4DDVA 4Z2YA 1V43A 3PFGA 4B09A 2J9FA 1VBMA 1SQGA 1TI7A 2GA8A 3AHCA 4P2GA 3T7CA 3LV8A 2BEUB 4IEIA 4XI9A 4BMSA 1EQAA 3HKDB 3PHCA 2BGTA 2J08A 3FRHA 2HMWA 4KHZA 2VBFA 4CQMD 3HABA 4R4JA 1MFPA 2GNPA 2WJAA 6REQA 1F06A 1QJ4A 2VF4X 4I5IA 5JAMA 3THXB 3D3KA 1QTQA 3ON5A 3RBXA 5K8IA 2VN8A 3MWFA 2I71A 4LY6A 1HL3A 2ZIUB 1R18A 4GYKA 1JG4A 2GD2A 4KRGA 1CDDA 1KFEB 2FEPA 3DVSX 3FH0A 3HO6A 3O94A 3QF7A 1OWLA 2IX9A 4ITUA 3BH0A 4HEHA 4J29A 3L6OO 1U8AA 1UK7A 1KGSA 4LDNA 2WSSD 3T0IA 4EUHA 1A1SA 2I3BA 2XJ4A 3HGMA 5HUHA 1QV9A 4R9VA 3C39A 1EA5A 2Q0SA 3S68A 3AB3A 1O7JA 3C5EA 3LF2A 4A15A 5LUBA 3KOXA 3TK1A 2EFHB 4DE5A 1I2CA 4F4UA 2AR0A 3LC7O 4HNHA 5GZ3A 1Y3BE 4RTQA 1FLDA 4TTQA 3QUQA 1MOSA 1D0VA 1IY1A 1KU0A 1GPH1 2O7QA 3AF3A 1JDBB 1OR8A 4H16A 4WLVA 3CRRA 2RARA 3PUZA 3TW4A 3UM9A 4AKIA 2OZKA 4ZYZA 3JQPA 3LPCA 4FOOA 5CTJA 2HK6A 5FD8A 4DUPA 1ZR4A 4EKYA 4CE6A 1Q3HA 3T9BA 5E4TA 2QD1A 2I9PA 3BWCA 1QIGA 3IEUA 1ETHA 4GBJA 3WHIA 2WMNB 5J1TB 2ZVDA 3R6TA 5DI3A 4BEWA 1GL3A 1P44A 3IKMB 2CMFA 2WYOA 2LCFA 2QX8A 2GXUA 2WWRA 5DMHA 3KEMA 4Y6GB 3ZLJA 4PZCA 1USVA 4YBZA 1OXVA 1CB0A 1SD5A 3DV9A 3CPHA 2F3QA 2XB4A 3WLPA 4F4FA 1JI3A 1KJ8A 2OCBA 4TV8B 2Y9PB 4D44A 4FWBA 3DL0A 4IW3B 1FYDA 1RMQA 4YRDA 4CQMA 1N92A 5B1DA 4MMZB 2HA7A 3R7BA 4KXMA 1U3TA 4DCTA 2PSFA 1VBNA 3RNOA 3GH3A 1UKZA 2FFAA 5GVSA 1XWWA 3R5FA 2PIDA 3FDJA 4X7RA 1X7XA 5ALJA 5BQOA 1BQ4A 2WQ6A 1GPKA 4IGFA 3VKWA 1Q3KA 3L41A 3WK9A 4AP5A 5DCWA 3B89A 3KDAA 5L3SB 3PHBE 2Z4SA 1FJXA 4KE7A 1QR6A 4A10A 4QTXA 3D6VA 3ONNA 4NPHA 2IQIA 3GRUA 1K3TA 5DISB 4YMUA 3LQQA 1KJQA 2DJIA 3G0OA 4X1YA 1Q21A 3BZUA 2PH3A 3WIOA 4EJSA 4ESVA 1H3FA 3C8UA 2O3RA 5F7JA 3ZGVA 4JQSA 5HHTA 1K92A 3GQVA 4IFBA 3DDUA 3NOVA 1GN9A 4R81A 1I80A 4TWRA 3TOXA 2ZUWA 2BUAA 4ISCA 2YHAA 1XL0A 2WFMA 4H18A 1DKNA 2NXJA 2AL7A 4UE6A 5EI5A 3ZQ6A 1RFGE 3HM9A 1JVSA 4GLBA 4C04A 5LIRA 2F1IA 1Y4ZA 1YRYE 2IYZA 1YRHA 2JFGA 3IVAA 3OU2A 1EJ0A 3MIZA 1JFLA 3R7NA 3MQ2A 3FROA 2NSLA 1PRYA 2FR1A 3FPGA 3OZVA 2Z58A 5KU1A 4RZSA 1EVKA 1GGFA 2ZULA 3ONDA 2YOFA 4ZO4A 3IEKA 4ZIRB 1V7ZA 4KOEC 4K86A 5E0KB 2B7BA 3T3NA 4L50A 2VRBA 2P9EA 4Y6QA 3S70A 2QVGA 3FFBA 4QHTA 2G8NA 3D3EA 3RYFA 1DS6A 2P2GA 4B44A 1SBTA 2RCNA 3DLIA 2WJWA 4E32A 2ODBA 3R7LA 2UUOA 3A04A 4FZJA 4N3CA 1E4VA 1JIIA 1IU9A 2R96A 3VTFA 2B98A 3FHOA 1HF3A 1NBHA 1I9GA 2RBGA 2IYOA 2IEGA 3ETNA 5T8KA 3TZCA 3PUJA 5I7SA 2G5PA 5TS3A 4C22A 1SHLA 3OZUA 4U63A 5FUYA 2CD9A 5BNFA 3GOHA 2A0FA 3JZDA 4FTWA 5AVXA 4EI2A 3K9BA 1YFLA 1I10A 3Q0EA 5AHKA 1XCGB 4MWCA 5J9FA 2VPPA 5KTNA 1HH4A 4FSXA 2VJYA 3F5DA 3G2QA 3OKPA 3WP1B 4DG8A 3OCXA 5J4KA 1A4IA 3KKMA 4LXXA 4LRWA 2IYWA 4WLEA 1PHRA 5HE8A 3ETHA 3QHPA 1NQXA 4CFZA 4FBGA 5AOCA 1Z2AA 1ELOA 2WU0A 1WZ2A 3IT2A 4LQDA 1C2TA 1U2DA 4Q93A 1JR3E 3F8WA 3WLAA 1V39A 3W9SA 2X1LA 1OCEA 4R7ZA 1K7FB 2OHVA 3C1TA 5ALKA 2X0DA 1ZIYA 4BKRA 1K97A 3NTOA 4NG4A 1NUSA 2YC4C 1EB9A 4D92A 1LC3A 1VG0B 1ZU4A 5CGZA 1GEEA 2GDJA 4AZ0A 1Z7GA 4E07A 4RXTA 4WZAB 5T3UA 4C01A 3FXAA 3I3SR 4XRGA 4MUBA 4AJ1A 4JLPA 2FNAA 2NQTA 1XCOA 3HCOA 3P1JA 1KYWA 4UD6A 1PG2A 3ACDA 1XJ0A 4H08A 3DAFA 3PQCA 3PQ7A 4E1VA 3UPUA 1F2DA 1NVBA 2WJJA 2QGZA 5CBKA 5AIBA 2XQJA 1RT9A 4BNYA 2VXYA 1O94C 2XMGA 4O4LF 2F43A 4HDSB 2QUBA 4JDUA 3HJCA 4S1PA 4F45A 2VPIA 2F1HA 4WK6A 3TZHA 4BRSA 3LCCA 1JKJB 1RRVA 2JVIA 3AR7A 3DH0A 3JX9A 1US8B 4F6LA 2BFDA 4YCSA 2EYQA 4EYOA 1U4OA 3LQRA 5JD5A 3CLKA 1E2KA 1Y4SA 2H6EA 3CLRC 2NUBA 3I9V1 3EDYA 4JVSB 3RBVA 1R27A 8LDHA 1Y8ZA 2V4MA 4XAQA 3TQFA 3ZHVA 1A8UA 4KXYA 1E5XA 1MJ5A 3QLTA 4WY8A 2WUWE 4HB4A 1VI6A 3O3CA 5A4IS 1CUUA 1YZFA 5K3CA 4B3TB 2O3JA 3MHPA 3QEAZ 1TQDA 1EVYA 2R5NA 3RJTA 3ET5A 4CIAA 4IDNA 2EAUA 1MORA 2H4JA 1VJ0A 3N2YA 4ICIA 2CFOA 2NVWA 1VE1A 4ACBA 4BO1A 1NF9A 2FFQA 2OV3A 3VR1A <