4DSOA

Small-molecule ligands bind to a distinct pocket in ras and inhibit sos-mediated nucleotide exchange activity
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
180
structure length
180
Chain Sequence
STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas, isoform 2B
publication title Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 180
sequence length 180
ec nomenclature ec 3.6.-.-:
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dsoA00
1CU1A 1FP7A 1CKEA 4LSGA 4B34A 1Z2AA 2HJVA 3CNNA 1KO8A 3NEJA 3TLXA 2YZ2A 3TR0A 1OB2A 2J9RA 2VP6A 1CP2A 1E1QA 2OLJA 2Q21A 2QPOA 5E4FA 4IFBA 4R2IA 3QKSB 3DVLA 3DZDA 4V0KA 3B2EA 3T61A 1COWD 2ZE7A 1GM5A 4NKRA 1U98A 5BXQC 3B1XA 1JNYA 1VKJA 2DWQA 4V0MA 2HYIC 2ZJAA 5KSOA 2QRNA 4GOKA 3Q72A 2IWRA 1AZSC 3KTAA 4KVGA 4QHYA 3GPLA 1R5BA 3CX8A 2BVNA 2CLSA 3RS0A 5KSYA 1ANKA 4IVRA 4LJ5A 1YR7A 3CWZA 4ZO4A 1UKZA 5JCPA 3FHOA 1BIFA 1G5PA 2C9OA 1AIPA 4LC0A 1KSGA 2O8EB 4Q1BA 2ZITA 1KK0A 3C41J 3QBTA 4JJZA 3HU3A 3F5FA 1W4CA 2QMEA 4TN1A 2FFAA 3KTAB 2ZU0C 1YHNA 3TH5A 2BCGY 1W2GA 1T8TA 2QL6A 4DCTA 1VG1A 1ESNA 4DLWA 3WBKA 2XJ9A 3K70B 2ZE5A 3ZZ0A 3Q5EA 2F1RA 2O0HA 4QNMA 1XEFA 1E96A 5B58C 4PR0A 3GJ8A 1NMZA 5FR1A 3TUZC 3PV0A 3W9YA 2F7SA 4Z51A 2GILA 2O8DA 1S3SA 2JDIA 4FW9A 1N6RA 1U8AA 1JR3A 3FTQA 1GKYA 5CJ2A 4OQMA 5LPNA 5GJCA 2OE2A 2WWHA 3IPYA 1NNEA 4YMVA 1G3UA 3K09A 3MJHA 2ZRBA 4GFDA 3RHFA 1L2TA 1US8A 2QP9X 1WB9A 3OIYA 5EZ6B 3AKCA 4EFNA 3G5UA 1XJCA 1HUQA 1FOEB 2ODEA 1OIWA 3QNUA 3UIEA 1ELOA 1HE8B 1A1VA 3HWSA 1G3RA 5AR1A 2PL3A 1P75A 4DCVA 3QQ5A 4P33A 2JJ8A 2QT1A 4OK6A 4M1YA 1QRAA 1XF9A 4TYNA 1R5OA 1E9CA 4J0QA 4Q1DA 1EX6A 2OSBA 5JSZB 2HXSA 5E7MA 3MRSA 1QG4A 3M1IA 2YINC 4LY6A 4LOAA 4PC3A 4D2IA 3U7FB 5H8WA 4XSGA 1W7AA 4NU0A 1NI3A 4FMBB 5JCZA 2OV2A 1ETUA 4ERNA 3CR7A 1C1YA 1Q1QA 1EXMA 3OFNA 4Q4JA 3K0EA 5FPYA 4AD8A 3LWNA 4GOJA 4X8HA 2FEOA 2IWHA 1YRAA 2ERYA 1KK1A 3Q5DA 3NVAA 5FPTA 3AB3A 4GP6A 4JKYA 2CCKA 5JI3E 4AG6A 3LW8A 1KTVA 2Z83A 4IW3B 2MSDB 2ZYUX 3HU1A 4TTRA 4EQ6A 3Q85A 1GDDA 4A2QA 2VPPA 5L3VA 1NKTA 1OPXA 2VQSA 3I72A 4V0NA 1TQ2A 2GCOB 3BJIC 2CJWA 5HCNA 4E09A 1OH8A 1MABA 1X8JA 1KI1A 2CCJA 3TW8B 2XSZD 4A15A 1M74A 1P3JA 4DUGD 3MLEA 3D31A 4PO1A 4WZBE 2IUUA 3KFXA 5G3YA 2OAP1 3AEZA 4C2UA 5DHAA 1H65A 2GXAA 4D4KA 2D2EA 2Z43A 1EFUA 1OH6A 4BRWA 1ZCBA 2AFIE 3L0IB 2W83A 5LBIA 2ZJ8A 2MSEB 2PH1A 2WTUA 4CW7A 1IN5A 4KFTA 1P60A 4F4IA 5JS8A 2BBSA 5EE3A 5HKKA 3OIUA 1IBRA 5JWRA 1AJEA 4JL5A 3TW4A 3THWA 4LHXA 1T9HA 1G41A 4UNSA 4C0QC 1F2UA 1XBTA 2BV3A 3WHKA 2H17A 5FFMA 3CLVA 1YKSA 3VKGA 1DAMA 2DY1A 2P2LA 1G18A 1J2JA 1UBGA 3NIBA 1NN5A 3K9HA 2I1QA 2OBLA 1VG0B 3V4FA 1EWQA 2BM0A 4RVCA 3RRMA 1A7JA 1G20E 1KDPA 1J70A 1KI8A 1N6IA 4MDFA 1E1RD 2OXCA 1VYTA 1F60A 1W46A 4URZR 2WKRA 1YR6A 5TV2A 1NSFA 1JECA 4Q03A 4QJ3A 1TTTA 1Z22A 1ZUHA 2D3WA 5AJWA 3REFA 1SHZA 5FUXA 5LD2B 2V1XA 4A1FA 2G77B 3TUIC 4US0R 1IM2A 1G8HA 2C99A 2FN4A 4MRSA 4B76A 1XRJA 1U9IA 3KB2A 2MSCB 4LHYA 3SS8A 3NH6A 4E03A 4JBWA 3TKLA 4DB2A 2YOHA 3ZS9A 1GWNA 2HYDA 3B60A 3IGFA 4F91B 5F9HA 2DFNA 4BFWA 4XVUA 5ELXA 2WSSA 1FFHA 1LTQA 1ZC3A 4JLPA 5TB5A 3QG1A 3AP2A 1N6OA 3GLIE 3MWKA 3W6NA 4CT5A 4CF7A 2Q0HA 2GWHA 4LCBA 3OF5A 4M9XA 1X1SA 1TPZA 2AL7A 3D3QA 4ESHA 5GJBA 2QNRA 4IDPA 2IW3A 4DSUA 2IA5A 3VR1A 1VCNA 3TSOA 3KQKA 4KLZA 4B75A 3ZIAD 1RRCA 1QHNA 4CYMA 2Z6VA 3B1ZA 4ZPXA 4KFSA 2W2TA 3GLHE 5JI2E 5K8IA 3LDAA 2CHVA 5DSZA 1IXZA 3DEFA 4ACBA 1KKLA 4BFUA 4D4LA 3A1SA 1Z08A 4DVGA 2O8FB 2QG6A 4G5OA 4TMVA 5TMPA 5EZ5A 3NBFA 1QVAA 1Q1BA 4IDNA 1NLZA 1WMSA 2YYZA 3CM0A 1XWIA 4FMDB 5FUYA 3TK1A 2DR3A 2N1BA 4FCWA 1D2NA 3ZYCA 4ASUA 4BE7B 2G88A 2DWOA 4US1R 5HE9A 2GETA 3KJHA 3KKNA 2G9NA 4Q7LA 3SQWA 1QHSA 4EFLA 4NBSA 1B23P 1GAJA 3F3YA 3THYB 1DG3A 2ZRHA 4GZMA 5D3MA 1IN4A 4LV6A 3W6PA 1XTSA 5L3SB 5JEDA 4B47A 3LRPA 3FFAA 1NBMD 2VF7A 2HJGA 2WJYA 1KI9A 3O8BA 5GJVC 3QENA 4IDHA 3WRYC 1T6NA 2OCAA 3SBDA 2XEXA 1KI7A 3T5DA 2GRJA 4FMCB 4OHVA 1N5JA 1CR1A 4OI2A 2QM7A 4UKDA 4ZCIA 4M0LA 3A37A 2BMJA 2KBFA 4TSFA 2OFXA 3NKVA 2X2EA 5HZHA 1YR8A 2RGGA 1AN0A 3H4MA 3O8RA 2Q9CA 3SE0A 2Z4SA 4GMXA 3LA6A 3WNCA 1AA9A 2VSXA 1ZNZA 3UG6A 5JWHA 1SHKA 3ZGXA 3GLIB 1G19A 1XMVA 3ZIAA 4LPSA 3AV0B 3WMGA 2X19A 2JCSA 3HJNA 1VG9B 4ARZA 4P31A 1LFDB 3QVUA 2RH5A 3N2EA 1N6PA 3A4MA 5DO9A 4LWZA 1W2HA 1T91A 1OH5A 2ZRPA 4CEHA 3WMEA 5BWMA 1KO1A 1XCMA 2ATXA 2FPLA 4PANA 1S8FA 1G3MA 2WIAA 3THOA 121PA 2YWEA 4C0SA 4A92A 5FTMA 2FF7A 2FFHA 2OHFA 4OL0A 2IYRA 2I1VB 5B30A 1Z6AA 3TR5A 1XMSA 4BLOA 5IK2A 1ONBA 2AXNA 2Q9AA 4QFMA 1XD2B 4A0GA 2ZRNA 2WWFA 1VHTA 2ZRMA 5JHHB 1J7KA 2BBTA 2LKDA 2ZVQX 4TZ6A 2IYQA 1DAGA 4UNPA 2JJ2D 2NPIA 4YONB 2Z5FA 1SGWA 4KU4A 1O87A 4Q18A 4YDSA 3FKSA 4Q9KA 1GFIA 5DYGA 3TVTA 1E2QA 3CPJB 4I4LA 2GJ9A 4BFZA 4HDQB 1ZW6A 1YZKA 1M2OB 4TQ9A 1P4SA 2QBYA 4EPYA 5C2JB 2ZREA 3QE0A 1UBFA 3VKHA 4IOLA 2Q6TA 1R0ZA 4R7ZA 2KI5A 1G64A 1P2VA 1Z0FA 1EGAA 3EZ7A 3FPAA 5L3RA 4UNNA 4M2LA 4HB0A 4HEJA 1AS0A 2CVHA 2O8CB 2D06A 2PBRA 1GSIA 3QF4B 3NEYA 1Z47A 2FSIA 2QZ4A 2RB4A 4W5WA 3BD9A 1OXTA 3IIMA 1AK2A 2WWIA 5EUQB 1R0WA 2GVZC 3X1DA 4DB4A 1FTSA 4Q02A 5IK2D 4W7SA 1UM8A 4WVFA 5CB6A 5HKKD 3DKVA 4Q21A 2B92A 4Q9JA 3LVQE 1SVLA 2CE7A 1QG2A 1Z07A 2J3EA 2GJAA 5KNBA 4BLTA 5BN5A 5FOUA 3KQUA 2HCBA 4MGIR 2ZJ2A 1Z6GA 4YMTA 3TJZA 3KKPA 4BLQA 4BEBA 2C78A 3GCGA 5J4KA 2H57A 1CR4A 2D4HA 2RGAA 4KJZA 8OHMA 4IEIA 2HLDD 2V6IA 1HQYE 3IQWA 3EPJA 4URWR 2ORWA 4RCZA 1Z0IA 4D80A 1UKVY 4JVNA 3CX7A 2KWIA 1R5NA 1VCMA 4MKGA 2GKSA 2GJ8A 4LBZA 1E2LA 2GAOA 2OUKA 3GLFA 221PA 4GZLA 2QTFA 2W00A 1R2QA 4UQOA 2V8OA 1AM4D 3LLUA 5DI3A 1UKEA 4F4CA 3QF4A 4NE2A 5KPJA 3IEUA 5H1YA 1GUAA 1JAIA 3PVSA 1KZ7B 2QU8A 2CK3D 1ZU4A 2NZJA 1DAHA 1YZLA 3CW2A 4TLEA 4XVQA 1T0JB 2W6ID 2VSFA 2V1UA 1G5TA 1ZBDA 3L8ZA 4A2PA 1E2NA 1WDTA 4F92B 3RLFA 4KLNA 5FBQB 5DHFA 1QHYA 3QKUA 4UNQA 2G1JA 1KYIA 3KXKA 4P4SB 5G53C 3BB4A 4KSCA 1R8SA 1JB1A 4YLGA 3R7WB 1NG1A 2IF2A 2QE7A 3O47A 4Z1MD 2GCNA 5EUMA 3VKWA 3ZZUA 2AX4A 4B2PA 3GJ4A 3IO3A 4LBVA 3K0FA 1JEDA 3GFPA 3TIFA 3TAUA 4LYHA 1Z6TA 3KXIA 4ASUD 2AXPA 1BH2A 1F6BA 3CH5A 3EWSA 3TMKA 2XNDD 2P0EA 5G3ZA 5JECA 2Q3MA 4IVPA 2J7PA 3RRYA 3RRNA 3AM1A 1KO5A 2C95A 4NYIR 2R9VA 2X1VA 4JLOA 1E9DA 2GEUA 2WM9B 4URUR 2NO7A 2IK8A 2QTHA 4LJ6A 4E22A 3B7GA 1PZNA 4TL6A 4LJ8A 5J4VA 1HQCA 2GJSA 1JR3D 2F43B 3U3RA 2EVWX 4PAOA 3SR0A 2ATVA 4KBFA 2IF0A 4OHXA 1NVVQ 1JAHA 1N6HA 1OYYA 2WJIA 3AQ4A 5H70A 2O8EA 3BBPA 3RABA 2HXYA 2C2HA 4XD7A 3UG7A 5F3WB 2VHJA 1U2RA 3DZ8A 3DDCA 4LHVA 4QL3A 4QNRA 2AFHE 3VR6A 4BFSA 4Q66C 2WIBA 3H86A 4FMCF 4B6EA 2XNSA 5FOTA 3CRMA 4K8OA 1R6BX 3EIEA 5CM9C 4DXAA 3D7MA 4PC7A 1R0YA 2XOKA 2QI9C 4D0GA 3UPUA 1FW6A 1S9DA 1ZUIA 3QXXA 2WWGA 2PLFA 2J46A 4AURA 3PUWA 3UMFA 2AR7A 3PG5A 5JBQA 3FYHA 4I1UA 3V00A 1IAQA 2GZDA 3CF2A 4RJLA 1PLKA 1DTSA 2K5UA 4I99A 4C7OA 1UKYA 2NIPA 1G3QA 1CRQA 2AWNA 3GQBA 4IHQA 3CONA 1BYUA 3CUEF 4HZUB 3QUSA 2BKEA 3E1SA 3FE2A 4H1VA 3CX6A 2CLCX 2ZUBA 4JLBA 4WAUA 2B7CA 1HY3A 2ZRAA 4RCYA 5KTYA 1QHIA 1LF5A 1ODFA 1OXSC 3AF2A 5TARA 3R7WA 2JLYA 5CDFA 4CIDA 4V02A 3LBHA 1UBCA 2YV5A 2JLQA 2WJJA 4Q00A 4WXRA 2J7PD 1LV7A 4TLAA 3EPHA 2WSMA 3W8RA 1KO7A 2VEDA 5G41A 4JKIA 2CE2X 3SFZA 4HAVA 3U3KA 4OHWA 1XZQA 4HUQA 4HDCA 3B6EA 2OO7A 3L2OB 2XITA 1SVKA 2H7VA 1W0JA 4DLUA 2IYYA 3IDQA 2IXEA 1RW4A 3C5HA 3BXZA 3OIVA 5JEEA 1KHTA 2ZR7A 2YWGA 4GT1A 1WBDA 2FSHA 3DKPA 3PEUA 4PPGA 3AH8A 2VHTA 2YWHA 4MITA 3K0SA 1KSFX 3CPEA 2R6AA 4PZLA 2QP3A 1SZPA 2L0XA 1GRNA 2Y8EA 4DDVA 1CS4C 3V4RA 4Z54A 4GOXA 1PLJA 2ZYTX 1H8ED 1Z0AA 3D6TB 4G1UC 5EP1A 5CLQA 1R8QA 2VF8A 1G4AE 4II7A 1XTRA 4KO8A 4PHGA 4A8JA 4ZCMA 1U0HC 1UAAA 4PAQA 3LD9A 3GJ0A 4NCKA 5AUQA 4JLJA 4KV9A 2ONKA 3QKRA 1XMJA 1A82A 2AK3A 1HTWA 2FG5A 4TQAA 4TSFD 2ZJ5A 3U61B 1VCIA 4EFMA 4JS0A 1FNMA 1YQTA 3P4YA 2WOOA 5E95A 2QEQA 4NCIA 4XOIA 4DSOA 4RFVA 5JMTA 1E2JA 1VCOA 2KBEA 3GEHA 4QBFA 4HLQB 1OT3A 3CWQA 3IO5A 2A78A 3CZPA 2IS1A 5UKDA 2P3SA 1U99A 3B9PA 1QHHA 3PUXA 4LJYA 1F2TB 1T0HB 2NZ8A 3RC8A 4O2LA 1GNQA 2ODNA 4MRNA 1DBSA 3PXGA 4BEJA 1TEXA 2BM1A 3PJRA 1XX6A 5F9FA 2JJ1A 4TZ0A 2O8BB 3MAAC 1PV4A 2BEKA 4KXFB 1VG8A 2QE7D 1EFTA 2B6HA 1S1MA 5FL3A 4F38A 4B3FX 1PLLA 2ZRIA 1M34E 4YXWD 1IONA 2F9LA 3E70C 1UEJA 1NVXQ 4OQFA 4DSTA 1G8YA 1N5LA 1N6KA 4OI1A 2ZETA 1YVDA 2NO1A 2XNDA 3K0FB 3UANA 1MOZA 1NVUQ 1ZM3A 4TMZA 4BWYA 5J47A 1RC8A 3FMFA 1TNDA 2FX3A 1GTVA 4OYHA 1RKBA 5CM8B 4HB3A 1Q0UA 3F8TA 1E32A 1II9A 5D3MB 5P21A 1X8LA 2ZU6A 5A4JA 3ASYA 3BE4A 1TU3A 2XXAA 4QBGB 4E07A 1I4TD 2F6RA 2HUPA 1Q3HA 4Z1MA 1UF9A 4M21A 5JJLA 5KPDA 2IT1A 1LVGA 4RZ3A 1MO5A 2O8BA 4OHYA 2VP4A 1SXJE 3U3OA 3X1ZA 2RGDA 4Q1FA 1X6VA 4QOSA 5LB4A 2I3BA 3NBZC 1EK0A 3FB4A 2PZFA 2ZSEA 5BYKA 2ZXUA 4PC6A 4TL9A 1SVIA 5EE9A 1OKKA 4DRZA 1Q44A 4C7OB 3ZVLA 3VNUA 1P72A 2ASEA 2GHIA 1E9SA 2OFWA 4MYHA 2Z4RA 4Q9IA 4GP7A 1X1RA 5DH9A 1S4QA 2GCOA 4KAXA 5KSZA 4C4PA 3KKMA 5BN3A 3C8UA 3LQRA 3PEWA 3REGA 1I2DA 3EAQA 3A58B 3OZXA 3IPXA 1M1YE 2GXSA 1NLYA 1NIPA 1NF3A 4UXIA 2WKPA 4PPQA 3AVVA 4EIWA 5K8TA 2PJRA 2OZEA 4BFVA 3SDZA 4BZPA 3K53A 4M4SA 3UWKA 1XDBA 2D7DA 4P0TA 2RGBA 4MQBA 3I4LA 1Z29A 2VP0A 5FBWB 2WMNB 4LPKA 2J87A 3EC1A 4F93B 3NC0C 2PJZA 4B32A 1CTQA 4BPBA 4NMMA 4EJSB 1ZUNB 4I1SA 3AF0A 3FMIA 1XPUA 3QXSA 4CEIA 1CBUA 3SYKA 4F7WA 1U8ZA 3BFXA 1G9XA 3HYRA 4RKFA 2Q9BA 2XTZA 1NL3A 2XGJA 1E1QD 2W2VA 3RSOA 1PVOA 1UPTA 3LW7A 4PO8A 2JLWA 5D3QA 4HUQB 2ZR0A 3I5YA 1A2KC 2OT3B 1MRSA 1DG1G 1RYFA 3K0AB 2RAPA 5FTNA 3TRFA 3FHTA 1XD8A 2OBNA 4IOJA 4LJ7A 4B71A 2CNWA 3AVWA 1SKQA 5EXPA 4YXWA 2DFKB 3I73A 1DAFA 2P67A 4Q7MB 2GXUA 3NWJA 2WWXA 4D26A 3OESA 3ZH9B 2ZJYA 5EQTA 1I4LD 5DLQC 1DO0A 3GFOA 2ZEJA 1MO4A 5KNDA 1Q1EA 1E0JA 1JPJA 1UDWA 4A6XA 2ZAOA 1A4RA 5AJVB 1KI4A 4L15A 4D4MA 1W4RA 1IY1A 1NKSA 4WZ6A 4R71A 1KGDA 3FKSD 1CIPA 5GJWC 3TE6A 3IEVA 1MRNA 4A0RA 4FCTA 4A4DA 4ZV4A 5IF9A 1Z5ZA 1NN0A 4L8GA 1PUIA 3RDPA 2EWVA 5KHOC 4KODA 1F3OA 6Q21A 5AJYA 4IFEA 4P3YA 1ESMA 3B1VA 2PCJA 3GLFB 1SXJB 2CHQA 2F9MA 2J1LA 1BS1A 4EJSA 4PSAA 1I4DD 2R65A 4YC7A 3JVUA 3QEJA 4GI7A 1K5DA 3CNOA 2JJ1D 3BAFA 2XB2A 2VP9A 1G16A 4IKEA 4GMDA 4MDEA 1SKYE 2PMKA 4QXAA 2EYQA 4JYCA 1SXJA 1N2CE 1MV5A 1W44A 1TMKA 3MCAA 3RS3A 3I8SA 2DBYA 3T06B 5FBLB 1DEKA 2MMCA 1LNZA 1SVMA 3OEHA 3Q3JB 3AKDA 1OW3B 1LB1B 4KHZA 5HE8A 4EPWA 3GD7A 2ZQ5A 3A4LA 3AVXA 4HB4A 1MKYA 4Q4AA 1FMLA 1NSTA 4KI0A 2HT1A 2A5YB 4Q48A 2JIZA 3ZD6A 1KY2A 3PCRB 4YQFA 3U6KA 1TU4A 4C2TA 1GL7A 2FGJA 3Q9LA 3A6PC 3Q7PA 2NG1A 2ZS9A 1RRFA 5B64A 3TAHA 2XZPA 4JVMA 2JLXA 2NO9A 2FNAA 4CZ2A 1E99A 4A2WA 4IEEA 1CLUA 1KI2A 3WNBA 5FPHA 1M8PA 4KVAA 4DLZA 1M7GA 1P73A 4D81A 3R8FA 2DYKA 2I4IA 1KI6B 2WPDD 4U7DA 4CEJA 4PHFA 3FGNA 3RS5A 4TMXA 1SVWA 4JLNA 3VR2A 3THYA 5J4YA 3DPUA 3A1VA 1W49A 1S2MA 2ZI9A 1UEIA 2V9PA 4PO9A 4IJMA 4XJXA 1EFHA 1GZSA 2EW1A 2KJQA 3CKLA 4M1KA 3TVDA 1KIMA 4CEJB 4B48A 1NVWQ 1FQKA 1RYHA 3DHWC 4JT4A 3KKQA 1XEXB 5TVKA 1E4YA 2B8TA 4HZUA 3VTKA 2WWYA 3K9NA 3TSWA 4BFTA 1T5IA 2ZRCA 1E9BA 3T12A 1ZD9A 1OB5A 4Y0AA 4A0FA 3TGPA 1P2TA 3A1UA 4HAUA 3NG1A 2PMDA 3HPRA 3VNVA 2GTPA 5DN6D 3ADCA 3VQTA 2HDNB 4R2HA 2HT6A 2TMKA 421PA 4AYXA 1OJLA 3AKEA 1XPOA 4POAA 4DC9A 5JS7A 3DL0A 4FN5A 3VR3A 2EYUA 1GL6A 4V0LA 4DCNA 1YJ5A 2V7QD 4JL8A 4MUAA 4NYJQ 2Z0MA 4JMPA 1G3IA 4DUGA 4H9GA 4LC1A 1YE8A 4C0LA 3GJXC 1G7CA 4PSKA 1IOZA 3U60B 3ICQB 1GVNB 1AQYA 2IL1A 3M0EA 2QQ0A 1C9KA 3GP8A 2Q3FA 2RGNC 3W3ZB 5AUNB 1V43A 1AKEA 4M1WA 2CVFA 5KNCA 3EZFA 1Z2CA 4Q47A 2ZROA 3CH4B 3AVYA 2PT7A 3P1JA 2JAQA 3PEVA 3IIKA 4TTQA 2JGNA 3DO6A 3OE7D 4Q4HB 1MO3A 3ETLA 3CRRA 4JLMA 4B3GA 3X1YA 5FOXA 3CRQA 1ZD8A 3I3SR 1W0KA 5HPYB 3JZAA 3LFUA 1OF1A 1YZGA 3E2IA 1BYIA 4JLDA 1DAEA 2QAGA 1XD9A 1E3MA 3GJ5A 1E79A 5FOWA 2FSGA 3ZZTA 821PA 1F2UB 1E2MA 2QP4A 3CB4A 3THWB 1D2EA 4PTLA 2JLVA 3U44B 1E1RA 4AKEA 4F4JA 1GNRA 4ZDJA 2G0TA 2BJWA 2REXB 3U7EB 3KQHA 3K0CA 4B35A 1NIJA 5KOYA 2REBA 3SN6A 2VHCA 4OJQA 1OFHA 4ZI3A 1BO6A 3GLHA 3NC1C 4DLTA 2QRZA 1XU4A 2QGNA 4DEXA 2ANCA 3MWYW 3WP0A 5HR5A 4M9ZA 4LJ9A 2DPXA 3NH9A 4M53A 4NP6A 4AWXA 4CGZA 3U3JA 4O0MA 5FBRB 3NTUA 3PQCA 4M9SA 5LB2A 4BASA 3QF7A 1GL9B 1OHHD 3FMPB 2C04A 4L9SA 5EXSA 5FUVA 3I92A 3FWYA 2ECKA 3AUXA 4WIAA 3X1XA 2ZYVX 1DS6A 1ZJ6A 3IHLA 4PQFA 4DT1A 3T15A 1W0KD 1ZP6A 3OAAD 1DVRA 3FVQA 4URVR 3PUVA 3CZQA 3BFVA 3VX3A 1D6JA 2J7KA 5J4HA 4QHTA 2P6RA 1DE0A 2PEYA 2R6DA 3CPHA 4XD7D 4TTPA 1P2SA 3U6BA 3CIOA 1FX0B 1JQLB 4JZKA 2GJKA 1JR6A 2YOFA 4OQLA 1KOFA 3PFIA 3UATA 5CYPA 5C18A 4Q4AB 1T4GA 2G0NA 1WA5A 2FGKA 5CK5A 4KITB 5B2ZA 5M04A 1W4BA 2IYLD 4JVLA 2YKGA 3SI7A 1JR3E 2RGXA 4NPHA 3DM5A 4EJSC 3KJGA 2P6UA 3LXRA 3TQCA 1GKUB 4MUBA 4D0NA 3QG5A 4PFSA 4RSGA 3SOPA 4M9QA 3U4QA 1BMFD 1TF2A 1U0LA 1H8EA 1KI3A 5JJKA 1N0WA 4B3BA 4LBYA 5EXXA 2F1JA 1ZNYA 4G0NA 5FI0B 1OXUA 4C30A 4MKHA 3FDIA 5L3SA 2FMXA 5LD2C 1H8HA 1WRBA 4B3DA 4AKGA 3MUFA 4X8LA 1ZC4A 2QAJA 4QC2A 1RE0A 5SZIA 5DNYB 2WVJA 3ZJYA 3IIJA 2ZAMA 2BCJQ 3WYFA 2ZRGA 1XZPA 2CL7X 4RY2A 3HYTA 4QM6A 2FSFA 2XXAB 3IILA 4LUCA 1XCPA 3AGQA 1FQJA 2V4ZA 4JL6A 4DCUA 2X77A 3JVVA 1NN3A 1WCV1 3KZ1E 3U7HB 1KI6A 3ADBA 2PT5A 2REOA 5C46F 2GZHA 3BH6A 4RD4A 3QJYA 1GITA 3LQQA 1U0JA 3LV8A 5JFGA 2QBYB 4DJTA 4EDHA 3PEYA 4HSEA 4W5HA 2J0VA 1X8KA 1N6NA 3S1AA 1S1CA 1D9ZA 2EFDB 1HA3A 2GBLC 2BIFA 1VPLA 2AWOA 4N0DA 2GK7A 3H0KA 4FCVA 4K81B 5BQ5A 1QHHB 4ZKDA 2ZSBA 4PZYA 4KFUA 5IRCD 4YMWA 4CDGA 1AQUA 2OFOA 2F3RA 1X3SA 4TLBA 3SJAA 2DFLA 2R8RA 2RHDA 1FTNA 1KY3A 3B5JA 2E9SA 4ARZB 3KL4A 1E2FA 2WAYA 4G5RA 3SHFA 3MGCA 2P5TB 5JWOA 1E6CA 3N70A 4LBWA 4RZUA 1OXXK 3AP1A 1EFRA 5KO2A 4HAXA 2V3CC 4A36A 4O3MA 4HDOB 4XTCS 4DWJA 1QZXA 2NOAA 2XOKD 2FZ4A 3BWDD 4MYUA 3QIAA 3U5ZB 3Q8XB 1Z06A 3KX2A 4TMKA 2GF0A 5F2EA 3NDBB 2BBWA 2ZI6A 4URXR 2WBLC 1Z0JA 1V5WA 1IY0A 2AN9A 4LHWA 3WHLA 5EE1A 2CL0X 1JQJC 4V0OA 4BZQA 4PHHA 1G21E 1G7SA 1YZQA 3CRVA 1OFUX 4DHEA 3G82C 2GXQA 3PUZA 1ZNWA 2DCUA 3X2SA 3QVVA 1LS6A 2KB0A 1OYWA 4FWTA 4JYBA 4EPVA 2HEIA 3RS2A 2OLKA 4RKEA 3WBJA 4L5BA 1G17A 5CB8A 3WNDA 5K8LA 3IBYA 2EQBA 3QKSA 1N0UA 2WICA 2N42A 1G6HA 3T34A 5HZKA 1BKDR 1TL7C 5L3QB 4PQYA 4QGGA 4RZ2A 2ZRFA 1RJ9A 2H18A 3A4NA 2QQEA 3IKJA 4B2IA 3QEOA 2F1HA 4NCHA 2ZE8A 2Q3HA 1SXJC 1CR0A 1XB2A 1IY2A 4LHZA 3BORA 4Q1CA 5J5CA 1QHXA 1ZINA 4C3ZA 4IXNA 4RD2A 1SKYB 2AK2A 3TUJC 1DELA 1Q20A 3W5JA 2FE4A 1NRJB 4NCJA 2QSYA 1EG7A 1KO4A 1YR9A 4PPNA 5JRJA 2VHQA 2ODWA 1XTIA 4OK3A 4JLKA 1HT1E 3EG5A 2JIZD 4LYAA 1OLOA 3PITA 4UNRA 4U00A 3GLFE 3CBQA 1NY6A 3GMTA 1KKMA 2O0KA 1Z63A 2PEZA 1GOTA 1T8UA 3RS7A 1HURA 3AVOA 3EPLA 3B9QA 3UK6A 1S96A 1XTKA 3MD0A 1FPMA 1D5CA 1VYVA 2ZI5A 3CRW1 2VSOA 1IJEA 3OEHD 4IOKA 2VIIA 4EKDA 1KK3A 3VHXA 3LVRE 4HAWA 1BMFA 1SXJD 2ZSFA 4Q9LA 3G0HA 1RFLA 2WV9A 5DE3A 3QXCA 3FOZA 2QPAA 1S3GA 4RD0A 5EXTA 4MRRA 4S35A 1P9NA 3AUYA 3I1FA 2ZI3A 3R20A 3C7KA 2VBCA 4DLRA 4A9AA 1JBKA 1TUIA 5KDDA 3SYLA 3BB1A 4TLCA 1J99A 2WJHA 3UKDA 4ACAA 1TF7A 2XX3A 4B33A 3WXMA 5CITA 2W0SA 3RYTC 2C77A 4Q1EA 3VFDA 5HCIA 2O5VA 1E98A 3K8YA 2QUZA 4Q4JB 4DT1B 3SBEA 2YHSA 3P27A 2IYVA 5C1BA 2FFBA 3OAAA 3UXMA 1KJZA 2ANBA 5TDHA 1CEEA 2IXFA 1Q12A 4PXAA 2ZM5A 2FV8A 4EUNA 3HU2A 4NCNA 4BZXA 1TADA 1OHHA 2EFEB 2XZOA 5EP3A 1KDOA 1E2PA 2A9KA 4HI0E 3S1AB 3ONWA 5C4MA 3THXA 1Z3IX 4TYWA 4V0ME 5FTJA 4H1UA 5KUTA 3FHCB 4OI0A 1ZIPA 4NTZA 2HCJB 4GL2A 2ZJBA 1CJMA 3BERA 2WHXA 1E94E 2AKAB 2QSZA 4E5UA 4W9MC 1CF4A 2C5LA 4QGFA 5LDDC 2H92A 1AS3A 2FDCA 2KE5A 2QORA 4QRHA 4R98A 4G01B 1EX7A 2VP5A 1GRQA 4D0LB 1Y3AA 1ZMXA 3B1YA 1DOAA 5BW8A 5KU1A 4P4SA 3O8CA 1P7CA 4M1MA 4FXPA 1H8HD 2O52A 3P4XA 4AG5A 5EP4A 1CXZA 4AI6A 2JLSA 3EIHA 1CULC 3PENA 3GEEA 2C9YA 1GP2A 1E2KA 2P6NA 1WXQA 3QXJA 2OG2A 4Q1AA 3ZVMA 4ZDKA 3LXXA 4PQRA 4M1TA 4I1VA 4HZIA 2IS4A 1TX4B 1W36B 1HYQA 1D2MA 1GKIA 1NBME 2IS2A 1E2IA 1OH7A 2QN6A 2EU8A 3NDPA 5SZKB 3DOFA 2R2AA 1M7HA 1ZM9A 1J8MF 3WY9A 4WBSA 2ONJA 5KYKA 4QBIA 1E9AA 4FWIB 4UJ5A 3EPKA 3OIWA 3ZLJA 4B73A 4FMDF 3ZQJA 5EJEA 2OESA 2IUSA 2JLUA 1R10A 3HDTA 1DADA 4GNKA 2LWIA 4BUJA 5L8VA 1U94A 1FZQA 4OK5A 1J90A 2FWRA 3A1TA 2QM8A 2B7BA 2P65A 2NO0A 1F48A 2UVQA 4LRWA 4A6PA 2J0QA 1XXHA 1GG2A 2IUTA 2G83A 3T5GA 2GAAA 5FBVB 3BIFA 4QM7A 3FMOB 3X1WA 1E69A 1YU9A 3V9PA 3AVTA 1HV8A 3SYNA 1XMIA 3L43A 4RFSA 2WJGA 3VHLB 3W5IA 4C0JA 1DPFA 3AGPA 4JBXA 4HLUC 1SULA 4BECA 4LYFA 4TL8A 4URYR 4A8JC 4C0AC 5SZHB 3GLGE 1II0A 3AF4A 1XJQA 4YMSA 3GFTA 3AP3A 4JIMA 1NMXA 1AZTA 3VU9A 2XAUA 1RJ9B 3CNLA 4HUTA 3SC3A 3GLHB 5L3QA 2EWWA 1R4AA 4NYJR 5FL7D 3I8XA 2QGZA 3BFKA 4LV8B 4DCSA 2OILA 2J5XA 4OJKA 4PZZA 4L9WA 2QTVB 1P2UA 3U44A 2BKUA 1G7RA 3C14C 2WPDA 3C5CA 2KSQA 3EASA 3MWLA 4GSYA 1N6LA 4XVRA 1XPRA 3SQXA 1E9RA 5KSPA 4PX9A 2V54A 1S0UA 4HAYA 4TYYA 4PC1A 1NVVR 2C96A 2QAGB 4IDOA 2WMOB 2CMKA 3GEIA 4JT2A 2E1RA 4AKHA 2R62A 2G3YA 3LLMA 1NG9A 4DLVA 3N5CA 3TNFA 4BRUA 5AJZA 1IN8A 5KDLA 3CF0A 3VX4A 2W2XA 1WQ1R 1OIXA 4TYQA 2YC4C 3U3MA 3EXAA 1F2TA 4A82A 3RAPR 1QDEA 1OV4A 3ZS8A 1L8QA 1EWRA 1D9XA 2B21A 2FA9A 1XP8A 4OI4A 4A8JB 1IXRC 1YZNA 5G40A 5CK4A 2ZI7A 2A5DA 3AVPA 1N25A 4PHTA 2E87A 1FUKA 4I1OA 3SFVA 2F55A 1Z0DA 3BB3A 4UXHA 1IN6A 2XZLA 5JRZA 4NL4H 3QBVA 1E0KA 3I61A 3RNLA 5GADl 1E2HA 2RCNA 3C4JA 1K5GA 4M1SA 3O8DA 1SVOA 2AKYA 2ZRKA 4ZI2A 4QGHA 2ZR9A 1N3BA 4IOMA 1FUUA 4D25A 3RC3A 1K8RA 1KSJA 5FTKA 3BH7A 2WJVA 3RANA 1D8TA 2IBMA 2QAGC 1P5ZB 1OFIA 1P62B 2NTYC 2VL7A 2W6JA 3W8NA 4UXJA 3EW9A 1G8FA 2ZUDA 4LYJA 1G291 1DAIA 1HT2E 2ZSDA 4ON9A 1XCGB 1TQ4A 3ICEA 1SQ5A 4JBYA 5JSZA 1HH4A 1MO6A 2PX0A 2W6JD 1F5NA 2GK6A 2VA8A 3AF3A 3BOSA 3GJ7A 3WRXC 2JEOA 4OKSA 3LO5A 3SJBA 1M7BA 2ZVPX 4US2R 1NJFA 2YWFA 4ZIRB 2ZJZA 2ORIA 4LGMA 4P4UA 4EPXA 4K46A 3TBKA 2AD5A 4KBGA 4QHSA 4WZAE 1FNNA 3E5HA 3ECCA 4AC9A 5IHPA 4ZDWA 3C16C 1Z6XA 1NMYA 2LCFA 3Q7QA 1Z83A 1IHUA 4O25A 3WYGA 1TUEA 2QROA 3N2IA 1Z6YA 4RZXA 4ESVA 1NJGA 4XSHA 3UMSA 3FKQA 1WE2A 3K9GA 3B1WA 5AJXA 3RWOA 1ZCAA 4B3XA 1RRPA 1VHLA 1Q3TA 2FFQA 4CRWB 3W6OA 3QPVA 1WP9A 2QENA 2VP2A 5DI9A 3TQFA 4NYMQ 2GBLA 2RHMA 4D6PA 3EX7C 4GPTA 2IYSA 1Z28A 2V55B 4PC2A 1Q22A 1E0SA 1W36D 1JJVA 3F0TA 1CJTC 1FMJA 4LZZA 4S2EA 1E2GA 1TQ6A 1A2BA 5BYJA 1KNQA 2GDJA 2QPTA 2D62A 4TWZA 2XSZA 2A5FA 4D4JA 4DIEA 1VMAA 3QSYA 2R44A 4KCGA 2RGEA 2ZRJA 4AKIA 4LJ4A 2ORVA 5K8UA 2AHOA 2DHRA 3ND8A 1JEEA 1TEVA 3QPWA 3NBXX 3IHWA 5FR2A 1E9EA 2IXGA 1XJ0A 2WOJA 3R9IA 2R6CA 1CJVC 3ASZA 4NZYA 5CDFE 4LV5B 5FH9A 2IX3A 3ND9A 5E7JA 1KAOA 3UMRA 1T3SA 3L8YA 2GEDA 2LKCA 2J45A 2ZJOA 3LH5A 2A5GA 3P26A 2JASA 5FL7A 1N0VC 1MT0A 1JXMA 5JHGB 1W48A 3FFBA 3IBGA 5DIFA 4Q7KA 5C4GB 3VR5A 2R6FA 3ADKA 1E2EA 5JLJA 1ZRHA 2XTNA 4LI0A 3W3AA 2FH5B 4TT3D 4BQSA 3QXHA 3ZDQA 2NQ2C 5FTLA 2RMKA 3EARA 4U5XA 3T1QA 1U8YA 1OIVA 1YRBA 1PJRA 1DO2A 1JJ7A 2ERXA 1OE0A 2W6IA 4I81A 4WXPA 3SNHA 4A0HA 1X86B 2H5EA 3MMPA 2A5JA 3NXSA 4DLXA 3HPQA 1UBEA 4FD2A 5CIWA 1XTJA 2FU5C 4RD1A 1Z0KA 4ZDIA 1OXVA 3CR8A 4JLAA 1XD2A 3WP1B 2BBOA 2PZGA 2IYWA 1XTQA 2UZ3A 2BMEA 1C4OA 3EIQA 3SEAA 1E79D 5KDOA 2EFHB 2GF9A 1L4UA 2IEYA 2VLIA 3D8BA 4MYTA 3KXLA 3P32A 4WOPA 4TL7A 3EZ2A 1GILA 4ITRC 4G5QA 4JLVA 2HV8A 4L4UA 2FEMA 2BWJA 1P61B 2J0SA 3QKRB 2ZUCA 3BC1A 3OE7A 2VRWA 3HR8A 521PA 1LY1A 5DISB 4BFXA 3LBIA 4MGYR 4TQUS 2GCPA 5DI3B 4C0BA 2IYXA 4Q01A 2OXRA 1IJFA 2A30A 3ADDA 2X2FA 4DLYA 4HAZA 3H2YA 2DWPA 1ZM7A 4NDZA 1DARA 4IXMA 4DIDA 2WSSD 2ZPTX 3U7GA 3AVQA 3RS4A 5CIQA 2SHKA 1T5LA 3BK7A 4BFYA 1ZYUA 1FX0A 2YJTD 1JPNA 1ZVQA 3NHAA 2F3TA 1G5RA 4DEYA 3K70D 5E7IA 5JJIA 1KDRA 1QF9A 2EFCB 4UJ3A 1TQDA 4JJKA 1JI0A 1G6OA 2V7QA 4XTRA 1KK2A 2YOGA 4ILEA 4KYUA 4CVNA 1GIAA 1VYUA 3MJRA 4TLDA 5FPKA 2CL6X 2O8CA 2J0UA 1L7VC 4V03A 2O0JA 4RD6A 5ANRB 2CCGA 2GA8A 1VDZA 1Q21A 2BHRA 2H16A 2RGNA 4L16A 4MRVA 5SZJA 1WF3A 1KMQA 4C0KA 2PX3A 1COWA 2WAXA 2R6GA 2CBZA 3VU9B 3VAAA 4P4TA 2FOLA 3HR7A 4XWAA 5J4LA 3PUYA 1VECA 5AK0A 3H1TA 3LY5A 2PZEA 3KUDA 4JSTA 4ZIRA 4N3NA 2ZS7A 5J40A 1EFCA 4EAQA 4AY2A 1NBMA 2OCBA 1U90A 3IUYA 2QMOA 2C8VA 1KZGB 2IS6A 4P32A 1RRGA 4GRAA 4ZCLA 2BC9A 3M4YA 2EFGA 3A36A 2QT0A 3R9XA 1E2DA 5AUPB 4DDWA 2J0UB 2W0MA 4Q5IA 721PA 5IT5A 4LJAA 4QKQA 2A7QA 3OEEA 4LDJA 4U02A 3EC2A 3SJCA 4XH9B 4HYYA 4BGDA 1Y63A 4WW0A 2QY9A 4EPRA 3OHMA 1K6MA 2ZRLA 3I32A 1SVSA 3K70C 1U81A 3A1WA 2ZSAA 1HEIA 5DGXA 1NP6A 3PR1A 2C98A 1XXHE 3EA0A 3KUCA 4YMUA 3SHWA 2C9CA 4OQXA 1QVRA 3L0PA 4DDUA 1MH1A 4XWOA 4CEHB 3QPUA 2F43A 1II8A 5DN6A 1ZIOA 3LNCA 3KKOA 1G8PA 3GLGB 3DMNA 3I62A 5AUOB 1CRPA 1KMHA 1VTKA 1M6NA 1VIYA 1FL9A 2GVDC 4B3CA 1S9HA 5F98A 1KSHA 1CR2A 3L0SA 4BLPA 2A3RA 621PA 4KSBA 1B0UA 1AGPA 2J41A 3GLGA 1MABB 3GLIA 2UZIR 1XFAA 2BEJA 2JA1A 3OFND 2ZIAA 4CT4B 2ODBA 4M1OA 3AF1A 2JATA 1ZM4A 3MWJA 2ZS8A 4G5GA 4IRUB 3RWMB 4DDTA 4TMWA 4WA7A 2WZQA 2C03A 5HTKA 1TAGA 2JLRA 2PCLA 3P20A 3W90A 5CLLA 5B57C 2JLZA 3QY0A 2NMVA 1G4UR 1W0JD 2VTKA 4X8OA 2XB4A 2H1LA 2OAQ1 4OQNA 1QHGA 3K0CC 1JALA 1G8GA 1OSNA 1BOFA 2CDNA 2RKOA 2FPKA 1E0AA 1QBKC 2HF9A 3OEED 4MH0R 4G5SA 4GBMA 1W1WA 3MG9A 1NN1A 3KDSE 4RFSB 3UWOA 1WBBA 5CJPA 3AVUA 4KYIB 3DOEA 4DKXA 1IXSB 3JZMA 4HATA 3B13B 1RPZA 2WKQA 3MFYA 3K09C 2DB3A 4G3XA 3EZ6A 3C15C 5FUWA 3SU8A 4CEIB 3EA5A 1IQPA 2A2ZA 3LX8A 1PUJA 1ZM2A 4MGZR 4RD3A 2D7CA 5AWFC 3T1VA 4NHOA 1I2MA 1N5IA 3B82A 2P5SA 1U9IC 4JVSB 2FJUA 3PIRA 3KQLA 3K1JA 2OEPA 4AYTA 3QI2A 3U2QA 3NBYC 3U4QB 1N5KA 4NYIQ 3R8CA 4NONA 2PLRA 4Y0VA 4BLRA 1XEWY 2CLDX 3SJZA 3BRWD 4KFRA 2NPFA 3LAWA 3VR4A 3W34A 3HP1A 2BDTA 2W58A 5JZVA 3MSXA 3QKTA 3DMDA 4B43A 4MRPA 5E3HA 1Q1ZA 1R7RA 4N0EA 2O8DB 1Z8FA 3T1OA 4C0HA 1E4VA 1RVDA 3B78A 2ZI4A 1CJUC 3RSLA 2VO1A 5EE0A 2HLDA 1NY5A 1ZD1A 4R9UC 2VH5R 1GNPA 4JSYA 4Q19A 2IEZA 4QJ5A 4Q9HA 4LK2A 5H68A 3K9LA 1YZUA 3EZ9A 4HB2A 3DM9B 1ZAKA 2OBMA 2AD1A 1GRRA 1LW7A 1JXOA 2BJVA 2NO6A 4ABYA 2N46A 3EWAA 4DSNA 3T1TA 1CJKC 1RZ3A 2GZAA 2F1IA 4DLSA 3RRZA 1XEWX 4MA4A 4QGAA 1W4AA 2MMGA 1E9FA 3L82B 4FINA 1MR3F 2HF8A 2CNWD 2ZRDA 4YDHB 4MGKR 4W5JA 1FP6A 1OFTA 4IVQA 4AK9A 1W36C 2GNOA 2OCPA 2QMHA 2IYUA 2V6JA 1XNJA 3ZVNA 1G7TA 1UADA 3CF6R 4LX0A 4BLSA 3GJ3A 4HLUA 3T35A 3BGWA 4Q7JB 1US8B 4DBLC 3B85A 1G1MA 3WMFA 1YZTA 4QJ4A 1W47A 4MKFA 5EP2A 2ZANA 5FPSA 1AKYA 2X8AA 2YVUA 1NLFA 2CK3A 3VMFA 2FPMA 1UDXA 5FI1B 5FOSA 1AS2A 4Q4HA 2YC2C 2IYZA 4B74A 1TF5A 1KDTA 4O2RA 4Q4LA 3KJIA 3KJEA 4B2LA 4FIDA 2DFTA 3BH0A 1T3LA 2BMFA 4QBHA 2IYTA 2RGCA 5IDVA 4OHZA 3THXB 2J59A 2XJ4A 4DZZA 1KJYA 3ZD7A 4AIIA 2IHBA 2G6BA 3I5XA 5A5GA 1UFQA 1XXHB 1L4YA 4N1AA 1T3HA 4D82A 3AKYA 5TY0A 1II8B 2JDID 2CJWB 2QMUA 2ZTSA 3WYAA 4X8MA 2WWWA 4HLDA 5GVSA 4NH0A 4FI3C 4B44A 3CO5A 4PAMA 1W5TA 1J8YF 1KMHB 3KFVA 4B6FA 3IQXA 4Z8YA 1OKKD 2GESA 1LF0A 3B8HA 3SZRA 3LX5A 1R0XA 3ZQ6A 2UKDA 2ZYWX 4XWKA 5BN4A 2H8KA 5CYOA 2D74A 1ZNXA 1Q57A 2D2FA 4HLCA 1P9WA 1EESA 2GEVA 4Z8XA 5TXGA 1KAGA 1LS1A 4EQ6B 3L0OA 1EFRD 1UJ2A 3TSZA 1AGRA 1P9RA 5DYIA 2IC5A 3H84A 3KB1A 4M22A 1IN7A 4PPFA 1HE1C 2IHYA 2B8WA 3LBNA 2VHUA 4QG7A 2CXXA 5FOVA 3KQNA 2G1KA 2ZE6A 2XTMA 2NGRA 4PSVA 2VYFA 2FZLA 3A8TA 1VIAA 3NHBA 5GVRA 1XEXA 4IDQA 3GJ6A 4AYWA 3M6AA 2QA5A 2CHGA 4TYPA 4XIGS 4C9BA 4GDFA 4MKIA 1DAKA 2OM2A 1A5TA 3K0AA 4MYCA 5EE5B 4ZKEA 4OBEA 1KNXA 2OCYC 4TT3A 3RVBA 1P6XA 2O8FA 3BS4A 1KJWA 4M8NE 2YNMA 3J81k 1ZU5A 3ZVRA 4NYMR 3QOFA 4TMTA 1W5SA 1O3YA 2BOVA 3R9WA 4EPTA 2JJ2A 5A0FA 2BMDA 2CEAA 1RIFA
chains in the Genus database with same CATH superfamily
4URFA 4EI8A 4BX8A 2GJ4A 5LWQA 4GAEA 1ZIDA 2EERA 2QJFA 3CZ9A 4H3KB 4BNVA 5F12A 3MERA 4ZV7A 3N58A 5IW8A 4H18A 1CQPA 2ZB2A 1KEPA 1OAKA 2QAIA 1HLGA 2NX2A 2VP6A 3BCHA 1CP2A 1E1QA 2OLJA 4G24A 4WNAB 4IFBA 3AUSA 4GXTA 2C2YA 1PFGA 2DQ4A 1GQQA 3CT4A 1AKUA 1V7CA 3B2EA 1Z7GA 5CU7A 5LYJB 1H2WA 1T5SA 1YDMA 4NKRA 3OPYA 3F5SA 4ZU6X 3NHYA 4RULA 1MNQA 2VPYA 2E6KA 2HNKA 3AETB 3CKMA 1L5KA 2DPMA 2DWQA 1OGJA 3O4RA 1EUDB 2CW5A 2NXEA 1AU9A 1FSGA 4F1WA 2VBFA 3ERCA 1QV7A 3H6HA 4CUJA 3WBFA 1OBFO 1DT5A 3KTAA 2VT6A 2AFIA 1U11A 1QFSA 3VC7A 1NF9A 3IMFA 4KVFA 5G4LA 4C7JA 1OWLA 5KSYA 1SIUA 2B83A 3JWGA 1HTTA 2P4SA 3EQ2A 2NZVG 1O7JA 4P80A 3WLTA 1BIFA 2G9UA 2XBLA 3PEEA 1TGVA 4C6SA 6ABPA 2QX4A 2AOUB 2FUG6 5ARCA 2ZDQA 1AIPA 4LC0A 4B6SA 5FTKA 3C41J 3QBTA 4JJZA 4B7AA 5KEIA 3ORSA 3TH5A 2IQ5A 4CFSA 2NADA 4I5EA 1BMTA 1T8TA 3WBKA 3CNBA 3PJEA 1NE2A 2EEZA 1M8GA 2OCLA 3IJPA 3DG9A 3L6RA 5KVSA 3K70B 1V35A 3Q5EA 2F1RA 3HFRA 2OB1A 1NJ8A 3ODGA 1XEFA 4QNMA 3TZKA 4E3ZA 2WHYA 4PR0A 3GJ8A 3GN2A 2FRXA 4AF8A 1ICIA 3C3PA 2E7ZA 4Q6BA 1QFJA 2P0AA 2F7SA 2GILA 1PG2A 4C6HA 3A31A 2O8DA 2ZWOA 1N6RA 4PZUA 2QX6A 1A1SA 2RH8A 2Z04A 4ZAYA 4L51A 5GJCA 4R9RA 5F23A 3OPYB 3NETA 4IO0A 2FMTA 2V98A 3EGDA 1AHIA 4GMKA 4YMVA 3K09A 1C9NA 2ZRBA 3RHFA 1U0TA 5E6SA 1W93A 2RBGA 2B5VA 1U5CA 3K3PA 3LRXA 4FFBB 1DRUA 1PNTA 3SIRA 1FNDA 4W1PA 3SQNA 2YJ4A 1XJCA 4XIJA 1RCTE 4LF7B 1ONPA 1OIWA 3CCBA 3HI6A 4JB8A 3U62A 1HE8B 1QDLB 5B55A 2I91A 3QQ5A 2JJ8A 4ZZ2A 4CETA 1XF9A 5ALQA 2PRYA 3H9UA 4ND6A 4Z9AA 1VHJA 4Q1DA 4DG9A 1K9SA 1U3TA 1P39A 5E7MA 5JSZB 4D2IA 1OA1A 1QG4A 2YINC 3U7QA 4YT2A 2CSUA 2DKFA 3U7FB 4D79A 4BO0A 2H1OA 1BDJA 5F1OA 3T3MB 3V8QA 2FEKA 1O2DA 3GBSA 3VUEA 3EG9B 4ZAFA 3LT2A 4YRLA 1C1YA 1F0YA 1HYEA 3H7IA 1HFJA 3INGA 4L07A 5IFKA 1B6RA 2Y9MB 5IKEA 2I80A 2PMWB 1TLLA 3GJYA 4R8SA 4XR4A 3AHGA 4OBBA 3GLQA 1Z9BA 3GQBB 2IWHA 1YRAA 1GPJA 1KK1A 1YBFA 3D5TA 3NVAA 4DA4A 4F04A 4JKYA 1YQEA 4XGRA 2Z83A 3L8EA 3W77A 1U1GA 3VH4A 4TTRA 1EE2A 3EMVA 1P1HA 2VVTA 1GDDA 3AZPA 3Q85A 4GKAA 3UHAA 3UUGA 4N01A 3WZLA 2VPPA 3EFOA 2HAEA 4V0NA 2W2MA 2GCOB 3E82A 3GRKA 2HMYB 2GPBA 1TE2A 2WF9A 3DYIA 3V55A 1OH8A 1MABA 1BWPA 3U1VA 2PXCA 4L5IA 3O82A 1M6YA 4XUEA 4EH1A 3SVZA 5COAA 4HN2A 5CM2Z 4B79A 4F3NA 4EG1A 4F11A 4A15A 2F4NA 4WZBE 3S2GA 4YTEA 2VRNA 3R5JA 4JFAA 5G3YA 3FTPA 1SK9A 4C2UA 3AM3A 4JGBA 5DHAA 1QGOA 4D4KA 1H4SA 2I71A 4R1TA 1JHQA 4S0ZA 1P4AA 1ZCBA 2AFIE 3UB4A 1AKVA 3JQRA 4CMKA 1UIRA 2MSEB 3CLRD 3HYNA 5KJ1A 3WQHA 1KZ1A 1R0LA 1RLIA 2YJNA 5TT0A 1U1CA 3I5MA 5A5FA 5JS8A 3OZEA 4JV5B 2BBSA 2H5JA 4N8SA 5EE3A 3MELA 3J7AC 4MHTA 3IXMA 3OIUA 3VR4D 1D1SA 2Z98A 3V42A 3IAUA 2WJ6A 3GW8A 1XBTA 1Q14A 1RAFA 3MTEA 3WHKA 2FJPA 5AW3A 3KCQA 4LNUB 1FS4A 2FZEA 4XXHA 1PNRA 3FUTA 4IX9A 3UMMA 2PKYX 4H6PA 1NW4A 3VKGA 2P2LA 2NSDA 1VPEA 4H2DA 4RHCA 4RZHA 2JFHA 1J2JA 3GUVA 5G0UA 3OKAA 4QLOA 3K9HA 3N1UA 3SEQA 1XFDA 2OBLA 1XTBA 2A88A 3IQGX 3ICPA 1LJ8A 3G49A 5ERGB 5JYBA 4MJ3A 1CZNA 1E1RD 2OZKA 4J8PA 5DWVA 1RXYA 4FBLA 1IHXA 3DLPX 4OX9B 2ZZKA 2WKRA 1CDDA 5K0NA 4B4WA 5J2UA 4ZALA 5AJWA 1L5SA 1SHZA 5FUXA 1TM5E 4EUFA 3AERB 2V1XA 4GEKA 4LXHA 2XVAA 4YMIA 1YDHA 3R40A 4GM1A 3BXFA 5ELLA 2FN4A 2W7TA 4B76A 1VLMA 1XRJA 3LDUA 4PZCA 3KB2A 5IUJC 2FPGA 3V1NA 3PUKA 3IBSA 3TKLA 4I19A 5IJWA 1SO8A 4REOA 4CBVA 3D6HA 1NQAO 4G23A 3SS7X 5C1PA 3OD5A 1XA3A 2HYDA 5I01A 5F9HA 4QLAA 2PSHA 2XIQA 3FI9A 4HXGA 2WSSA 5TB5A 1LTQA 3ZV3A 2PUAA 3QG1A 4K9RA 3GLIE 3CG0A 1ZH2A 2ZTVA 3MTBA 5BOSB 4LISA 2GWHA 4LCBA 4R6WA 2G17A 4BZWA 4C07A 1X1SA 2AL7A 2HBZA 5DP1A 4ESHA 4OCZA 4N0QA 4WK4B 4WOJA 4IDPA 1E7WA 2PL9A 2RCYA 2W2QA 3DTVB 1Y3DE 3CUVA 1YDEA 1UBHS 4D7AA 4EELA 2YWXA 2DEUA 3HWRA 4CN8A 1T35A 4PYKA 4QODA 3GGGA 3I2IA 1DBWA 4KLZA 3RVSA 3VV2A 4B75A 1QV6A 2FZCA 3ZIAD 6REQB 3IE2A 3DF7A 1I9CA 3B1ZA 4F84A 1JMYA 3NNDA 2W2TA 2XWBF 3LMKA 4UBIA 2B4YA 3LDAA 5IS2A 2VHXA 1G0OA 3E23A 2Y0EA 5DHRA 3ABRB 3NGMA 5TEVA 2W70A 4RTLA 3VZQA 1A9QA 3A1SA 5ETJA 1HL7A 1NFRA 1I4WA 3AHEA 1TFRA 3AR9A 1T9CA 1KYTA 4CU2A 5K03A 3U31A 3KE8A 4NEHB 2O8FB 4RJTA 2WV7A 5JO9A 2QG6A 4BKRA 1P7YA 3GEPA 4TMVA 3TLEA 5JDIC 5EZ5A 3NBFA 5BSUA 1QS0B 4B9AA 1A9XA 1GGNA 1Q1BA 4IDNA 4ZODA 4IGFA 1JLLB 3TK1A 1SA0B 4KGZA 4FCWA 5A4KA 2B5WA 2BZSA 4MEJA 4BE7B 2G88A 2DWOA 3FDJA 1JIVA 1SUIA 3KJHA 3KKNA 1A9XB 3R09A 2ZT8A 4M0PA 2WQ6A 1C0IA 3W1WA 4FQ5A 4PWYA 2WYVA 2CVQA 1B23P 4UTOA 3RT7A 5ICCA 4O4LA 1XN1A 1DG3A 5ALNA 2JJYA 4ZC1A 2HU8A 5ILGA 4EEZA 1XTSA 3N59A 3TE7A 1Y9ZA 5ICFA 1LI7A 4P58A 1CYDA 5HNKA 1W6UA 1NBMD 3FFAA 1DOZA 3D6AA 2VF7A 2HJGA 4S3MA 1LDMA 3OOWA 3O8BA 3QVWA 2BFDA 2P7HA 2P7IA 1PYGA 5TGTA 5AK4A 3T94A 2JH9A 2DHCA 4FOLA 1CZLA 4R3WA 2OCAA 5IFLA 2BH2A 3K6JA 5AESA 1G0NA 2DG2A 2GRJA 4FMCB 5BR1A 1N3LA 1C4XA 1RXEA 4CFYA 3WWZA 2L69A 3WFJA 2XYVA 5I9NA 4J16A 5C8YF 4J7XA 3J81A 3GMDA 2BMJA 1GGVA 4KWCA 2PX5A 2KBFA 2GK3A 4TSFA 1L8LA 2WMYA 3E2PA 3PC8A 2RGGA 1KEVA 3R0VA 3BK2A 1QGUB 4IIUA 2Q9CA 1KDVA 1Z0SA 4OJTA 3SE0A 5JATA 5FHQA 3WNCA 1AA9A 2IIVA 1E7RA 1ZNZA 3OE1A 4RSMA 5JWHA 1SHKA 5LL6P 4NOLA 3ZGXA 3ZIAA 3CX3A 2PH5A 1TCUA 1R0KA 3GZNA 3LKVA 4LMAA 3W2FA 5KHLB 1I6MA 3QI7A 5HF9A 3WLRA 3LC1O 4YQZA 1WTCA 1JEJA 2RH5A 1PX0A 1Y8QB 5EZQA 1TKAA 4LNAA 1RS0A 2P9ZA 2ZRPA 3TLZA 4X93A 1U8TA 3MGBA 4P36A 5BWMA 5E9AA 5CT4A 1LJUA 1RI4A 2X2OA 3CUTA 3I6YA 1G3MA 2ID9A 3KWFA 1Z5PA 3PX2A 121PA 1WPXA 3FMGA 5F5XA 3THOA 3WIOA 2YWEA 5IAKA 3HZHA 3CYFA 5CH8A 3HFJA 4PVDA 5ENZA 4A92A 4C0SA 2WD7A 1P7PA 3FPHA 4YJGB 1UBKS 4YJ3B 4DCCA 3PDHA 3AL0C 4OL0A 1JEQB 4DTCA 2JFPA 1B8PA 3HXPA 3U17A 1NHGA 4POOA 5B4TA 4GECA 4QFMA 1XD2B 3HCOA 1U7PA 5E4JA 3COPA 3RS8A 3P9IA 3RHZA 2FEPA 2BFDB 2GD2A 5JHHB 2ZAYA 2BBTA 3TF5A 4MLPA 4TZ6A 1DJLA 2IYQA 1DAGA 4GICA 3LSTA 3U56A 4YROA 4DA7A 4E7OA 4O2AB 4RMIA 4M0DA 4YDSA 5FLXA 1DRWA 1U4SA 4XYBA 3WGMA 1ZY2A 1RIIA 3CPJB 2C8KA 4BFZA 1ZW6A 2A1IA 2C2XA 4I55A 3T9BA 3ZTWA 4LZAA 1NJ1A 1AGXA 2EX1A 3LHSA 5K8VA 1V71A 2VZEA 2GA9A 4O2BF 3VV3A 2ZREA 3DGFC 3E0XA 3QE0A 3UA3A 5ADWA 2WTBA 1X42A 4R7ZA 1ZKDA 2Q99A 1G64A 1EU1A 1EGAA 2PMCA 1DUSA 1WP4A 5CFQA 4Y6OA 1VZ2A 1VPDA 4HB0A 1P4RA 1IOLA 3Q98A 4M8SA 4EECA 5I7OA 3KZKA 2D06A 2X0IA 4XYGA 1GSIA 1R8JA 3NEYA 4BNUA 4MLCA 5EJAA 2FSIA 1QIFA 3WK5A 1ZOPA 1QC5A 1BGXT 2I76A 3AVTA 1LXCA 1PS0A 2CVOA 4UHKA 3OCXA 2RB4A 3TRHA 3TBHA 4IV5A 4M46A 4CQLA 1OXTA 4WJLA 1XNHA 5F7ZA 2OYRA 5AMXA 2GVZC 3SKXA 4BNTA 4BTVA 1FTSA 5D8DA 3ZE0B 4DYHA 4KAAA 4WVFA 4OSPA 5IK2D 3GRVA 3M70A 4L85A 1V3TA 2JGFA 4EG7A 4XQ9A 1Y5RA 2DC1A 2H11A 4Q9JA 4X1KB 4WDQA 4UVEA 3P94A 4X7BA 1ZMTA 1MFZA 2NNLD 2P2SA 2C0CA 4IZHA 3ROXA 1QG2A 2BW0A 1IM5A 2J3EA 3CSSA 1Z4OA 2GJAA 1DIRA 4LOJA 2C9ZA 5KNBA 1B2RA 3RYHA 4YDQA 5FOUA 4ARIA 1RP1A 4IIJA 4KIFA 2ZJ2A 1VLZA 1Z6GA 2BEVB 2G28A 4WFKA 3TJZA 3WA7A 2X23A 3KKPA 4FE4A 5LMNB 3BRCA 4QIHA 5IASA 2I67A 3GCGA 3K70C 1CR4A 1SY7A 3B3QA 1MG0A 3GCWA 3W5CA 1LD3A 1EWYA 2CZQA 2F48A 2HLDD 1HQYE 2VSNA 4NJEA 4P2BA 1TD9A 3HHEA 3P2EA 4NE7A 2W4MA 3SKYA 1ZGCA 3VJMA 1ZSYA 4URWR 4DV6B 4D80A 4JVNA 4EW3A 4YRPA 3RTAA 3CX7A 3LZCA 3TTXA 5DW0A 2GWRA 3PQ4A 3U40A 3WJAA 2OCXA 1TD1A 1BVUA 1E92A 1XWWA 3F7NA 1VMDA 2JZOA 1MHPA 3BRWA 3PQ8A 4F8YA 2I9PA 1C30A 1RWOA 1R2QA 2W00A 1UFVA 4GI5A 3LOUA 1WBJB 3CH7A 2R3SA 3SLRA 3AEUB 5KOHB 2P3QA 4DM3A 3PVSA 5DM1A 1QC5B 2HHJA 1TTQB 4E46A 2YV4A 3LP6A 1ZU4A 2O06A 3H9EO 3K94A 3CW2A 3L7AA 3OOJA 4M54A 5IUKC 3WMRA 1EQAA 1U3GA 3LY7A 3USZA 3ZNOA 3P0EA 1ZBDA 3AJDA 2WNSA 3L8ZA 1ADCA 5CXQA 2IPAB 5JNUA 5F9MA 1DIGA 1WDTA 4OREX 4AUNA 1HBJA 4YB8A 4Y6QA 1SUDA 1UDAA 3ZKAA 3WRVA 3DV2A 1XU9A 1JIXA 2NTNA 4NOKA 1WQ4A 1DL5A 1V1RA 3IUQA 3N3BC 3QFHA 1WEKA 4FDAA 3R7WB 2QE7A 3WLNA 4Z1MD 5JXGA 3MXTA 3VKWA 1KFEB 3GJ4A 2F3QA 4OF4A 3A4IA 4LBVA 3A11A 1N2IA 4FPXA 1OROA 2NTVA 3I6IA 4H4CA 1Z6TA 4LYHA 2PE5A 1ZR4A 4HL6A 2KM1A 5LQSA 3TFWA 2H2FA 1NZFA 1R6VA 1HFWA 2C5GA 2WIKA 5JDIA 1R27A 4YMGA 3EWSA 2CWDA 4I36A 4FCCA 4IVPA 1Q19A 3FVRA 5HK8A 3RRYA 1PDOA 3KEQA 4RA6A 2O7RA 5BMVA 2QJTA 2AVNA 4DTIA 1B1CA 2X1VA 4IUCS 1E9DA 2GEUA 2WM9B 1P1IA 2EKDA 2H7CA 3H11A 2ZUEA 2IK8A 1GTSA 4KPEC 3WR5A 4LJ6A 1PZNA 1Z6ZA 1PV1A 2FW9A 4PRKA 4TL6A 1LLDA 1DFIA 2PZLA 4RPJA 5EEGA 5BT9A 4YPOA 2GCGA 1RPNA 1H2RS 2EVWX 1EBBA 1FDSA 1JS1X 2RG1A 3FPFA 3E3LA 3K16A 3QHAA 4PAOA 1SHJA 4ZREA 4OHXA 5F78A 2J0EA 1GTG1 1NVVQ 4PRYA 1OYYA 2WJIA 1NYTA 1T2UA 3AQ4A 3H6GA 3H8SA 1CG6A 1M76A 2E85A 1Y0BA 3K05A 3OJWA 4FYVA 4RHTA 4N5IX 4LQLA 4XD7A 3RABA 1DC5A 1U5BA 1U2RA 3DZ8A 4LHVA 1GSAA 3P9PA 3RVPA 4GKJB 3Q3CA 3A6DA 5FOTA 1PO7A 3CRMA 4K8OA 5CM9C 3T5BA 3F9IA 4PC7A 5AICA 1S9DA 3B7PA 4EGFA 2WWGA 4AJ9A 3IALA 2PLFA 3E53A 5CDTA 4GWGA 4OXKA 2D13A 4KQXA 3H2HA 3UMFA 3IJ5A 2IXTA 2W8ZA 4I1UA 4WSOA 3V00A 2YVKA 1W1UA 3HGQA 2V0CA 3CF2A 1Q11A 5HG0A 1R16A 4FX2A 1DTSA 4FN4A 3WLPA 1R64A 1UKYA 4HS4A 2AWNA 4OB7A 3EBOA 2PH7A 3NVDA 2WSBA 1BGVA 2CJXA 4WASA 2DQYA 1EM8A 2A0WA 3CUEF 3E2MA 4ZQBA 3QUSA 2GCIA 3E1SA 3IQEA 4H1VA 2VJBA 4RXUA 3RE1A 3S2YA 3WIDA 4ZOEA 5C9ZA 1GLNA 5MN4A 4WAUA 2WTAA 1K6JA 3DZIA 2WY2D 1ZHOA 1GCIA 1ODFA 1OXSC 3AF2A 3E7FA 1XT6A 3PHIA 3NZEA 4JXJA 3R7WA 3SKVA 3WSVA 4CIDA 2PO5A 5HQ3B 2PUBA 4EEKA 1EINA 4KWHA 4RO0A 3RU9A 2HA5A 1YR1A 2WSMA 1ZONA 3W8RA 3KLBA 4JKIA 4KRGA 4RTMA 1X1DA 2CE2X 4J94A 4HAVA 1EVIA 4DSAA 1XZQA 2JGAA 2O0MA 4HDCA 2J6HA 1KP9A 2Y77A 4M55A 4LYEA 1I13A 2H7VA 1X92A 2L2QA 2NV6A 3FYUC 1W0JA 1PHPA 4PYQA 4DLUA 2NM0A 1M5RA 4H7KA 3ZE1B 2IXEA 5BV2P 3PKZA 3DQQA 3C5HA 1RFGE 4DMFA 5BQ3A 3MAJA 5CCXA 4YCDA 2J4FA 1GFZA 1GPBA 3WLKX 3ESRA 2O2XA 2OGSA 1F06A 3PEUA 1M75A 4MXDA 4RZIA 2YWHA 1X9IA 4DCPA 5JJCA 2IYNA 3FJ1A 4TZKA 4IJUA 5IVHA 3KUUA 2R6AA 3N8HA 4NXNB 1PL0A 1UAYA 4ML3A 4CIXA 4ZYTA 2Z1DA 3V4RA 1QUFA 4Z54A 3O74A 4LRTB 4DFDA 3DNMA 3UPTA 1AO3A 4KRXA 4BGUA 2VEOA 2OUIA 4JFRA 2UVPA 1YB4A 4PAQA 3GJ0A 1Y1TA 1HE5A 4JLJA 1BHJA 2GN8A 2I65A 2J6CA 2ONKA 4NPAA 3G7UA 4A16A 4E4RA 3QKRA 2YFQA 4TQAA 5A9TA 4LMRA 2SNIE 4MVXA 2I2FA 2V5VA 1MZPA 2IPXA 1YQTA 1ENYA 1ZH0A 4NBWA 4NCIA 3DE3X 4QFBA 5JMTA 2SKEA 3OKPA 4WE3A 2KBEA 1Y8AA 1XZEA 4DMMA 4X6XA 1OT3A 3IO5A 3Q10A 2V5UA 2A78A 2CVPA 1P0FA 3BF8A 3OC6A 2KQUA 3CURA 5L6LB 2IHKA 1U99A 3B9PA 1QHHA 2OKCA 3FHJA 4ND3A 4LHEA 3CLUC 4AW9A 4WTOA 1Q0RA 2CDRA 1JDTA 1SQFA 4PY2A 5AJUA 5B3KA 2PUFA 3PXGA 1POWA 3ZR4B 3DAFA 4UTZA 4ZVUA 1UUFA 1ABEA 1XX6A 4CMCA 2CV1A 2O8BB 2ZT6A 3AI7A 3OC0A 1PV4A 3NGLA 4CLOA 2QE7D 1WUHS 3MQ4A 1OXMA 3C6ZA 3IEXA 4CMHA 1HE3A 2PLNA 3S5UA 1BW9A 1H9AA 1S1MA 2IDKA 4ID9A 2EV9A 2QLMA 4F38A 5I3ZA 1QX4A 2CGEA 2GSWA 2ZRIA 1M34E 2CXHA 3AHIA 4GR4A 5J2TF 4BQIA 1JYEA 3QVKA 1G21A 1UEJA 4OQFA 4DSTA 1UM9B 4K26A 3KOUA 1B42A 2ZETA 1YVDA 2NO1A 4BWYA 2R84A 4R1LA 1MZVA 1JHMA 3FMFA 4Q3AA 3HB1A 5CM8B 1AUQA 1WCWA 2IHNA 1UBJS 3B48A 5GINE 1BXGA 1JKMA 1II9A 5P21A 5G0VA 5A4JA 4G1MB 3SJ7A 1K3UB 5FWYA 4CL3A 3KTDA 1MW9X 1PU2A 5AI9A 1NQXA 3F2VA 2QTWB 3D2LA 5TQVA 2NU8B 2XXAA 2J3KA 1GARA 4ETMA 3NI2A 2FPIB 4K9SA 1USWA 2IT1A 3GGJA 2VZ8A 1Y7HA 2JK0A 2K6GA 1MO5A 4FTWA 1MP0A 1S8OA 1TKBA 3C3MA 5E6UB 5IBQA 3TLJA 4CMIA 3TOCA 1YSCA 4LDNA 3U3OA 3X1ZA 2PMEA 4Q1FA 4UCWA 2GSDA 3O8NA 5HEKA 1LBIA 1V11B 3FCXA 1YJ8A 5CTJA 2R97A 3NBZC 2X4IA 1GGJA 1AURA 2BEUB 2OFPA 1BRTA 5BYKA 4TL9A 1VQ1A 3DLIA 5E4YA 1FRZA 5DFAA 1X2EA 4IXTA 1Q44A 3N8IA 4DRZA 4TPKA 1P72A 2ASEA 2GHIA 2ZYDA 3D3JA 4EYGA 1YS7A 2DE0X 1OJ7A 1W87A 3F6YA 3QPCA 1H2XA 3KOZA 4MW0A 2Z4RA 4Q9IA 4MLZA 3ABOB 4KK4A 1PBTA 3KT6A 1S4QA 3ASUA 1RZVA 2GCOA 3ZZMA 2HJHA 3OPYI 4PAGA 3FTNA 1YXMA 3C8UA 4RQTA 5BN3A 4DV0B 2BTQA 3LQRA 3I0NA 4J03A 2HFJA 1UBLS 5KKNB 4Z7NB 2HPVA 3A58B 4P4GA 2IHZA 2RONA 5FBKA 2GXSA 2WM3A 3CEAA 3H97A 4X6UA 3V7NA 1NIPA 3NBUA 2I8CA 2WFZA 2WKPA 3EVDA 4PPQA 1OXBB 4EB6B 5K8TA 2OP0A 3AR8A 4FX5A 4P5EA 3GFRA 1NW9B 5HCUA 1ABBA 1KVQA 4BZPA 5CHYA 4M4SA 3R3YA 1X94A 3C7CB 3REQA 4YPVA 4WINA 2UVDA 3LY8A 4P0TA 3DBIA 4MQBA 4CU5A 1Z29A 3QYJA 1LDGA 4HEA6 4Q7EA 4Q9AA 3RW9A 4JBLA 1BH6A 1S01A 2JAWA 4LPKA 2WM2A 4ENUA 1AGNA 4RC9A 2ZYSA 1R3UA 2PJZA 3RAFC 1RM4A 4NMMA 2I2AA 3N2YA 1XPUA 3QXSA 1CBUA 4QNNA 2IPNA 2QRPA 4KI7A 4HPXB 4CM9A 4N76A 2P30A 2R79A 1JA9A 2EOAA 1DIOB 1G2OA 3S0JA 2I7CA 1EB9A 3OM0A 1NL3A 3M5PA 3V48A 3RSOA 4UM8B 1Z2DA 2MU1A 3LW7A 4KE7A 3W5VA 3ZWAA 3I64A 4HUQB 1RJWA 2ZR0A 5AT1A 3V9AA 5BYBA 1JV2B 2BFNA 2RAPA 1TTPB 3QKIA 3DJYA 1XEAA 4BVBA 3AVWA 3QPBA 1RQ7A 1AOXA 2DFKB 3I73A 3HCDA 1DAFA 3Q3GE 1S8NA 1YJXA 4IEFB 5F1KA 3T7RA 2WWXA 4D26A 4NMLA 3SZ3A 2UDPA 2WF6A 2ZJYA 3L5KA 1I4LD 4WPGA 4R8RA 5BUSA 1PFKA 1FYDA 3GFOA 4ZRDA 3PXAA 3HJCA 3T3NA 1Q1EA 2C92A 2H5LA 2C9BA 3GDFA 3I58A 1E0JA 4PAWA 2C5FA 5LLSA 3U81A 2UYHA 1GNSA 2G4VA 4QT4A 3RAGA 1T2DA 3ROPA 1RWWA 3DQZA 1QYCA 4H35A 3RPEA 4YFYA 4ZCTA 1NKSA 1T6YA 1RRMA 3IESA 1NVBA 4HH1A 1NVAA 2RHTA 4KEAA 3FKSD 4NBVA 1YDWA 1G20B 3QVGA 1CIPA 3R5HA 3OFVA 5EFZA 4A3SA 3VI3B 3VI4B 4MB2A 4ZV4A 5IF9A 5JY1A 3D3NA 1PUIA 2ZJ1A 2E82A 4G5YA 3W4KA 4BMDA 4Y9SA 5ELMA 3NCHA 5C5EA 3ORYA 4EHFA 6Q21A 1L7PA 5EIBC 4P3YA 1BHO1 1CQIB 1ESMA 2CDAA 2PCJA 3CTMA 4LTDA 3OTWA 3C8HA 3WLQA 3GLFB 5EKUA 2QQGA 4UOZA 4MK4A 1N7IA 3WDSA 3QEJA 5FBZA 2XNHA 3PDIB 4GI7A 3GLUA 4ND5A 2JJ1D 3BZBA 3EWIA 4E2XA 3BQ9A 4CIVA 1EFDN 5DBEX 2XB2A 5AH0A 5FNVB 13PKA 1UMDA 4KQKA 4NU8X 2BONA 4BU1A 2ZWMA 1MV5A 3R23A 4PCAA 5DNCA 1QQTA 2OAEA 1SWVA 2A1TS 1Z7EA 1ZN9A 3KOYA 4MKRA 3OEHA 3ZDZB 1K7SN 2OV6A 4OJNA 4EYQA 4L8FA 5BNTA 4YRNA 3ANNA 1OW3B 3TEFA 1XTPA 2JANA 1RDFA 4NNJA 3G2QA 1XRNA 3N2NA 3TW6A 3A4LA 3HCFA 3VVMA 1MKYA 3ZDFA 4FMPA 4C05A 1SOMA 1FMLA 1BX1A 5COBA 1MENA 2HT1A 3FNHA 3R5TA 2E18A 5DTEA 1KY2A 2EZ8A 5B1SA 3AQIA 3C1UA 1AMNA 1A0OA 1Q7TA 5AKHA 3QMMA 2HHCA 1RRFA 3ACDA 1XDGA 1PD0A 2WJWA 2XZPA 3LQFA 3VOBA 2Q0XA 5B64A 1V8PA 3DAOA 2JFXA 4UUMA 1C7EA 4CZ2A 4CXMA 3PX3A 2JLBA 1ULSA 4RLHA 4Z9XA 4HY3A 1KR5A 5AJHA 3TOVA 3WNBA 1IPFA 1RXIA 2YV1A 4KVAA 4EG5A 3N76A 5ITVA 3ACBA 3GF4A 2ZJ6A 4MLDA 4E1BA 1NW8A 2DYKA 2WPDD 4C6TB 1F8XA 3CUWA 1XCLA 3RS5A 4DQ0A 2OQIA 4F97A 5L7TA 1RKXA 4YALA 1SVWA 4XM0A 3THYB 4JLNA 3EDOA 4UEOA 3VR2A 4LXYA 3DPUA 4BFLA 3L49A 3SF8A 3TZLA 3DBRA 1UMBA 2FWJA 4GUAA 1M33A 4UPEA 4ZHSA 3FHTA 1S2MA 3OMLA 3TMYA 3C97A 3RHSA 4EI7A 4IJMA 1XZCA 1EFHA 1KXJA 2KJQA 3BXHA 4OHMA 4BV2A 3HKCA 1KIMA 4CEJB 1QPBA 1DX4A 2YJ5A 1IEVA 4B48A 5C7OO 3HYSA 1RYHA 3C6KA 4KBYA 1SHTX 1HOTA 4MI1A 5TVKA 4N6OA 2B8TA 3NHKA 4DWWA 2FMKA 1DHRA 4YUWA 3MWEA 4OMFG 4EQZA 3GGSA 2BFFB 1RLOA 1T5IA 1UWVA 1WB4A 2ZRCA 3T12A 4G4IA 3AFGA 4YO7A 4EA8A 3B2NA 5KVQA 4QUAA 4Y0AA 3ANSA 1XZDA 1U9CA 5EJ9A 1P2TA 2OP1A 3A1UA 4GM0A 4R54A 5HJ2A 2B4RO 3K1AB 3NG1A 3HPRA 5A71A 1OFVA 1TT5A 5ITWA 1W9MA 2UAGA 2VDVE 1RQPA 4R2HA 3MOGA 2HT6A 2TMKA 3WC4A 2QM0A 5K0GA 9ATCA 1TM1E 1R6XA 3L79A 3DL0A 3WGYA 2HW8A 4RIFA 1XNRB 4HGYA 1GL6A 1E5TA 4Z0HO 1QUEA 1YJ5A 2VXOA 2V7QD 2DRIA 1CWUA 4JL8A 4RUKA 3AR2A 3JD4A 4XDYA 5I7AA 4EGAA 5AKJA 2D8AA 1Y8QA 5KQMA 1YBMA 3NAZA 4RHYA 5AK6A 1GZVA 1P4JA 4C89A 1K5PA 1E7YA 4H9GA 2NU7A 3I0ZA 2AQHA 1EK2A 1T0IA 1XHEA 1KOLA 1YE8A 3MCVA 1RAHA 1J33A 3ONNA 4N9QA 3WS7A 3O90A 3U60B 4LTMA 3ICQB 1GVNB 1AQYA 1EQ2A 2IL1A 2B4QA 2QQ0A 3R5FA 1O54A 2CF5A 2JLAA 3RUAA 5JH7B 1USVA 5JC8A 2Q3FA 3W3ZB 5AUNB 1YQQA 4R9SA 2Y05A 3GUHA 4M1WA 5J9FA 3E18A 3EZFA 3C3WA 3U9TA 3ZHBA 1XLUA 3P1JA 1V8DA 2JFUA 3WLLA 3NTXA 3PRKE 3UWDA 4FFLA 4WA8A 4ETIA 2HU2A 4LS3A 4QOIA 4FHEA 4AXBA 3OE7D 4Q4HB 1Y42X 3F7TA 2DECA 3KEFA 2PIAA 3O0DA 4B3GA 1KQPA 1UDRA 5TNXA 2NV2B 2P91A 5FOXA 3I3SR 1WDLA 1ZD8A 1RMYA 3HH8A 4I1PA 4QYMA 1G5FA 4IL5A 4N3BA 5KTSA 4E70A 1OF1A 2A86A 2F8SA 2ICAA 4TV8F 3L0DA 3K1AA 4JLDA 2QAGA 2WUEA 1VRWA 1E3MA 1QF6A 4KP7A 5K9ZA 3WK6A 5LNK1 3DZCA 5CR9A 4B87A 2A8YA 1FTGA 4CHGA 1VSVA 2VNAA 3Q0EA 3FHLA 1GDHA 2C1EA 3TTWA 3CB4A 1Y9AA 2MYUA 1YVEI 5JPIA 4B45A 4D3YA 2DUMA 1WM1A 2R8EA 1ZWLA 2W2LD 1E3EA 1GNRA 3ANTA 3AHDA 4U0JA 3U7RA 2OPHA 1VPTA 2BJWA 2XWPA 4ZDJA 3U7EB 5DNDA 2OGUA 3GJZA 5D2CA 4GQAA 1VJRA 5AI8A 2REBA 4WESB 3KBOA 2WWVD 3SN6A 2GKGA 4UUQA 5H4HA 1UT6A 1ES9A 3C5VA 2DT5A 4DLTA 1H1LB 2QRZA 2QGNA 1AE1A 4F3YA 5JCOC 1B6GA 1HDEA 2B2XA 2AZDA 3MT9A 4GVPA 3ZI0A 1V7ZA 4M9ZA 5HR5A 2DPXA 1OUMA 1I1HA 1UXIA 1WKBA 4NP6A 3RODA 1SUWA 2HA2A 2E3JA 3ICWA 4O0MA 1L4GA 1JX6A 1D07A 1MB2A 3QF7A 1GL9B 3FMPB 5EZYA 2C04A 5FUVA 3RJMA 5BWLA 3FWYA 2ZYVX 1HYHA 1UP6A 3G02A 3HDQA 1CF9A 4WOBA 5TMEA 4BPRA 2Y1CA 1W0KD 1ZP6A 3T15A 2QTMA 4DT1A 5AQ1A 5G53C 3PX7A 3VNBA 3PUVA 4QTXA 3BA1A 3BFVA 1W85B 1VIMA 3D2AA 1ZK3A 3KV1A 5SY6A 2WFAA 3PNSA 1T26A 3V1YA 4YV2A 3EZLA 1K7FB 1DE0A 2B0CA 4B8ZA 1CUVA 5HUJA 5K01A 1FX0B 2YICA 2R1TB 4JZKA 3UAZA 5C8XA 2BM8A 1R4MB 3PNPA 1JR6A 2LNDA 4UOEA 2C1XA 1GU0A 1T2NA 3GP5A 2NSHA 3OCUA 3DD1A 4N6NA 3L1VA 4DL9A 1I1QB 3A26A 3GAMA 4KITB 4K1XA 1WMBA 2JFOA 3JRNA 2W5UA 3FCYA 3IBCA 3VZRA 1W4BA 1DT3A 1JSXA 1G6KA 2YXDA 3BGDA 3FZEA 3WTBA 5U9CA 5KYUA 3KJGA 2ZWVA 1U0SY 2P6UA 1M2WA 2IVFA 2EZ9A 4MUBA 3UAGA 3V6MA 4UAUA 3QUQA 3QG5A 3SOPA 5BSKA 3WFIA 5KTMA 5DK4A 3IIEA 3SG0A 4KN9S 4C04A 2ZPUA 2CXSA 4C7XA 1L9KA 1YIDA 2D54A 3LUBA 1Q2XA 5EXXA 1LVHA 1OXUA 4C30A 1L5WA 2VJKA 3OQOA 1WRBA 1ZHFA 2WVAA 1WMAA 1BD4A 2ON6A 3MMSA 3ND5A 1GAWA 3HVKA 4REMA 5JLAA 4JI1B 1RE0A 2R96A 3O9ZA 1IIBA 1S2DA 2FCAA 4JZYA 4MPRA 5DNYB 2R8BA 2AF4C 2ZAMA 3H11B 4D5EA 3CKKA 4RK6A 4EMTA 4OH1A 2Y9PB 2ZLBA 2FSFA 4MEBA 2V4UA 2VP3A 1L5FA 4AY4A 3NOVA 2H2DA 4CWAA 5IAEA 3W2EA 2PGAA 2PRJA 1FQJA 2C7QA 4Z0NA 1PFWA 4BBAA 2BHTA 5BWNA 5LU9A 3O2JA 5HYVA 4DYDA 3KLPX 3MZ0A 4MQFA 2REOA 3BH6A 4XIIA 3HO6A 2JVKA 3QJYA 4RD4A 3LU1A 4M0EA 2A1UB 4G89A 5F3RA 1XCOA 4CMAA 3ML1A 5HZMA 2GZSA 3LV8A 5JU6A 1QCZA 3RJ5A 5P8WA 4OQQA 4KUEA 3PEYA 4P08A 3RLIA 1A3CA 4W5HA 1ZXBA 3E7XA 3MHPA 1N6NA 3DWFA 3MTGA 5AW2A 4XWTA 2Y1FA 3LK7A 3RAJA 4CHTA 3R0JA 3WL3A 5HRUA 1I2BA 4QQ8A 4KQ1A 2AXQA 3IDZA 4BX3A 2GK7A 2C0QA 3EQ7A 5F98A 1DJPA 3L40A 4PZYA 4KFUA 2ARKA 1ZCJA 2OFOA 4CKEA 4E30A 4MCJA 3S8EA 1X3SA 3SZUA 2DFLA 1E1NA 1X38A 2RHDA 1JIIA 2II6A 3QPDA 1IMOA 1E2FA 3KL4A 4PLGA 2J6BA 4L5JA 3UTCA 4BQQA 1NPDA 5SYAA 4LBWA 2FPXA 3A14A 1N57A 2ZBRA 3WRYA 3H1PA 1UFOA 3OLXA 5IBRA 4A03A 1YZFA 1V6CA 2Q28A 3EXFA 2H1WA 2HWXA 4XTCS 3ZHOA 5B1IA 4B83A 2FZ4A 3NQ41 1V5GA 2HCFA 3EN0A 1Z06A 3NWPA 1RXSA 2NUAB 4JMLA