4DM3A

Crystal structure of human pnmt in complex adohcy, resorcinol and imidazole
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Missing fragments: detecting cooperative binding in fragment-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dm3A00
5E2BA 1V39A 3KQQA 1EJ6A 1QZZA 2WA1A 4QTTB 5E1DA 3PFHA 1AQJA 1IY9A 2PJDA 1WY7A 3WSTA 1L3IA 4FT2A 3SR4A 2CMGA 3HEMA 1XDSA 3GXOA 3IYLW 4LG1A 4DQ0A 3EGVA 3DOUA 5DLYA 3FTEA 1QAMA 4EMSA 3REOA 4PGGA 4C07A 2NNWB 1NE2A 5H02A 2QY6A 4PYOA 1JSZA 1R8YA 3ELDA 1ZQ9A 4L7VA 5E9JA 5FULA 4DCGA 4PYMA 4YV2A 5DRTA 1G60A 1P1CA 4OQDA 2PX2A 3P97A 5DM2A 2ZBPA 5HILA 1ORIA 5T6BA 1EAMA 3BWBA 3G8AA 4CKCA 3M4XA 4QVKA 3SVZA 3GRRA 2AOUB 4QPPA 4RTQA 3FPHA 4M7RA 1G55A 2ZVJA 3PS9A 2ZW9A 2PWYA 4YUWA 5BXYA 1NBIA 4PYJA 3CC8A 5HZMA 2OB1A 2ZWVA 3KPJA 2C7QA 1Z3CA 3BUSA 2B9EA 3A7DA 2YX1A 2K4MA 4HG2A 2EFJA 1TPYA 2CL5A 3FRIA 5FA5A 3FTCA 5C1IA 5KVAA 3KQOA 2IH5A 4QQKA 1UIRA 3B89A 2JHCA 3JWJA 4FSDA 4A6DA 5C9ZA 2IFTA 4CWAA 4RWZA 4KDRA 4F84A 2FYTA 3G88A 1O54A 5FHQA 2EJUA 1DUSA 4CTJA 5HIMA 3KQMA 2PV0A 3BWYA 5EMMA 3G2MA 2OB2A 5KQSA 3PLAE 2O06A 9MHTA 1JQDA 4EK9A 2UYOA 4RVHA 2C7PA 2NXNA 1RI5A 2B78A 4HTFA 4P7GA 2XYVA 3OPNA 5LQCA 3GNLA 2OKCA 3LDFA 5LQRA 1VE3A 3P2IA 4GBED 3OU6A 3JWGA 3ER8A 1PRYA 3E7PA 2NYUA 1BKYA 3FUVA 3KQWA 3NWEA 3CGGA 3THRA 3DMFA 5EHIA 3R6TA 5DM4A 3LKZA 3V97A 1NV8A 4FSXA 3FRHA 3JWIA 3DULA 1R6AA 3Q87B 1ZGAA 1FJXA 3FUWA 4DCMA 3AJDA 3BKWA 3DP7A 3GU3A 2CMHA 1X19A 3FYCA 1Y8CA 3VSEA 2PX4A 4M38A 3EEYA 3TOSA 1MJFA 4MHTA 2XBMA 1ZHFA 2AN3A 2VDUE 4RX1A 2YR0A 4B17A 4EQZA 2QRVA 3EPPA 3B3FA 3P2KA 4X1OA 4HH4A 5LQAA 1DL5A 5BW4A 2P41A 3IHTA 2I62A 1X1DA 3MCTA 2ZLBA 5CVJA 1SUIA 3EMDA 1RJDA 3UJCA 1TW2A 5EC8A 5EEGA 2HMYB 3EVEA 4UOEA 1YB2A 3EVGA 4AZSA 3FTFA 2PT9A 5EMJA 2IDJA 1L3CA 2AOWA 2R6ZA 1D2GA 3F4KA 2NXEA 2IBSA 2O0LA 4GOLD 4FR0A 2YTZA 5KYGA 4X63A 3JWHA 2PSSA 3LHDA 3BGIA 3V8VA 2C7OA 2AZTA 3G7UA 4QDJA 3OE4A 2IH2A 3SXJA 3NDIA 1SUSA 5U4XA 2H11A 3SGLA 3M6WA 2AN5A 3A4TA 4QQNA 1RJGA 5C0OE 4EKIA 2ZBRA 3CJQA 4GF5A 4PCLA 3KU1A 2JJQA 5F2NA 1KXZA 5KS2A 2GPYA 3EEOA 5FCDA 1KPIA 3FPFA 2OZVA 3C3YA 3LCUA 2JHPA 3MAGA 3LL7A 3KQPA 1L3BA 3NW9A 5E1MA 4ER3A 5DPMA 3TPZA 3EVBA 2AVDA 1R18A 1I9GA 1SQGA 4WVLA 1M6EX 2ZZMA 1L9KA 4MTLA 5DSTA 2BM8A 3HCDA 5ICGA 1FP2A 2N47A 3CCFA 4GOOD 1VPTA 2QYOA 2WA2A 4MIKA 5FUBA 5EZQA 3KPWA 3DTNA 4G56A 4PYLA 5EZSA 3TKAA 4F86A 2PGXA 4K6MA 3LBFA 1NW7A 2AOTB 5CVVA 4AX8A 3A27A 2NXCA 1I4WA 3HP7A 3EGIA 3BZBA 3TM5A 3I9FA 1KHHA 3AXTA 4C04A 2AOTA 4E70A 3EGEA 3E8SA 3DUWA 8MHTA 1JQEA 3R24A 2WK1A 2EX4A 5CVUA 5EHGA 1NW3A 3M6UA 3P9IA 2AOUA 2AN4A 4E33A 1M0EA 2YUIA 4M37A 1HMYA 4PIMA 4EKGA 3LCVB 2PXAA 4OA8A 3OZRA 4FS8A 4IKPA 3ERCA 1Q0SA 3ME5A 2P7IA 4HGYA 4OA5A 2P35A 2ZIGA 2BR3A 3NVMB 1SG9A 2HWKA 5HFJA 3S68A 3HM2A 2B2CA 3FUUA 2BR4A 4RYLA 2FK8A 3HCAA 4DA4A 1WZNA 1O9GA 5LQUA 3T7SA 1NBHA 5DTRA 4C03A 5M5BA 4C08A 2YXLA 5CD1A 2P3LA 2QE6A 1O9HA 1RI2A 3EMBA 1EJ0A 4R6XA 4ER6A 2IIPA 3R0QA 2F8LA 3KPVA 5FA8A 1UWVA 1FPQA 5E2AA 2Z6AA 3KR9A 2DPMA 2BH2A 3GRUA 4U7TB 10MHA 3HA3A 4CKBA 4JXJA 5IH3A 2YXDA 5E1OA 2ZIFA 5K0EA 4R6WA 3AWIA 3DXZA 5E8RA 3FUTA 1QYRA 2KW5A 2G72A 3HVJA 4X61A 3ELYA 3UA3A 3GRVA 2NP7A 3HCFA 4XUDA 3DLCA 3MB5A 2FCAA 1HNNA 2AOVA 1L1EA 2GLUA 4C06A 5CCXA 2GH1A 4PCAA 3LDUA 1INLA 3SM3A 2ZSUA 3LGAA 4HSGA 4P58A 2JG3A 2AS0A 1U2ZA 3X0DA 1VLMA 2XYRA 5EG5A 4E32A 2PWPA 5EOVA 4DM3A 5K8VA 2G1PA 1N2XA 3G89A 5B1SA 3BWCA 3C6KA 5DM1A 4U7PB 1EG2A 3HVHA 4LWPA 1XCLA 1NKVA 1QAOA 3UBTA 3BWMA 3ER9A 2PX8A 2E5WA 5CIYA 3PFGA 2OY0A 2PXXA 3KR1A 2PVCA 5K05A 1JG4A 5HOQA 3NVKI 1KYZA 4NECA 4PWYA 2G70A 1QAQA 3RW9A 2Y1WA 5DRYA 2IP2A 3K6RA 4R8SA 4V0QA 3UJBA 2FPOA 4GOND 4WXHA 4YUZA 5K0CA 4BLUA 4PIPA 5DT2A 1XTPA 5GIOE 1VL5A 1FP1D 3GJYA 3OZTA 5DXJA 4HGZA 2ZZNA 3BT7A 1IXKA 3PTAA 1JG3A 5LQJA 2EJTA 3QOWA 4RTNA 4E2YA 1KR5A 1X1AA 5JUWA 4GC9A 2ZCJA 3M6VA 5EIFA 4CXMA 3CKKA 5FADA 3HVIA 5HIJA 5P8WA 3UFBA 1EIZA 1VIDA 3UJAA 4YV0A 2A14A 1IM8A 3G2PA 3GO4A 3LX6A 3TKYA 5K0BA 2YXEA 3D2LA 2ZULA 5LR6A 3G2QA 5DX8A 5DX0A 5E1BA 5ICCA 3OZSA 3CBGA 5EKXA 5T64A 4AZVA 1KPHA 3EVAA 4M36A 4BP1A 5JR3A 1ZKDA 3Q7EA 2FK7A 3OFJA 5CCBA 3MGGA 3OE5A 3VC1A 3MTIA 4H0NA 1PJZA 2LD4A 4OBWA 3PVCA 3T0IA 4KIFA 1D2CA 2ZTHA 2HNKA 3LPMA 3PX3A 4LECA 3HNRA 5GP1A 4E31A 3B3JA 2BZGA 1WG8A 5E9QA 4A6EA 3GIWA 5MHTA 5DTQA 3EVZA 3KHKA 3T7TA 1RJFA 3SSOA 1OR8A 1WXWA 5CM2Z 4XCXA 3C6MA 4KIGA 2R3SA 2XYQA 4HRAA 2BR5A 4IWNA 3NMUF 4BLVA 1ZGJA 1AQIA 3HA5A 2IPXA 3ID6C 1NW8A 1NT2A 4YV1A 3C0KA 1R00A 5EQJB 7MHTA 1D2HA 4P7JA 2OYRA 3DR5A 5E8JA 2HV9A 5GM1A 3E05A 1AV6A 1NW6A 1VBFA 5DXAA 4RSRA 3HTXA 4HTFB 2P40A 2FRXA 3AY0A 4PYNA 3NDJA 5HIIA 4KWCA 5CVDA 4BP3A 5DWQA 1XCJA 2XVMA 2H00A 3K0BA 2ZZKA 4BY9E 1KPGA 2ONZA 1RI1A 4CKEA 3R3HA 1SVUA 5BP7A 3P71T 3SMQA 4AZTA 3UZUA 2IBTA 2B25A 1JTEA 1JQ3A 3KQTA 4IV8A 2V7EA 4FT4A 4DF3A 4V0RA 5EPEA 4QDKA 3UJ6A 3P9NA 5D1HA 3SSMA 4YUVA 3LDGA 1P1BA 2GB4A 5FWDA 3T7RA 3FUXA 3PT9A 3OU2A 3CJRA 3OU7A 3CJTA 3ORHA 1AF7A 1F3LA 2JHAA 1XDUA 3DMGA 4FGZA 1N7IA 3PB3A 4XUCA 5EGSA 1JTFA 4BLWA 3KPUA 1G38A 1RI4A 5ERGB 3UJ8A 1T43A 4PINA 3B7PA 4ER0A 2IH4A 4RTRA 4YUYA 3G2OA 1ORHA 3IEIA 3OCJA 4GC5A 5GINE 1BOOA 2VP3A 3DLIA 3M33A 4MQ4A 5F2OA 1YFLA 4X41A 4XUEA 3RIEA 2Z6QA 3ELWA 5HIKA 1TW3A 2QRVB 3I58A 5GM2A 5EVJA 5GIPE 2VZ9A 4R8RA 3KQYA 2PBFA 3GRZA 3EVFA 3L8DA 5EMLA 1RI3A 4OX9Y 5GWXA 3PX2A 5CVEA 5K09A 4P7KA 2JH9A 1G8AA 3BGVA 4GQBA 3DMHA 5K03A 1ZG3A 2PX5A 1N7JA 5HEKA 5K0LA 3RODA 5DTMA 1WXXA 4PNEA 3UWPA 4HC4A 2P1DA 2PXCA 4CTKA 3KR0A 2HTEA 4ZTBA 3UA4A 5K01A 2H1RA 3EVCA 3GDHA 2G8NA 3B5IA 3HCCA 2CWWA 3KKZA 5LSAA 2VS1A 1JSXA 3OFKA 5K0GA 2GS9A 2B3TA 5FWAA 4E2WA 2OO3A 3THSA 3KPYA 4E2ZA 3NWBA 1G8SA 5DSXA 2GA9A 4DMGA 2I7CA 2P7HA 3TM4A 2V74B 3VYWA 1H1DA 2C7RA 1F38A 2YVLA 3LECA 1NV9A 3FTDA 4AZWA 2G71A 4P7FA 1XJ5A 5K0NA 2UYCA 1Q0TA 2I9KA 1YF3A 5G02A 5DX1A 3H2BA 2IDKA 2O05A 3FPEA 5GOZA 4DKJA 1RJEA 1SKMA 4RTJA 1VP9A 1WS6A 1EQAA 4DZRA 2VDWA 2PKWA 3HVKA 5FQOA 4C4AA 4POOA 5K0JA 2BM9A 4E30A 5EMKA 2Q41A 1NW5A 4KDCA 3MERA 3P2EA 3I53A 1X1BA 4ATNA 2ESRA 2ERCA 1DCTA 4GOMD 3O4FA 3SX0A 1YFJA 3FZGA 3GGDA 5KQRA 1BC5A 4R05A 3A25A 4FP9A 3B3GA 4KW7A 5ICFA 3R9XB 2CKDA 4ER7A 3QV2A 5BW5A 3G8BA 2Z6UA 2UYQA 4RV9A 3DXXA 3C3PA 3BGDA 3LBYA 5D1NA 1XDZA 4Y30A 3P8ZA 3HCBA 4RTOA 1XVAA 1VQ1A 2EG5A 1BHJA 2YQZA 1KYWA 5LQKA 3CVOA 5FTWA 3GWZA 3U81A 2IGTA 2OXTA 3MCZA 3O31A 4LWOA 5FHRA 2NXJA 1QANA 4QVGA 3MTEA 4PYIA 3I5UA 3MHTA 3ELUA 4GEKA 3NTVA 3ANXA 3M70A 1YUBA 4ER5A 3UJ7A 2PLWA 3TRKA 1R74A 1YZ3A 3I64A 2ZBQA 4OQEA 3G5LA 1JG2A 3A26A 4OBXA 1M6YA 2ADMA 4RVGA 5IKMA 3O7WA 4C05A 2ZFUA 5E9WA 3UJ9A 5LQNA 1R8XA 3EVDA 4X60A 2Y1XA 3MQ2A 3IV6A 3A7EA 5ICEA 1FBNA 1JR4A 5EKUA 2ZWAA 4E2XA 2HR1A 1G6Q1 2ORED 4YMGA 4RTLA 4EVIA 3DXYA 2JH8A 3TLJA 3QOXA 4PYQA 4RTPA 2UZ4A 4RTSA 4KRGA 5FQNA 2ZIEA 4PYKA 3KQVA 3UJDA 4F85A 5K0FA 4PGHA 1YZHA 1KP9A 2DULA 4AUKA 2UYHA 4Y2HA 1X1CA 3TQSA 3VC2A 4KVZA 2NP6A 3TR6A 2PY6A 1XXLA 2O07A 2AVNA 1I1NA 2I6GA 2OBFA 5T67A 2FHPA 2OPBA 3BKXA 3HA7A 3KQSA 4ISCA 3BXOA 3AXSA 3DH0A 3GRYA 3NJRA 4MWZA 3LSTA 4IV0A 3LCCA 1KIAA 3M6XA 3TFWA 5CUQA 5EEHA 3TMAA 1JG1A 1VP3A 1MHTA 1UFKA 4FZVA 4QTUB 1P91A 5F2KA 1SQFA 4PONA 4Z2YA 2AOXA 2O57A 3FYDA 4RVFA 3SSNA 2P3OA 2XVAA 5EIWA 4O29A 3E23A 2GAFA 2QM3A 2VDVE 4QPNA 1B42A 2AR0A 2ONYA 2P8JA 4RTMA 3P9CA 3HCEA 4YUXA 4YMHA 4RTKA 2PT6A 3FPJA 1P39A 3KR2A 4RVDA 3GCZA 3FPGA 2P3QA 3G5TA 3LKDA 3P9KA 5DM0A 4GUAA
chains in the Genus database with same CATH superfamily
3D7LA 1ZD4A 1Z38A 3CLUD 4G3XA 1EJ6A 2X8JA 3R3UA 1MHPA 2AUMA 2WVAA 3ILYA 2QTMA 3GLHB 1NWCA 2RI1A 2HOQA 2CMGA 3KSRA 3K5WA 2Q7XA 2FOLA 2PZKA 4OH7A 2YWEA 4RNCA 3REOA 1F6BA 3LT2A 2PQMA 4RENA 3PFFA 2OORC 3USES 1WXIA 5FTJA 1UZNA 4XYEA 4BRUA 4ZHQB 1WCIA 3AUUA 3Q9UA 1TL7C 1QB8A 4LDQA 4ZQEA 4KMRA 2DLNA 4ZYWA 4DCGA 1G60A 2XX3A 1UMCB 1PD1A 2RK6A 2LCQA 1P74A 1T2NA 5ALWA 1Y0BA 3OQMA 4RACA 2F3QA 2W2KA 1FJ2A 3F6EX 5FTMA 3RNOA 5T6BA 1OYYA 1Q50A 5EZ5A 2GN2A 3B5EA 5B3JA 3ZW7A 1A97A 3HUUA 1MD9A 3HB0A 3O8NA 2XQFA 4XYMA 1WZ2A 3EHDA 1TA0A 2PR7A 2VA8A 5I7SA 1WPGA 3AHEA 2PWYA 4G5YA 3EBOA 1NBIA 1KIFA 3E82A 2YWRA 2XMRA 5FEMA 2HSDA 2ZWVA 3PDIA 1ILEA 4RESA 2IZ0A 2B9EA 4FGUA 4CIXA 5LWQA 2K4MA 3PD0A 5IT0A 3IIKA 4RY0A 4WT7A 2NO5A 1ULAA 1XHEA 4J2HA 5BSKA 1OB5A 1L5SA 3UB4A 4LZZA 4LSMA 3EPLA 3B89A 5CDFE 1TKBA 1NFQA 3DDUA 5ED0A 2QG4A 1SIOA 4JBYA 2H31A 2XMPA 2WQ7A 4UZFA 1KMNA 4CV3A 1AKQA 3SDBA 3SIWA 3KQMA 4BX2A 1OI3A 3WRVA 4ASUD 1VSVA 4DARA 4A8JB 4BV8A 3HUEA 4KUHA 4RVHA 4O4IF 3WNBA 1LC0A 1FXSA 1TT7A 4O4HF 2P9FA 2ZSFA 4IGIA 1RZRD 1U7TA 1UKAA 1OXKB 1Y8QA 3R0JA 2I4NA 3QEJA 5C1BA 1Y3FE 4RK4A 5FLKA 1DG3A 4QO7A 1BW9B 4I14A 1W25A 1D0SA 4GR9A 3HGQA 3N0VA 4MAFA 2PWBA 3D6HA 4MO2A 3KTOA 5F9HA 1M83A 1CE8A 2DWOA 4IS2A 3MRSA 3H9EO 3QPVA 1QNLA 4P5DA 1F8GA 3ZHSA 2A0WA 3K1TA 3ZK9A 3JD1A 1JE1A 1QIMA 1ZXLA 5HJ7A 2EP5A 4LY6A 3NBUA 2QTAA 3DMYA 1B14A 1NLMA 2YYYA 5TMDA 3ZHOA 4C0BA 4EQZA 1UDAA 3IPXA 3JASA 4GSKA 4BX3A 3C8ZA 5JS6A 1XRNA 1IJFA 3PFBA 4FYMA 2WBLC 4D8XA 1OA1A 3DO6A 2H0QA 2VKTA 2QDXA 3MCTA 4ZC8A 3LYAA 5DTJA 3KSZO 4JU8A 3RUAA 3TW8B 3QELA 4U1RA 1IUPA 2P6NA 3NNDA 2PKCA 4RD6A 3VBEA 3FTFA 1T5OA 1ZOOA 4CMIA 3HMKA 1F9AA 5ALTA 1L4HA 2GLXA 2JJ2D 2OO5C 4JNCA 5BNFA 3WMXA 2X0FA 2HQ1A 3H7IA 3HWX1 3PDHA 3FOEC 1U7HA 5BQPA 5LXTF 1SVWA 5E4TA 1LY1A 5FWXB 3WWEA 2R5WA 1E2UA 1BG6A 2AMVA 4GT1A 2IY7A 5B1HA 1PUXA 2KWIA 1V25A 2QXTA 5LM3A 4D82A 1M33A 5A6VA 2CB0A 5C0OE 1FSZA 2F3RA 3KU1A 1WCWA 5JZSA 3F6YA 4QLOA 1MW8X 1J0CA 1Y7PA 3IT1A 4RA9A 3C74A 1DAOA 3JQBC 4NNOA 3KT6A 1CSEE 3U9LA 1OC4A 4MB6A 1W1IA 3WP1B 5CBPA 5IXSA 2XA2A 4JXXA 2H59A 1N6OA 5ECGC 5TT0A 1M6EX 5C4MA 1L9KA 2TYSB 4U9IS 1Y1KE 3FSRA 2Z08A 1M6NA 3Q0EA 4IIVA 4HPJB 3UAZA 2YJ4A 4F4HA 4HLCA 1E20A 3ZWNA 1WEKA 3S8YA 5M2QA 3HJUA 1Q7CA 3IAAA 4MV8A 3T7DA 1C8KA 5JNSA 3UWSA 4MUMA 3SC2A 2ZR9A 1G6HA 3DFZA 5T8KC 1I4WA 4N7RA 4RZUA 1I7SB 5BT8A 4IOMA 5I51A 4MVJI 3JQDA 4I99A 4MSUA 1O03A 4Z9XA 1BXRA 2GM9A 3R75A 5K8CA 1EZ4A 3R24A 1LNSA 4XFJA 3O84A 4TTQA 2PJZA 5JAZA 1EM6A 1P6UA 1SBYA 3VPXA 2FDCA 3SEQA 4UNIA 2J0UB 2ZTUA 2I80A 3MJRA 4JVNA 1UMKA 2OVBA 3MLAA 4FC7A 5DN6A 5DOVA 1H6BA 1H2AS 4ND2A 1ISMA 4MKFA 2H08A 3TWOA 2CK3A 1U0SY 2V6JA 1LX6A 1YUNA 2PBZA 4O4LF 3QYPA 1RVDA 5K0SA 3WV5A 4ESEA 1FMFA 3AI3A 3O7MA 4G1CA 3SD7A 1NBHA 4UOQA 5M5BA 2O8CA 1GPNA 3ET4A 2X42A 4UU0A 4R6XA 1O9HA 5DI3A 4EEZA 2IP1A 3HB4X 2PL1A 2JA2A 3KPVA 3WGIA 4ZYZA 3RBAA 4H15A 1IIRA 3CRQA 5K4AA 3KXLA 1RAHA 1XAHA 3N59A 4WNAB 3OHMA 3S8MA 2Z2JA 3WK9A 1ZD2P 1ECBA 1K6JA 1QHSA 4FE4A 3KEQA 2YXNA 4U2EA 4XVHA 1KJ8A 4DUZB 1KAOA 1QH1A 2GAIA 4WZBE 1U7OA 5T4HA 5JYCA 3R41A 5K0EA 5IF3A 1F2VA 3EVNA 3JQEA 4FXOA 4WDQA 1LLQA 3NBAA 2ODEA 2NQ2C 3UPDA 5K3OA 3M8KA 1BVRA 1Y6FA 5CNIA 5EIHA 5GTDA 4LC1A 1BGXT 3BD9A 4JEMA 4MKIA 1KK0A 3LF2A 3DL7A 4C3OB 3PQ4A 2NVOA 2NVUA 9MHTA 2PX6A 3Q9LA 4BAZA 2F8MA 1L1EA 1HEYA 3W90A 4QT4A 1H6CA 2GH1A 5IC4A 1CYEA 3TDKA 4DSUA 4Z1MD 3RFFA 3M4YA 3P0RA 1OX6A 3F4BA 4UBKA 1SUDA 1FA9A 3VI4B 4CR7A 3HYNA 3PF9A 3GY0A 2A78A 3ZUGA 5FYQA 5IYZB 4XD7D 2C1ZA 2AJLI 3WL3A 5HHTA 3OWHA 3SC6A 1E1CA 2GJAA 1OXMA 1EHCA 2V7VA 3TZQA 4BNUA 3ZY5A 1MJNA 3TB4A 3DG9A 1CF9A 3BWMA 2G5TA 1GSHA 3GZJA 3P1JA 4O33A 3FR8A 3JSXA 3MTQA 4KJXA 3GEEA 1ADJA 2MDTA 2YOHA 2IZ5A 1IH8A 4QUHA 4X8LA 5HP4A 2GM3A 1CULC 1XZMA 1L8AA 3W9BA 3WGMA 4YMUA 1E4EA 4DMFA 3Q85A 4WXHA 4YUZA 1YGYA 1LI4A 1Q91A 1VL5A 5L4NA 4DR1B 1FC0A 4CQMB 2WABA 1R8QA 1DLIA 3T5PA 1BDJA 1ZL2A 4MH0R 4YJKA 4E2YA 1OFHA 3LXUX 4ZKEA 5JUWA 1KYIA 1L5GB 1JDPA 3LP5A 2XNSA 2ZRMA 3UFBA 3OQNA 2M6RA 3UICA 5K2MA 4PHHA 4DN6A 4UPEA 5F3WB 5SYMA 4XCVA 4I19A 4ON9A 4B3XA 1FX1A 1K8RA 4CQLB 1ZD1A 5LMZA 1SCQA 3OFJA 3M34A 2JK0A 2B0JA 2R00C 5C8YB 4TTJA 4BQIA 1GAJA 2Y77A 1XXHA 4CKWB 4QHSA 4NZZA 3C5HA 4OQPA 5CYGA 2Q1YA 4MS1B 1S2NA 1NUAA 2B36A 3EIWA 4B2LA 5B2EA 2IT1A 2WTMA 4WXYB 3SPXA 1OLUB 2REQB 2YH2A 3EDRA 1JBEA 3GJ0A 3A1FA 4UDYX 4MLPA 3ZZ0A 3TGWA 5EJ5A 1KO7A 1GY8A 4HDOB 3M6MD 1JXOA 2IHUA 4HWTA 3H2SA 4QU5A 3EW9A 4K03A 3ZD9A 4KI0A 5TPWB 2KBFA 2VQ6A 3I9KA 4A0FA 3EXEA 1F51E 1RE0A 3CH7A 2JFWA 1N2EA 2C59A 3CWQA 2HL6A 4YVFA 3UUWA 3A3PA 1IB6A 1WNFA 3KTAB 4P7JA 2G77B 3AZOA 3E8MA 5G1NA 1W36C 1EWTA 3QYFA 3Q6MA 3BXEA 4PLCA 5GZ3A 3ZDDA 5TE9A 4KQWA 3I8OA 4RF3A 4UASA 3NDJA 4EJSB 1VB5A 1TLTA 3WVNA 3E9EA 2IYNA 4TSFD 1DO2A 2C20A 3AYXB 3RAEC 1HNWB 2ZYRA 3WGLA 4BHTA 5H82A 1F1JA 2ONZA 5AM1A 3G13A 3P71T 3SMQA 4AYXA 1VDZA 3D2BA 1SBTA 4QXAA 3T41A 2ZXUA 2JLXA 2A6PA 2R6AA 1SZPA 3O91A 4OUDB 2R8RA 3JR7A 2QROA 4DE5A 1SBIA 3C5EA 1Q21A 3OU2A 4DTIA 1LJUA 4Y0AA 2JIOA 2YOFA 4PG4A 3VQTA 1QCZA 1T5BA 1T8UA 3B53X 3EAQA 4MV4A 4XR9A 1Z4QA 1OBCA 4HGOA 1RR6A 2W2VA 4PINA 3GG9A 2D0PB 4Z4GA 1U9ZA 2CF6A 1U3WA 2HV8A 2TSYB 3KALA 1BOOA 3KTFA 4L8FA 2QLBA 4JITA 4XJVA 1AF4A 1OOEA 5FJJA 5A9SB 3FZYA 1BCSA 1CERA 3LHKA 3AY7A 4M3NA 2G1JA 1P9LA 2P0AA 1QIEA 3KQYA 1V43A 4Q9JA 3RUPA 3VZCA 1G7CA 2QZPA 3DMTC 5EJAA 5IU6A 5JADA 2W22A 3HUFA 1ENOA 2RKOA 4NCBA 3JQQA 5LP6B 4GXTA 5DTMA 4NZOA 3AEUA 4LBVA 3SC2B 4B84A 3H19A 4DAEA 5HZHA 2HREA 1Q1GA 2WAXA 4HD8A 4BS9A 4EGSA 1U02A 1LEHA 3EF1A 4LNAA 2H1RA 1NY5A 3F9CA 3KKZA 3W7AA 2H3EA 1JFFB 1NN5A 3H1TA 4JASB 5KCMA 4ZV4A 3PICA 5JANA 4UTVA 1O4VA 1HYGA 1TM4E 2ORWA 2AC2A 3DQZA 3HKEB 3OLYA 5DSXA 3KUDA 3OHSX 2J0EA 3N2KA 2R8BA 1C1HA 4QEKA 4DCSA 1POXA 3GH3A 3AR6A 4YCBA 5JW6A 5E6RA 1Y1TA 5LLTA 1QPZA 1QFSA 5F4ZA 3RSSA 2I9KA 1RRFA 5CRIA 2IPNA 4N82A 5G02A 3R6WA 2DWQA 4N7MA 1SPXA 3T1YB 3U60B 4IBOA 2FG6C 4DKJA 2QRKA 5GONF 3IQZA 1T4DA 2Z04A 3LI2A 1KZYC 2VXBA 3KJXA 4NICA 5DHFA 2W2MA 4DZRA 1U2TA 3RVKA 5JC1A 4Q66C 2OAGA 3C3AA 3PVSA 2X0RA 1FQOA 1SVNA 2C00A 3RVQA 1MJGA 1NRXA 2JL1A 4EOGA 1DCTA 1J09A 1QLWA 1FPMA 2G6TA 3I1FA 3A4IA 4EH1A 1NN1A 3EDCA 1RMTA 3SIXA 4L0MA 4DLLA 5JNTA 5DVZA 4UXJA 1ZH6A 5BVGA 1GU1A 3R3WA 1EEXB 4PXSA 5F9MA 3VX3A 4TV9F 2Q2VA 2I8AA 3S2IA 3AVQA 1E0AA 1DJMA 3K0HA 1NJGA 4J1QA 4MXDA 5J1TB 2BCEA 4AG5A 3HCBA 1EFPB 4I1OA 3ZEIA 2J87A 4BO8A 1QP4A 4C43A 2AN1A 5DNDA 4YS6A 1NMSA 3VO1A 2C5BA 3ZHUA 5J43A 3ORFA 4IDPA 4DB4A 1PR5A 3FJYA 4FB5A 3O31A 2HO4A 2NXJA 5JDCA 1XYYA 4Y1GA 1KK2A 1W73A 2CK3D 3EDOA 3I5UA 4UVIA 3UKDA 3W8NA 4QJIA 5BOSA 5AP9A 2YC2C 3E9NA 3M70A 4X00A 2EGUA 4KAFA 2Q8NA 3DFUA 3JD4A 4X7PA 3TAUA 3H9UA 3QU2A 5A5EA 3TRKA 2TMDA 3A1CA 1AXEA 3BMCA 4OBXA 2WTBA 4WLFA 5BN4A 1NTRA 2SKCA 1FNNA 4R5HA 1JEQA 1M2WA 1P73A 2BSXA 3W06A 2QTZA 1PEKE 5ITSA 5KQGA 4HS9A 1QGUA 1UP4A 7REQB 4YI3A 4C7JA 3C41J 3A4YA 5EVCA 3THWB 1Y5LA 4L85A 4YRTA 3W79A 4V1CA 2HHAA 1GEGA 1ZQ1A 3CNEA 2RHHA 3K9FC 3V1MA 2XB9A 3TLZA 1I4OA 1U7PA 1VKJA 3PIRA 4F1JA 1Z0SA 3F3KA 2ZWPA 4AN0A 1ZOIA 2HSEA 3E48A 4B4DA 2R7MA 4Y18A 3G0DA 5DZSA 2NP6A 1UANA 4XI9A 1W88A 2PY6A 1UXKA 1I7LA 2EOAA 2IUTA 3D8HA 4MP6A 1NUPA 5LBTA 4ZWNA 4LJ4A 2IV2X 2VLIA 2GPWA 2VLBA 2ZSIA 3MSCA 2P6UA 3BMNB 3B3QA 4B9AA 1PWEA 1R12A 1KIAA 3QKSA 4H4CA 4I50B 3UC9A 5CVCA 2JLYA 4L4UA 2G7ZA 3AK4A 3IE0A 4K6FA 3UM9A 1MHTA 2GHQA 5BSRA 1CKEA 1J99A 4KQJA 4RVFA 1RDFA 5IJ0A 2JCBA 3KZXA 4TL7A 3ZNOA 5C1DA 3G2NA 3VH3A 3OQBA 3K1YA 1JHUA 3B82A 3H5IA 1G5TA 3HJGA 4DRXA 2AR0A 2EIHA 4J91A 1IZ0A 1P29A 1P18A 2XI4A 3RU2A 2OHXA 4DAOA 5EYPA 4AW9A 4ZT7A 1WUIS 1IULA 4GYKA 5JNUA 1P39A 1H2BA 2PIAA 3BL8A 2DUMA 2XMZA 3FCSB 1ZINA 3JXEA 4OQLA 4WKGA 3L41A 2WWRA 1R5BA 1BN6A 3E22B 2H6EA 3ZPXA 3MMXA 2WA1A 3KAPA 2IXEA 4R1TA 4RSMA 1FU7A 4Y0NA 3RSOA 2ZR8A 4W9RA 1JB9A 4KO2S 3SXUB 3SHFA 3T1HB 3WLRA 1O0BA 3IYLW 2X8AA 5CA1A 1ZZGA 5FNVB 2FUNB 3WBBA 1CDEA 3GZTB 3G1UA 3QPWA 3C4QA 4MR7B 4EITA 3GPCA 4YP9A 2CFIA 3A14A 4NBNA 1YU6A 4QGHA 1XZJA 2CXOA 1R8YA 4L7VA 5FULA 4JUFA 2GNPA 4N6OA 4RPCA 2J5XA 3GRAA 3ZXSA 4W7IA 5B1IA 5REQB 4V0MA 3LH5A 1KEUA 2C84A 3PWSA 3BAZA 1I94B 4PQEA 3R9XA 1QFMA 2FCRA 4CKCA 5CA0B 4QVKA 3OTQA 2OV8A 3NVAA 3HQ4O 3LUBA 2VJAA 1TIKA 1WL8A 5K0ZA 4GBGA 2ZW9A 3ANNA 1KSJA 4JB8A 1UQUA 4A73A 2V0GA 1X77A 1NBME 2DWUA 1Z3CA 4RL4A 4LISA 3N7AA 4BWVA 1YS4A 1G7SA 3AFGA 4H31A 2WF8A 2NPIA 3K0FA 4DUGD 3E0XA 4P3OA 1EFPA 3FTCA 5ANRB 3RC9A 1UBLS 4L0QA 4QU9A 2C83A 1U81A 3MXOA 2CVZA 1WWKA 2IBMA 5BRNA 4HPWA 4B81A 1ITZA 1FTYA 1I4DD 1AXGA 1Z12A 4XGRA 4ETNA 4PVDA 4EKNB 1SFRA 3JATB 1B8VA 1N6KA 1RRGA 2ZSDA 1ZUNA 2ZJ7A 4WINA 5EQDA 1H2XA 1MX9A 4EK9A 1NBOA 3RVOA 2R62A 4R7GA 3UHOA 4AP5A 5KTYA 1X0VA 2BFFB 1R0KA 3K9WA 3OO0A 3LYLA 4FJ1A 2Z5FA 1KORA 1QYDA 3GNLA 3LDFA 4Y9DA 3H6HA 4DZZA 3ZG6A 1JKMA 2ZRCA 1HPLA 2GO7A 1V16A 4PFSA 4X85A 4ECAA 4ARIA 1AZLA 1MOSA 3THRA 5B55A 3ESAA 1ZM7A 3BG5A 3LKBA 521PA 4MZDA 4KC0A 1RWNA 1F14A 3HLTA 4HX2A 4FSXA 4JZKA 3VKVA 3Q87B 3SR0A 4BLQA 4TQGA 5CK4A 3Q3EA 4GMFA 4PSAA 4IJ5A 3BA1A 1JRLA 4QARA 5BN5B 4YRJA 5MN5A 1NMYA 1R64A 2QP4A 4KGZA 1R0WA 4QBHA 4NAUA 2PX4A 3EEIA 2CMDA 1SG0A 3FWNA 4BP9A 5IAAA 1TOAA 3GR6A 3I8SA 1RXUA 4OHFA 3WGTA 4ZZ3A 2VNJA 2IYLD 1YC5A 3OZAA 2GBIA 2FP3A 1EH5A 1YR7A 2IZ7A 3GROA 1XT6A 1RJDA 3C7AA 1C7IA 1KZ1A 4PO9A 1TJPB 3VKFA 2PUEA 2I03A 2V1XA 1Q1AA 1QHIA 5DKFA 2R6ZA 1OFVA 2NV2B 1OXXK 1P61B 3E3NA 1XVUA 4GX5A 2H2WA 2YTZA 2XNHA 3KOOA 5GOTA 4MUBA 5KYGA 1PEAA 1L8LA 1O4WA 1DIRA 2AZTA 2UZ1B 4LJAA 1VG1A 4Q03A 1ZW6A 3NDIA 3UOWA 1VOTA 1AKNA 3F7MA 3ZLTA 3FOCA 3BTOA 1GCUA 3PZRA 2VSNA 5T3UA 2A0XA 1T2AA 5T41A 2TMKA 3AM1A 3IVAA 5SZIA 1JSRA 1E9VA 5KS2A 3N0RA 2GERA 3FPFA 2RARA 3I4CA 1XMXA 2J5BA 3C3YA 3KD3A 3IQFA 3LCUA 3KQPA 3DVRX 4FFMA 4PG5A 4AG6A 5B3KA 1LDMA 3AKEA 2QSUA 4TWRA 4TV8B 2Y2UA 4UDXX 3SJBA 3W8RA 4CW7A 2VVTA 3I0MA 3T5CA 2R4UA 2FSHA 2N47A 4PXAA 4AQ7A 4FLMA 1K68A 2QYOA 4TPKA 5IDXA 4TMWA 1A2BA 4BNVA 3ZV5A 2LZ0A 1ADCA 4G4SO 4D96A 2EAUA 1NW7A 3O3NB 4KITB 4ZVKA 3A27A 5KZMB 2NXCA 1OVMA 3QVLA 4UM7A 3EF3A 3OE7A 1AMUA 2RKWA 2NUBA 5EJ7A 3M82A 4NULA 1SURA 3B12A 5BWNA 3F73A 4RY2A 2X9LA 2OO5A 2EX4A 1QV7A 1NR5A 4G85A 1YQEA 2Y0EA 2AN4A 1M0EA 4PY2A 3S2FA 3SHWA 1QQ5A 4BBPA 1EINA 1ZN7A 1E66A 4WSOA 2PO7A 3NHRA 2EBWA 4IKPA 5T5QA 4H77A 4DBLE 4PX3A 1Q14A 1E32A 2B82A 3PZBA 4G1MB 4WGGA 4B2IA 2E21A 2EWWA 5GADl 4XB1A 5AK6A 3GP5A 2Y1KA 4D9KA 1TMOA 3WDSA 1XTKA 2YMMA 1DAIA 2BIFA 3HCAA 3KSAC 1O9GA 2BFDB 2IOHA 5AHKA 4BE4A 4MWOA 5LWHA 3E5RA 4QUAA 5HJ5A 2WWXA 5HKLA 3U7QA 3HL0A 3TNLA 3AVOA 4BX8A 4DCUA 3DHVA 4XCQA 2JZOA 1CLUA 2QRPA 3ZV7A 1YVDA 4OH1A 5K3DA 3QEBZ 2I5PO 3KKNA 1UFVA 2D1FA 2IYEA 3USZA 3VR2D 4D0NA 4NIMA 3I5YA 1BW9A 2AFIB 3DCIA 4V0LA 1RKVA 4KN8A 4BNWA 4CKEB 1I5EA 2OCYC 3U17A 1AMOA 3L4KA 2X41A 4LYAA 2GF2A 1QYRA 4EGCB 2J46A 1FB5A 1TFUA 1CE8B 2Q1WA 1E1RD 4C9BA 1P7PA 1F1BA 3PC8A 4UAUA 4X0EA 3HHEA 3RG8A 9ABPA 3IRUA 1SXQA 1ZRHA 2XWJI 5IAKA 5CDUA 1O89A 3E7XA 2AWOA 2XT6A 3STTA 1MT0A 4G26A 2AGVA 4U7JA 3ER6A 1XNGA 2ES4A 4HZGA 1BDMA 1NVFA 2JCXA 3FG9A 3CLSC 1WVIA 3LS2A 3O1LA 4HQ0A 4HSGA 4KU4A 3UY4A 4AJLA 1N8KA 4DB2A 3AR5A 4DSOA 3A04A 3JQFC 1NYQA 3B78A 3K70B 1N5OX 2MSDB 4BQSA 4ENWA 2VF4X 3DAHA 4MW9A 4DDTA 5LNK6 3LO5A 4FGWA 5IZ4A 1WXFA 3FNIA 1V8BA 5A0TA 4NNPA 3GUZA 1NMEA 2AK3A 1DIAA 5IPFA 1QAOA 4X20A 3NC1C 5T7BA 1UBFA 4MLZA 1Z08A 5JEDA 5JBNA 5KX5F 3ER9A 4G84A 4TROA 4B8WA 1IN4A 3GVCA 3T5DA 1L7PA 1NP3A 3R5SA 3TW0A 4HVLA 5HOQA 5LQMA 4CDGA 5KOJB 3NATA 3UJPA 2FQYA 3Q40A 1YWGO 1ZA2A 2ILVA 3LT5A 5EUMA 1RPTA 4Z7OB 1NVVR 4H7IA 4A8HA 5ITVA 1GRNA 1KVQA 2BBTA 1LSUA 2X3YA 4G5QA 4UXHA 3SEZA 3BBLA 1Q95A 3DS8A 3NRCA 4XTCS 2VHJA 5CPBA 4EFNA 1CUHA 4NVRA 4YMSA 3H9BA 3S55A 3OX4A 1J8DA 1X1AA 4J0EA 1Y4SA 2A1TR 5AKLA 2P6MA 4GC9A 3OFNA 3LIIA 1PR3A 5HCUA 4IM7A 3B6JA 5J40A 4CV0A 5C2JB 1QG6A 3DW1X 4HFRA 5FOUA 3BMXA 3KXDA 3MGAA 4EG0A 1ESNA 2OVFA 4JLWA 4L8YA 3LX6A 4C4SA 1IXSB 3K2EA 1HL3A 1ODIA 2PLRA 1WBDA 1DAGA 4M36A 2YZNA 2D1TA 3DQQA 3U7JA 1KQGA 1H1LB 2DFNA 3WWOA 4H0NA 4OFZA 5DV9A 1A8PA 2NU9A 2X2PA 3GPDG 5BPHA 6CHYA 1GKUB 2VYND 3CUUA 4LECA 1L7NA 3GNTA 4FYXA 4QRIA 2RGWA 4J6EA 1U2PA 5IZCC 1UOQA 4LHYA 3N2EA 4F21A 5LU9A 2OHVA 2RHTA 1X14A 3KS9A 4RIEA 3M2TA 5G0TA 5ALJA 5TT1A 2JJYA 4EL0A 2XMSA 5DEOA 4FHEA 1IN6A 1LW7A 3ZK7A 2V7PA 2VTDA 1BROA 4O02B 5JPDA 4DL9A 1Q74A 3ZWWA 3ZWKA 3TF5A 1PNVA 4YV1A 3C0KA 5JQWA 5EJ4A 2FW0A 4RMIA 5D7NA 1K4YA 2OYRA 3VUFA 1H9AA 3LUKA 1W0JD 1NVTA 2WPNA 3E05A 5DNEA 5BN4B 3WLAA 3WK7A 5J4YA 1ZJWA 3ETHA 5DBGA 1J06A 3HTXA 3SMVA 2P75A 5IKPA 1RHJA 1HDZA 2A1TS 1FNSA 1TM2A 3OZBA 2G25A 4K87A 4O6VA 2UXBB 1LTHR 1WU8A 1NRIA 5JNRA 1NF3A 3PGJA 4ZQBA 1E79A 1P7YA 1RI1A 4D4MA 2IBTA 2AQKA 3W6NA 2I66A 2P8SA 2XZTA 3LA6A 3UB2A 3N2LA 4A03A 2ZK7A 4Q4AA 4RVUA 1ZH2A 2ID8A 2GTPA 4PFJA 1LF0A 2QQEA 2PUVA 1M3SA 4HVAA 4YUVA 3ITKA 2BWJA 4P82A 1WPRA 5H0IA 3EUWA 2VH1A 4IX1A 1RNLA 4DV2B 1F3LA 1TQ8A 3C39A 4G1FA 4IGAA 1XP5A 5EGSA 3A1SA 4LI0A 2P2ZA 4RGQA 3ASYA 1BKDR 4E3WA 3CZMA 3MCWA 1QP0A 2IH4A 2GQ0A 2ZBDA 1UWKA 2FPIA 3G2OA 4Q3AA 2HPHA 4A8PA 1VL1A 2JNWA 1XZQA 4EGFA 5SYAA 3OICA 3A3KA 4JVOA 2Q5LA 1E0KA 3L8GA 4JI7B 2ZRFA 2VZ9A 1VHTA 1YS2X 1LBHA 5EMLA 5I9TA 5A1JA 4OX9Y 2DFVA 2AL7A 1T1JA 5KHOC 4NFSA 4ZOQI 2GF9A 1QP7A 1L5RA 2EFCB 3HCOA 4BPRA 1P7ZA 3D9QX 3EY9A 3HJAA 4MIEA 1DZIA 1PZNA 5AYVA 4OKSA 3W2FA 4TLCA 5T6MA 4ZMSA 3Q3IA 4GNRA 1YJQA 5CFLA 4MR8B 2ACEA 2CUZA 4WZBA 4LDRA 2J6CA 3IAS1 3VTZA 4CQMA 4DV1B 1UJBA 2OFWA 1G8SA 4D25A 2A84A 2ZYTX 2I7CA 2P7HA 4XQGA 5C18A 2VP0A 3KVRA 1IAQA 3VYWA 1J1ZA 1W0CA 1F2UB 1ZW1A 4U2GA 2W71A 4KNWA 1JZTA 1JYSA 3DTVA 4G5RA 4P7FA 4AZWA 5K45A 2UYCA 2GK7A 2A67A 1YBVA 4CLOA 2P65A 1RJEA 1H93A 1M0TA 3BIJA 2P4HX 3S4YA 3GP8A 3EQ2A 4JLOA 1X7XB 2VWHA 4ZU1X 4AP9A 1O97D 2JGMA 3CEJA 1Y9JA 2O2SA 4CM8B 2I2CA 4ZEOA 2RGXA 4JX8A 1ONOA 3IEKA 2BHSA 1KVRA 2ZR0A 1AKRA 4PZZA 3EC2A 3CNHA 1F8XA 5L95A 1XA0A 1KP3A 4P2BA 4ENVA 1TC2A 2Z09A 1LBQA 1YR8A 2XGSA 3LK7A 1N2CB 1PHPA 4GYYA 4ZAWA 3U39A 2XOXA 2ZUCA 3H86A 3EPKA 2UXDB 5F2EA 4LVNA 3FCXA 3HLYA 1II8A 1PDVA 1V7CA 3QV2A 1UDCA 4DWWA 3NV7A 1Q3HA 2ODQA 1QK3A 4TXHA 4EFKA 3U4MA 4CCAA 1OU4A 2DF8A 1SQ5A 1ODSA 9GPBA 3D6FA 1Q0HA 1DKUA 2F1OA 1WUKS 4Q5IA 3LZCA 4K9NA 3VH2A 3ZV3A 1P8AA 2XD9A 4K9OA 3GEIA 3H1GA 1TQ6A 5AKXA 1U2GA 2WSYB 2CXNA 3GGOA 3LUGA 1FU8A 1JPUA 4FYYA 2DTXA 4Z7JA 4NZNA 2RBEA 3T34A 4EMBA 2OT3B 2HI0A 2IYYA 1Z22A 3JWEA 1H4SA 1BO6A 3H1FA 3QVUA 1ZN2A 3AKCA 3Q98A 5TVGA 2D06A 4P3YA 1WP9A 4PAMA 4ARAA 4AU1A 4BFVA 5IFLA 7GPBA 2ZRLA 4YPVA 2OGZA 4NBWA 4BLOA 2EXXA 2GM5A 3SHOA 4MUIA 1LPNA 2VOJA 3PVZA 5EKUA 3EXAA 4NJEA 4BYMA 1T35A 4NENA 2VQ3A 3BS4A 2WUEA 4WECA 3UV3A 1N32B 2D1QA 1NFFA 1M34B 2HU2A 3ZZ1A 5EWJB 1FTNA 1GPJA 4RTPA 2AJDA 3BF8A 2PL3A 4LK2A 5M7EA 2C31A 2WVJA 2ZBVA 4TKVB 4R54A 1GNRA 1WCYA 1YZHA 1TKCA 3RJ5A 2NU8A 1O9BA 3VUEA 4J3NA 4AO6A 4DMCA 4IHKA 1E2LA 4ZOLB 3KETA 2QV0A 3WL5A 1GAWA 1XXLA 2EBFX 4B2PA 4UPDA 5ENZA 1DLJA 2UVDA 2XNDD 5CDSA 4FDLA 5LDDC 4PANA 2QMUA 3KL2A 5KPJA 3GRYA 3L1IA 4FOTA 3M6XA 2FZVA 1AXRA 1DQYA 5ALGA 5L45A 4WLUA 4S0XA 4JBWA 1D7OA 4XPIA 3OOWA 4YGXB 4F9EA 3MOSA 1XRMA 4LUCA 2KYRA 1KI1A 1QGED 2FSFA 4KQKA 2C77A 1EFLA 1MZVA 3EA4A 3PGXA 4J8PA 3OH8A 5GV7A 3BWEA 3VDXA 3H16A 4EW1A 4FFBB 1X1EA 2BFNA 1MH9A 5C31A 4C0XA 3UPUA 4C7OB 4FE3A 1X39A 4JB2A 4YI5A 2EBUA 1G8PA 4IQ4A 4TWBA 5JV5A 3EJWA 2Q27A 4MWDA 1IXYA 1CDOA 1C9JA 4WTOA 2FEAA 2GPSA 2ZTSA 5IUJC 1QPBA 4K40A 3BGSA 4NV0A 1GDHA 4ZEVA 4DLNA 2GEJA 4MWSA 2P3QA 4B8ZA 3KYCB 5J59A 4RORA 3V2IA 4X6LA 1OYWA 3VV2A 3K4HA 1V39A 3KQQA 3HADA 3MRVA 1GVNB 2IPLA 3OZ7A 1MNAA 1AQJA 1G63A 4DRYA 4OQXA 3WSTA 1XKLA 1L3IA 4WFJA 4XEUA 3X1ZA 1S7GA 1DV1A 1N8TA 3DDWA 3IGFA 4I3FA 4M22A 3SS9X 3FTEA 3DOUA 5BSWA 1J90A 3ZCVA 1ZUD1 1S96A 1QZTA 1Y1PA 4ALJA 2QMOA 2XCSB 2HYIC 3PRJA 5DYIA 1DBWA 3MIIA 1R4NB 4J9VA 2Y6UA 4Z99A 1SG6A 2CNWD 5AM2A 2CLSA 2YFKA 4CTOA 1RJWA 4WE3A 2UUAB 2C2OA 4JU9A 2X5KO 5T4BA 1UJNA 2O8FB 1GAXA 1AO3A 4DW8A 4Z3KA 2GN1A 1XQXA 2AOUB 1GTMA 4PRZA 1BMTA 3AG5A 3FPHA 2JGNA 2QN3A 3OPYB 4QPPA 5BR8B 4B83A 3I9NA 1H23A 2AXEA 2VPWA 3CNLA 2HCFA 3PS9A 4KGVA 1FRQA 5D86A 3T5GA 6GPBA 2HGSA 2J5RA 3E3MA 3ITNA 1JILA 1Z5GA 1RWKA 2MINA 1FQWA 4L7QA 3QWHA 5NLLA 1ZJ4A 2J0UA 4UE6A 2ONJA 2FWAA 1FNBA 1IHOA 3MA0A 1OX5A 4M8IA 3FRIA 3QSGA 1W59A 2C5AA 4BGEA 3CE9A 4RSHA 4BBJA 3PQ2A 1RAEA 4A6DA 4V24A 1XNJA 3GLHE 1JBQA 2EBHX 4GL2A 2IFTA 3NHKA 1MEEA 4YLEA 3JQ8B 4F84A 3ADDA 3THXB 2AFRA 4JGGA 2REOA 4TTRA 4ZV7A 2BGMA 3E4DA 4YAUA 2G9RA 4EO4A 4IHJA 4EHFA 4DBLC 3H04A 1JDBB 4AD8A 4HTFA 1I3KA 3QWAA 1RIIA 2NLOA 3AHHA 3DLPX 3MLBA 3OFVA 1YZUA 3UT0A 1P9WA 2Y66A 3VR4H 5JISA 3ST7A 2WF9A 3JWGA 3MGCA 5AW3A 3ADPA 3N7UA 3AEYA 2OFOA 1SJ9A 4CKBB 1ZEJA 1K3TA 2C4KA 2Q6IA 3DEJA 3KQWA 3LUJA 2R00A 2JFYA 5BNZA 2VJLA 3T0FA 4COOA 4G63A 3T7JA 4JYCA 4MEJA 4F0JA 2CUNA 2LPMA 3H3FA 5HUHA 2WWTA 3DULA 2J07A 1I24A 2NV6A 1ZGAA 1ZJYA 5F12A 3VPCA 2B34A 2XQGA 3TZKA 3BKWA 3ADBA 1UAGA 1N0HA 4R4JA 1LV7A 2C2MA 3QKSB 5LUAA 5JSYA 1Y7HA 5H3HA 4LBWA 3TNJA 3O26A 1M6HA 3VZPA 4ARBA 4AWXA 3B3FA 1V8FA 3DGFC 4ZRMA 5ITWA 3KEOA 4OHYA 1LPAB 1OAAA 3L7MA 2OYCA 4AJNA 4X44A 3ZU2A 5IYZA 3PJEA 4FR2A 2CLOB 3RUEA 3EVEA 1DDGA 4LW8A 3SLKA 3OX2A 3H9QA 3R6DA 4RIIA 1LBEA 2Q0XA 1AZSC 2JFZA 2QN1A 5JROA 1XQ1A 3I52A 3PGA1 4UREA 3DM9B 4D41A 4G65A 4K6HA 1FUUA 3D54D 3JWHA 3NBKA 4P36A 3H17A 1C7JA 4BVFA 2CCGA 1W44A 3QU4A 3GJSA 1O57A 2ZWIA 4WK2B 5DHAA 4HUQB 2AZXA 1EDDA 3CE6A 1YAJA 3M6WA 4WPGA 4IVPA 1PJAA 2V3WA 4DM7A 3ZDXB 4GPIB 4C4RA 1DDOA 1IRXA 2JJQA 2V03A 3AVWA 1I7PA 2XB8A 2EX0A 2XUPA 3BXPA 3KZNA 3PR2B 4KBGA 4Y2PA 3EA0A 5FCDA 1T9AA 2WFMA 1AK1A 5E3IA 2FPPA 3VU9A 1CJSA 4ZVOA 3THYA 2AQIA 2BM8A 1OJ7A 1AB6A 1JDSA 5CDGA 1WHSB 1JR3D 4YCJA 3G23A 2NSDA 1DNPA 4YXWD 2QZSA 1R5JA 1EWVA 2XOKD 2N46A 2RAUA 3ETGA 4O2BF 5CVVA 5THQA 2OFPA 3QVMA 1OXBB 1W4CA 3DD1A 2JD1A 3FHCB 2OBYA 5FPHA 3ZGXA 1X7ZA 2E4ZA 1SC1A 2A59A 1L4GA 3E8SA 2HMUA 2IU4A 1XKXA 3Q15C 3QLVC 1RCFA 4MEAA 5ETJA 1T9HA 1P2TA 5AKGA 4UTRA 5JASA 4TMZA 1K7CA 3BJMA 4HQNA 621PA 2AOUA 4DV5B 3HO8A 4P5PA 1QKKA 2WIJA 4M37A 2NUTB 3B5JA 4GICA 2IVZA 3M5CA 4D02A 4C2BA 4KO8A 5LIPA 1B26A 3EXHB 3N9IA 1Q0SA 2CDNA 3ERCA 3VO2A 1QVRA 3D6NB 5CLGA 2YOGA 5WRFA 3UPTA 3VZBA 3D1LA 5JZOA 3D4NA 2WYUA 3X2FA 4UQOA 2C9DA 1RD4A 1MTZA 2VJDA 3IJ5A 4FDMA 4FUQA 4ITUA 5DTRA 1PSDA 2QE6A 4XJSA 3V7WA 3QXHA 1T3ZA 1U0TA 2PLAA 4RK1A 3NX4A 1ZR2A 3RKRA 2HJSA 2YNMC 3WG9A 4OLFA 2WZQA 4O2BB 3AT1A 4OAOA 4U7TB 4N5NA 3PEYA 2FOXA 1NJSA 1P2UA 1YQGA 4BO1A 2X8LA 3PXGA 1NN3A 3MWYW 4PRLA 1HUQA 4RM3A 2EYQA 1DO8A 5K4GA 3TGPA 3FWHA 1V8ZA 2QOEA 2WEKA 3BFKA 4V0ME 3BYZA 1CJUC 3NHYA 2JAPA 2PS0A 3MXTA 3ZYZA 4I1YA 4OMUA 1RYZA 2R751 3G85A 4HAXA 1W9MA 3G79A 5E7JA 3RYFA 2ATEA 2MTBA 1H1TA 3AX6A 3C24A 3S7TA 1OLXB 2O8NA 3QTBA 4U7HA 5KOYA 3EPHA 3HRIA 2FZGA 4IINA 5LB4A 1XDDA 2ZRIA 3I2KA 4QFCA 2W6JA 1Q0PA 1SQSA 4PHFA 4URYR 4WASA 1PK7A 3PNMA 2OAQ1 4OGWA 3KVVA 5IG2A 2AKAB 2J3QA 3ONDA 1DTWB 3M3DA 3O8DA 4DHEA 3NHPA 4HVTA 4NQZA 5BORA 1KQFA 3T54A 5IUKC 3AC0A 3FNHA 1H6DA 4UE3S 4B6FA 4Z4EA 4C5BA 5DM1A 2FSGA 3HB7A 4QWMA 3LZ6A 3E9MA 1LV8A 3LCMA 4UTXA 3JYLA 1KDVA 4UBIA 3UBTA 2HA6A 2H5JA 4HDSA 4DT1A 1YBFA 4KX5A 3ZI0A 1L5NA 5CIYA 1U4NA 2WAOA 3NBFA 4CM1A 2EQBA 2NAFA 3S5JA 3DZCA 1E89A 2IXGA 1A95A 2ISQA 2G70A 1QAQA 1TM3E 1USGA 3KB2A 3SE7A 5GV8A 4CL0A 1N77A 1XDWA 3PYXA 1NNSA 1RBMA 1ZVMA 2FVYA 1DEKA 2IP2A 3IKJA 4IIJF 1CUYA 3K1JA 2CVQA 3BIOA 2W6IA 2XKJE 3QXGA 4RAOA 5FV7A 3WBJA 5GIOE 5M3BA 4Z86A 3HFRA 1M54A 2BSAA 4GVXA 2VZLA 3AUKA 1AIPA 3CIFA 2XTZA 2Z8ZA 4QOJA 5F35A 2FMUA 2Z9DA 1JHPA 3ORRA 4FFWA 4N3CA 5J9FA 2IX3A 4M2LA 4IIBA 1OXVA 4EHJA 3T1TA 1H69A 1TZMA 1QYIA 3NRJA 2YYAA 2YIVX 1CNFA 1W5EA 1H2FA 4NMHA 4ZAYA 4L72A 3KJHA 1JLRA 3QXSA 5EKXA 3CBGA 5T64A 3JAKA 3WYNA 1M6VA 4LEIA 4RC9A 2A8YA 2WT8A 5EWLB 3NP7A 2D54A 3LL4A 3ENVA 1GP2A 4CIVA 5IP5A 2V1UA 3V9PA 1II8B 2J7KA 4UU1A 4JQZA 4OREX 4JP8A 3PX3A 4IL5A 1HORA 3I0ZA 1XAJA 4I7EA 1K7XB 3SJZA 5E9QA 3T1QA 1KE1A 1JL3A 2AZDA 2IHVA 2R85A 3KX2A 1I2AA 4N0DA 2OESA 2PX0A 3C4JA 2E4VA 1A9OA 4RLHA 3NPMA 4TL8A 1RIFA 4IVRA 3CLRC 1P0FA 5IASA 2R6R1 4ZCQA 5I01A 3LT0A 4EUSA 2IUEA 4O8CA 4IWNA 1FMJA 2ZB8A 2FV8A 4EEXA 3K0EA 1M1XB 4P35A 1NQWA 3NBYC 4CL8A 3A10A 2ZYIA 5GGYA 3TX2A 1L4YA 1D2HA 1I1QB 2YRFA 3D1JA 5HSGA 2BMWA 5GM1A 4BFSA 3EIFA 3L8YA 4AJ4A 4XEHA 3LLCA 1VLVA 2ZROA 4KPFC 2J3MA 1P2SA 3CUYA 3GLUA 1WPQA 5HIIA 1GDDA 1RBZA 2R6GA 2ZTMA 1AJEA 1Z2DA 4UNSA 3NNNA 4Q16A 5EXSA 3HA2A 1RLOA 2TMYA 3LPCA 4YWJA 4CKEA 5IX8A 3R3HA 1RQLA 4G1BA 4HADA 4UC0A 1ZPDA 2XA1A 4OXYA 3UZUA 4DSZA 1JTEA 4IV8A 1E62A 5EJGA 1C8VB 3I34X 1UF9A 5HTOA 1PFGA 3KHUA 4LWQA 2NU8B 3WZLA 3THWA 4NONA 3GT7A 2OENG 4MGKR 2CL6X 4YP0A 1C3JA 3ZH2A 1N4DA 5D1HA 4KSYA 5TJHA 2NVUB 4LOIA 1MQ8B 3R5TA 3FR7A 1ZIYA 2WFZA 5B7QA 3WNVA 3EXG1 3RYFB 5JJIA 1KK1A 3DMGA 4LRQA 4BLWA 1TRHA 2Y1DA 4FGZA 2D6FA 2IY9A 4NG4A 2HJ9A 3KPUA 5D3KA 1UDRA 4EVQA 1D4AA 3PNYA 3KZMA 1QG0A 2Y9PB 4H6WA 421PA 1N6LA 1JV2B 3DLIA 4X6UA 2Y68A 3QOFA 4HN9A 1MB0A 2RGEA 3MT9A 5BVHA 2VYCA 4IX9A 2FWNA 4HAWA 5LZ7A 3YASA 3A06A 4F06A 1QRSA 1AN0A 1B15A 1B8UA 3VU3A 2L42A 2XR1A 5EWMA 3A2NA 2NU6A 4I08A 3F5MA 1TYEB 3ORQA 3PNVA 4U0KA 1S1CA 2FW7A 1QRAA 1GZ4A 1OIWA 1PJBA 2WWGA 2E18A 3EBLA 3H5WA 1EVYA 1ZUWA 1G1MA 1SVSA 1C8BA 2KB0A 3QEMA 1I1OA 2NXWA 2X5NA 3IP3A 1C7RA 1NJ5A 1THMA 3IRVA 4PXYA 1Q15A 4R9NA 3B9QA 1KYVA 5CDYA 1G17A 3H0CA 3ZU6A 3TQTA 2BTQA 1V5GA 4IFIA 5TGZA 1Q77A 3THSA 2WHPA 3KPYA 1EJBA 4KR3A 1X3SA 1CUDA 1I4EB 2V74B 2XF2A 2QAIA 5FP0A 2CDRA 3C3WA 1ZICA 4C4OA 2VAPA 2FFBA 4MQEB 5TQVA 1E3WB 2KSQA 4JGBA 3UV7A 3BRWA 4NJMA 1OPRA 2IDKA 2D3WA 1I6LA 1NLYA 3FPEA 3OTHA 3W8FA 5BXQC 3KQLA 2OCBA 1Y8ZA 3DWEX 3AVPA 4MQFA 4WMLA 4POOA 2RHGB 3KAKA 4AYTA 2IF0A 1Z2AA 1U5BA 3EDQA 3M4JA 4Z5XA 1N2IA 5G1PA 2QL9A 2C5LA 1P7WA 3CU5A 3KWMA 5FFFA 1T26A 1XVIA 3QQPA 1O95A 2PRJA 4TUYA 2PSEA 4Q1EA 2VTKA 3NBQA 4R05A 4MVJP 2OUIA 3W77A 1E7QA 4PG7A 5B4VA 3R9XB 4QU8A 4TS4A 3KAJA 4UBOA 2V7QD 5ECDA 3DT9A 4A8JC 3FCUB 3C5CA 1LVUA 3B6MA 1V11B 2YFYA 4O59O 3H2GA 3GLGB 5LD2B 3REGA 2XKAA 2XUQA 1XVAA 5HUQA 3K8QA 3QHQA 3QY9A 3LOUA 1X7YB 1H94A 2ZRJA 2GBLC 5AVWA 1HDIA 3H83A 4HAOA 4Y6SA 4BZZA 5K1ZA 2E4YA 4YY3B 2YHBA 2Z1MA 2XJ9A 4IUCS 3MHTA 3KE8A 1JPVA 2JDID 4RDIA 1N33B 4N8SA 1YUBA 3V34A 1GNLA 1V1RA 4V0SA 2H5LA 2C4UA 3D6UA 2JVJA 3G5LA 3RU3A 3UCEA 2QUZA 3GGJA 1DMRA 3GJ4A 3T6KA 1KF0A 4WV3A 4X60A 1L6IA 3A7EA 4L27A 1SOWA 4RPJA 2XUJA 2Q1SA 1D2EA 2AG6A 3N74A 4KP7A 1M75A 3SZMA 2QT9A 4NG5A 3GT0A 1PZFA 2R97A 5TF0A 2DUJA 3WS7A 4N5HX 4ZD6A 1SHLA 2EWVA 5K0FA 1USKA 4H60A 2VSQA 3CZQA 3PHIA 4O4JB 4EYSA 3K3PA 1IK6A 2ZATA 1Q1EA 2FPMA 1L5WA 2M6SA 2NWQA 3GJQA 2VJCA 3GPIA 3HU5A 1LDBA 4LPKA 2Q2WA 4PTLA 3H5OA 5DGIA 2OBFA 5IBRA 2R0QC 4NPHA 1MB2A 1RWBA 3N8IA 4B0OA 4CVNA 2J45A 1V2HE 4BBAA 1S89A 4BLPA 1U63A 4GFDA 4J49A 5A62A 1J25A 1Z7GA 4BN4A 1HQDA 2JLAA 2ZRNA 2QVCA 3GEHA 2HA5A 4Y9SA 1X80A 3V6MA 1EYZA 3WQBA 4D9BA 5ALVA 5I9IA 1AHPA 5BVHB 2GM4A 4DLSA 1I0IA 2XUHA 1U90A 2PTHA 2XCQA 3E23A 3NG1A 2WE7A 2C1XA 3L5OA 1AHHA 3RFCA 3G68A 4AG3A 4OHZA 4EG7A 1PFWA 1CIJA 2I6UA 2PEZA 3EGXB 4YMHA 3D59A 3BN3A 3C1AA 1R0XA 5EP1A 2FF7A 2OEPA 3TOXA 3WISA 4BASA 3FPJA 5CURA 2QMZA 3ESXA 1ULUA 1GNTA 3GCZA 3HLKA 1G98A 4FOSA 4OOFA 1RJ9B 4ZARA 1JBKA 5K9ZA 2WYOA 4LJSA 2GHIA 3TVDA 4K8RB 1NATA 2C2XA 4M0MA 1JNYA 4I9FA 1UQTA 2A3NA 1N5LA 3OKAA 4E12A 5KYWB 4J4BA 4OHVA 2JAHA 4Q4DA 1V7ZA 2P3SA 3M81A 3ZY3A 4HAYA 4NH4A 3L06A 4EMSA 1GSOA 1VRWA 1E3QA 1NVGA 2A33A 2VUSA 5H02A 3U3XA 4CUJA 2QY6A 2JF0A 2RGUA 1C81A 1G2OA 4BFXA 4I4NA 2GN6A 3U5ZB 1T4CB 5K0TA 4N9QA 1NZDA 1T6NA 1V1JA 1N8SA 1XLTA 2IYXA 1Z62A 3AOEA 3BWVA 3EFOB 3D7KA 2XBUA 4DXAA 2V7QA 2VSOA 4E5MA 3OEEA 2QAJA 2W83A 2OCXA 4BEJA 3K96A 3IJEB 5CDFA 1KVSA 4PWZA 1K6EA 1LLDA 4TS1A 3ZDAA 1M74A 2MMCA 4KO4S 4P34A 5FH9A 5AKZA 4FEEA 4RHEA 5ITZB 2PH7A 1DIBA 1Y82A 5I7OA 3D6VA 3GLVA 1YJCA 4ZCMA 3BUSA 4BB5A 1ZU4A 3VV3A 3W5UA 5IDYA 1S9DA 3PQ5A 4HQRA 4UMVA 1FRFS 4TYYA 1TQHA 2GEBA 2B35A 2HSGA 3K53A 4MCHA 1ZH4A 2AE2A 3U44A 2CNWA 3H75A 4JOCA 4CWAA 2VCYA 2ZUSA 3W4JA 1ULSA 3CRRA 4NC9A 5I7EA 3IMFA 1E9EA 2ILTA 4OAQA 9LDBA 2ERXA 2PV7A 1TUIA 1COZA 3VO8A 1IHPA 4LQLA 1G8JA 3L4BC 3C3KA 1WB9A 1IHYA 3L46A 3LVQE 1ZD9A 4TM8A 5EWJA 3VR4D 4GBED 1C9YA 4RELA 1RXWA 3LC2O 1ZOLA 5EN4A 1AKYA 5JHGB 3U37A 4OY3A 4JYPA 1FDUA 4O4IA 2FEOA 2VDKB 4ZZIA 1ESMA 3W7BA 3QQ5A 2XXAA 2P78A 2YYZA 3WLJA 3LQQA 4L4ZA 2JK1A 4YAFA 5TQ2A 1FNMA 1D2MA 5A9RA 4QUKA 5C52B 2WD7A 2YC4C 4EYEA 2IZ1A 2ZRQA 3MIZA 3WHIA 3VSEA 2ISSD 4M38A 3V42A 2OMKA 1UBTS 3VFDA 3DO8A 1YULA 5TS3A 2QTGA 4J0CA 1TUBB 2YVKA 3EPPA 5BQ3A 5DYGA 3DVQX 4HH4A 1G4UR 1MPTA 1G21B 3INYA 4Q6WA 2KMLA 4KDEA 4Z9YA 2OBBA 3CXRA 4FFBA 2ZLBA 4Q24A 3AUYA 2JFQA 5BQFA 3SJAA 3KQKA 5GAJA 2XSZD 3PJRA 4DT1B 5FPYA 2QD1A 2VYFA 3HV2A 5DCUA 1YB2A 4PQYA 4AZSA 3F4KA 3I2JA 4V0NA 1RFLA 1X80B 4MMZB 4W5WA 2G5GX 1KBQA 1B7GO 3A3OA 5LIRA 3P9RA 2IEIA 4DLTA 5GVRA 3DBVO 1F0KA 2IKSA 3LK6A 5JQGB 3ZQUA 3L0YA 2PPVA 2R7KA 3JQFA 4OHCA 1D04A 2W58A 5K6RA 2ZRAA 3IUPA 1BRTA 1A5ZA 1MABA 1RJGA 2Q1UA 1HT1E 2H4YA 3RT9A 5JRDS 4MHTA 1BGVA 2IEBA 2WMDA 4FB4A 1XD2A 2E1RA 2ZI9A 4PBSA 1Y7IA 1B6TA 5EJ6A 3EEOA 1I2ZA 3RLFA 5KYYA 4NMLA 1L5FA 3O74A 3QVJA 4TLDA 1QLJA 3SR3A 4KN5A 1VGQA 3VGJA 2OFXA 3KJQA 3PEVA 3OLQA 3WV4A 1MTOA 2HZBA 1NBMD 3AP2A 5KBYA 3GD5A 5TLSA 1FP2A 2GFQA 4JVLA 5CTAA 2HU5A 5CLFA 1IG0A 3DEAA 3F67A 4BO3A 3KWJA 4J1TA 4PZ0A 1ZESA 2B0CA 1QHHA 3I04A 1XTUA 4QFMA 2QENA 4B1FA 3VTKA 3VKUA 3M0EA 3S8EA 5KOHB 4DLZA 4M88A 1HE3A 2I2FA 2JD0A 3L7AA 1JXMA 4J7AA 1EK5A 3P4YA 4ZU3A 2B1RA 4B34A 4JUCA 2PNJA 2A5YB 5T4EA 1Q17A 1PT9A 2H2IA 3HNPA 3VR6H 3BDVA 1QGAA 5EJ2A 3K0FB 1Q57A 3QFRA 4X8MA 3KT8A 4ZQGA 2WJ4A 4P4SB 1MJ5A 4MUGA 1Y37A 3A32A 3VTFA 2BZSA 3NWPA 1OKKA 3QUQA 1JIKA 2HWWA 3CX3A 3IS3A 4J29A 3GJTA 1O6GA 1OAOA 2BFEA 3KIPA 3RS7A 1T9CA 3BL6A 3U0VA 3DE0X 3K9CA 4TQ9A 1C0EA 1R6BX 4ZICA 1OD6A 5J2TA 2YY5A 4BMDA 4LMPA 4S04A 1FX0A 4OB8A 4YP1A 5CGZA 1NUUA 1BD3A 1N5KA 2C4TA 3K71B 1DCMA 1P2BA 1U65A 2DKOA 3CUKA 1Z34A 1OF1A 3KZKA 3ENZA 1LTQA 4KTTE 4OGKA 1SCDA 2HB6A 3MCAA 3MWGA 1QZ3A 2PN1A 3SYLA 3K9NA 3RSQA 4CKBA 3TOVA 4NF2A 2P77A 3OF3A 1M76A 2M9MA 5ALKA 4MVJE 4REQB 3WA6A 1ATIA 4RJ2A 5CH8A 1QPGA 4TYWA 5ENVA 4L2IB 3LUAA 2IYFA 4KO3S 3TTSA 3DDZX 3DV0A 3FUTA 3CO0S 3COPA 4HY3A 3K9HA 3T35A 4LZLA 4BIMA 2BE7A 3ZGLA 2ZE6A 4JAVC 2OP1A 2OC4A 3DONA 4OV6B 4ZRNA 1KDYA 3V4PB 2VP9A 5G3YA 4FZRA 4IKOA 3H9JA 1PJQA 2LBPA 1UOOA 1HNNA 1WY5A 1J5XA 4L9WA 1WKCA 2HJRA 3OM0A 3D7RA 3LLMA 5AW9A 4C7BA 3U3OA 4MQBA 4NARA 3Q8LA 1U0RA 4P58A 1V7PC 5ENDA 4GMDA 3RVMA 1MLDA 1KTIA 3BTSA 5H70A 3FDXA 4YRIA 3BHMA 4EUFA 5FRDA 2H1LA 3BRQA 1XMJA 2EKPA 3V1KA 1O87A 2BEVB 1HZJA 2BDUA 1SD2A 4B2YA 1MXFA 2ZI6A 4R0MA 4RKRA 1KMCA 3K4QA 4MLCA 1L5HA 1N5RA 4OIMA 3PFGA 3HKCB 1E2PA 2PVCA 4L5YA 1CQWA 3TI7A 3CZPA 4BLTA 4FCWA 3PA6A 3W04A 4P33A 1QTQA 3ZNNA 1CQPA 4Z53A 1EXWA 1S8NA 1ZIXA 1Z68A 2V45A 1FYFA 2PR2A 3NH6A 3BBPA 1ESDA 4GPAA 1ZH0A 4B3IA 2FPOA 3N39C 1CY2A 4I1RA 3E9ZA 3QE4A 4L0CA 2QRQA 5CX4A 5A7FA 5DXJA 3BT7A 2P1RA 4BKQA 2IHYA 3DFMA 2W8ZA 3QOWA 3ZI7A 3DE4X 4DY4A 1H3EA 1ZM4A 3SLRA 2O8BB 1BJKA 3VYVA 3SCZA 5CA0F 1M5TA 1ZM3A 4NMMA 2ZI5A 5HIJA 1E8MA 1LDEA 1J9ZA 5H9VA 4E5NA 2A14A 5KSZA 2WHEA 1L1FA 1PAUA 3BIXA 1N1EA 3FRJA 3CTPA 1XMOB 3WB2A 3CSUA 4AZVA 1WCIB 3V4OA 3TPCA 4ECEA 3GUCA 2JLWA 2QU7A 3IPLA 3H8SA 2PUAA 2CFSA 2JBAA 2Z5GA 3INNA 2YJ3A 3VC1A 2MWMA 2AYXA 2P2DA 3L18A 5FNVF 3UUFA 2QQ0A 2SECE 4XDZA 2OZKA 3HJRA 2M6LA 2YYSA 3SJ7A 1GR1A 2FRDC 3DZIA 3MWEA 1OFUX 4GPEA 4KSBA 2RGNC 4OLJA 2BZGA 3Q88A 4FWIB 3T0GA 2LTAA 5FUQA 3TLKA 3W78A 1BXRB 1Z9BA 2OGWA 4J94A 1C80A 5DEIA 4A6EA 4L3OA 3AEKB 4IVNA 4JUBA 3SF8A 4ZMRA 2PFKA 4J0QA 4MP3A 3HO1A 1USWA 4YALA 4IH1A 5DT9A 3UO8B 1VE9A 3WDMA 5JEEA 1AQIA 2JLQA 3VR6A 1NW8A 4QYXA 1V1RB 1Y6QA 2DHQA 1MAHA 3MTBA 5EJFA 5EAIA 1GPWB 1PR0A 1R6DA 2ODWA 4PEVA 1WVMA 3AM4A 2D74A 3RUCA 1NW6A 3TBHA 4EF6A 3GBSA 2FDXA 1ZJZA 5HWSA 1YNOA 2JFHA 3GMIA 5AM5A 4X62B 2B3DA 1G0NA 1KQOA 2AFIA 3B1KA 4ITRC 3T5TA 3LWNA 5DHUA 1TKAA 1N25A 3ICEA 4KQMA 4M8SA 4B3SB 4UMFA 2Q4TA 1VJ5A 2R8PA 4G5SA 1BWSA 4FYWA 1P1KA 4DC0A 1MENA 1V5EA 3C70A 2DERA 1W30A 1YQXA 2RKBA 3EC7A 1E6MA 1GN9A 4FX2A 5IUNC 2VBFA 2WIDA 1ZJ6A 4Y2SA 2BUCA 5FWDA 1E2IA 1XJ0A 2QK4A 4JK3A 5IULC 3K6SA 5DO9A 2CGEA 1UWLA 3VDMA 2WSSA 1XDUA 2DFKB 3FNRA 1XMSA 3CV3A 3MUEA 4G24A 3E61A 3EHEA 3OJEA 1H22A 4Y2RA 3WYBA 1B2RA 1ZYUA 1RHMA 2DQYA 2XQIA 3KSMA 4JQOA 4CG2A 2X1VA 3ORYA 1UADA 2SHKA 5B1DA 4BXOB 4KCGA 2EZ8A 1B00A 1OJLA 1U1IA 1HC7A 1NVAA 2GYVA 2HLNA 2P5YA 1Z0ZA 2Q8PA 2C8JA 3MTGA 4GGPA 4N5MA 5GM2A 4BNTA 3L8DA 2XYPA 4LVCA 4GIBA 5GWXA 4EI8A 4NYIQ 4EW3A 1DINA 3E27A 4DJTA 3VOAA 3J81k 1OH7A 1JHOA 2R47A 2BEKA 2NUAA 2PX5A 4XLTA 3RSCA 3N6RA 1AU9A 1A1SA 1T9BA 4RO0A 2JLRA 2OD9A 1F4PA 3COJA 3D3QA 4CTKA 1DU4A 1DFHA 3CSSA 3N2GB 4JCCA 3LLVA 5FBVB 2V54A 3B1YA 1GL6A 1P3JA 3DEIA 3HCPA 4MWTA 4PQFA 4R3NA 4RZHA 4RJIA 4WOPA 3TLYA 3UK6A 2ZJAA 2H92A 3GELA 2WHRA 4D45A 1HEUA 3H5LA 3GLHA 4FZ5A 1PT7A 1PFKA 3G5UA 1EDZA 5EXDA 2F1IA 3ROMA 1UWCA 5JMPA 3B60A 2W48A 4M9RA 3E6AA 5LQDA 1DKQA 5TMPA 4W5OA 3TJMA 3JAWA 4ESHA 2JZCA 2VNHA 4JT2A 1OQAA 1U7WA 6NULA 3NYRA 2NPOA 1KYYA 3VNQA 5B7PA 1W2GA 4AXXA 5CX1A 3R4VA 4HX5A 2C2WA 2YWBA 1F8UA 3I37X 3I6QA 2Q41A 1D2AA 2GK4A 1GM5A 4OP3A 1DS6A 1N1DA 2XY4A 4Q9HA 5AKYA 5JCZA 3WRYC 1UXHA 3TE6A 4DWJA 3P27A 2GMWA 1K1EA 2H1SA 3E3LA 3L2OB 2UVPB 3MINA 4PS1A 4BLSA 4EPTA 3KYDA 3KC2A 4B7ZA 5BWMA 2UYQA 4MYTA 1IM5A 3MWEB 3O47A 3OT5A 2NT4A 3ZCXA 1WW8A 3K1ZA 4J0KA 3U3JA 1FFEA 3UK0A 4KPEC 1PK9A 2VJYA 2PJUA 4TTTS 1SZCA 1SUFA 3D4BA 5K3EA 2GWRA 2WNIA 3V4LA 1C4OA 4Q9DA 1L4EA 5SICE 1T34A 1W8DA 2BLNA 3E2IA 4G89A 4MGZR 2WU4A 3C5VA 3FPKA 3JVIA 1O96A 3I01M 1QGZA 4IH4A 3RHZA 1A77A 1DKNA 2O2JA 4N39A 1ZI9A 2Q5OA 4K28A 3NTVA 2B21A 4F3CA 2FFJA 2WTUA 2B6HA 1CNEA 4C6TA 4Q34A 4M0EA 1XB2A 1DARA 4M6WB 4UTNA 1Z33A 5LQNA 2BZ0A 3FNFA 5J5AA 4UOZA 1GWNA 5JO9A 2VJOA 3FYHA 2VTVA 2O5EA 2VA9A 4EYOA 3FB1A 1R50A 3B8EA 1AHNA 1VPVA 2Z5VA 2ZDGA 3VZDA 1R9JA 5K3AA 4DNXA 3WY9A 1QH1B 3FSJX 4MPJA 4DDKA 1M2NA 1UM9B 1CVRA 5SZKB 2ZIEA 4U8HA 1X0XA 1P9RA 3RVJA 3IKMB 2NTJA 2R1UA 4AULA 3QFHA 2UYHA 2HMWA 3RC3A 3W6UA 1D3AA 1UT5A 1ZL0A 1DTEA 4HGNA 3IBCA 2I3BA 3GBPA 1WCV1 2QTWB 1V3QE 2OD7A 2OM2A 4RA6A 3TR5A 4TX1A 1WB6A 2IEDA 3L7OA 2X1LA 4E5VA 1QR2A 3TFWA 1VZ3A 5BNIA 1EX6A 4C0JA 3JZMA 3PDUA 4FNMA 1WNTA 4QXQA 5FOVA 4Q7MB 2VJNA 4JLAA 2F1HA 3HZHA 5F2KA 1WZEA 3EIEA 3FWKA 5F64A 4DA7A 1ZSNA 4UULA 1SBCA 3JQAD 3OCXA 4HYYA 1KOLA 3TCXB 1GTSA 4IWYA 1YU9A 3V8RA 4OHUA 1DFGA 1PS8A 4IMRA 3WGNA 4CG3A 4RTMA 1HG0A 1DAKA 2PX3A 2UKDA 3QPBA 3D3WB 3NHWA 3PD7A 1VGVA 1I30A 3GRFA 3GZNA 4B3MB 3TR0A 2Q5IA 3MS4A 5L3QA 3A1DA 4NCAA 1W87A 1LPMA 3OMXA 3P9KA 4H1WA 4HUQA 2RE8A 3TTYA 3DHYA 2HN9A 1EU1A 2PD6A 5LJLA 5BYBA 2C7BA 1MVLA 3DZKA 1RRMA 2I4TA 3DOJA 3KG2A 4UBLA 1F6DA 2XADA 3SOZA 1E4EB 1D1SA 1NXPA 1R0RE 4X8OA 5A1TA 2X2EA 5G3ZA 5KDLA 1WBBA 5J3JA 3GARA 2FSVC 4I4TA 2OZPA 4PGGA 2GCOB 5B5SA 5EE9A 4OBEA 3QUBA 4QTYA 1UMCA 3DT6A 4FLEA 3WYDA 3GFTA 4K7JA 4HQLA 4CR8A 1T29A 4IDNA 3ZQKA 1SHUX 1KDPA 5IK2D 2RGRA 1XZGA 5CX1B 7AT1A 1KQPA 3FYUA 4IFTA 3OA0A 4FMBB 4IIXA 6PFKA 3NHFA 4ZREA 3IC5A 4EX7A 1EAMA 1AH2A 2P0YA 3DKRA 1F5SA 2FHSA 1NJFA 4MGEA 3SVZA 3SZOA 5KNDA 4LZPA 5DNYB 1G55A 3ZCPA 3PDIB 2ZVJA 4K9DA 1JR2A 1O94C 2B8EA 2VRCA 3LNTA 4ALNA 5A03A 2C9MA 3OUTA 3TLGA 4G8JA 1BEEA 5HZMA 3SQWA 4UBNA 3FJ1A 1C0IA 4I2VA 3GT4A 4BFZA 1GRRA 1WMFA 1WAMA 4GYWA 1DRJA 1ZMTA 1L4KA 2EFJA 3FFWA 5FA5A 3O92A 5J2TB 1FW6A 4NLLA 3UUGA 1WZUA 2QG9A 3NTRA 4I1UA 3AR2A 4E5PA 2WVGA 3CSDA 4MITA 1A8UA 2UUOA 2FYTA 4CZ2A 4TZTA 1DUSA 1KJWA 1WDTA 3CCCA 3MT0A 1K27A 1CIPA 2WF7A 3I3SR 5FL7D 2PDAA 5YASA 3E35A 1QG4A 4ND6A 2ZUVA 4YREA 1E2NA 3FVVA 4R8MA 4P7GA 5LQCA 3MJSA 1PJCA 2B30A 1JEQB 3PGVA 2HW8A 1DKPA 4AS2A 2ZETA 4ZPJA 3NWEA 3CGGA 4GRDA 2H1OA 1EFKA 1T9GS 5CG1A 3V97A 3HB1A 1VSQA 3ZGVA 1ZAKA 4JSTA 4ED9A 4NYJR 5DLEA 2C78A 3IB3A 2C99A 4XD2A 2O2GA 1J2EA 1NQAO 1TDJA 4HL6A 1MQSA 1JZSA 1LZKA 2IXAA 1UBMS 1BH6A 1P1IA 3JTMA 4OBBA 5CJPA 3A0UA 3GEGA 4IIDA 2P6PA 1TD9A 2PMBA 4GX1A 4A91A 5C53B 1JI3A 2AG0A 2VJMA 5JVDB 5HS4A 3A0RB 1NU6A 3F5QA 5HF9A 4L4XA 1QS0B 3TZEA 3D5QA 4FDTA 1PJ4A 3N86A 2HMYB 2FU5C 4YONB 2GD6A 2PT9A 5EMJA 4AURA 1XQ9A 3EEFA 1YBMA 2WG0A 3KKOA 3EGXA 4PO3X 3H3JA 1PFYA 4OYHA 4N3AA 4FR0A 3TGLA 1I9CA 5EMHA 1CCWA 3ISTA 2OL4A 2C3YA 4RU1A 1VG0B 3M5WA 1D2NA 3B2QA 4FZ3A 4QATA 3FGPA 4D99A 3EZ6A 4DRXB 4J2OA 1I5OA 2K5UA 3OO1A 5C5DA 1TCAA 1ECJA 5EYPB 1DUVG 3W3AA 1GNSA 5ALYA 4YGYA 4B7AA 2V8OA 1JDVA 2ZBRA 3OECA 1BXGB 5A6SB 1ICEA 4CLEA 1B76A 3CB4A 1T5HX 2VDRB 5CBPB 3IAFA 4ZYLA 4CN9A 2HIHA 2Q6VA 4OM8A 2C3UA 3PFWO 2WAAA 3N2KB 4EJMA 4ZI7A 1G3RA 2BM0A 2CN1A 3BXZA 3RFTA 1TEVA 5L3SB 3TLMA 1V9CA 5C7OO 3ND6A 3CCFA 4GLLA 1ZKMA 4GOOD 4I4TB 3B51X 3IULA 1O5IA 4EPRA 4BO0A 1E1QA 3EOAI 3B52X 2A30A 3ZU3A 5C51B 5ELXA 3GFQA 4P2GA 3ZW9A 4N8DA 1CEXA 5GZ1A 1IBCA 2I2AA 2Z5LA 3E9CA 3Q7RA 4G1EB 1P33A 2VRCD 2AOTA 1DJLA 1RYYA 2ALJA 3EGEA 3MJHA 2DP4E 4GRIA 4QT0A 5REQA 3ADOA 4BKRA 5A4DA 2XZLA 3CISA 4Q9LA 1H0HA 4RHCA 4CKCB 4CIDA 2XNKA 3OQPA 5FXMA 3VI3B 2B94A 4D98A 2V5AA 5FBZA 1GQQA 1K8QA 4KZPA 4OEHA 2YWJA 2A5DA 5K3FA 4FCCA 2D5LA 2ZIGA 3LCJA 3QWFA 4HNQA 4F2GA 2BR3A 3T9DA 3U7HB 5JNLA 3IP5A 2Q3EA 3F8SA 2I2XB 2BF7A 1FEZA 1K86A 1JHMA 4INJA 5DI3B 1PQPA 4EPYA