4DSUA

Small-molecule ligands bind to a distinct pocket in ras and inhibit sos-mediated nucleotide exchange activity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
180
structure length
177
Chain Sequence
STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas, isoform 2B
publication title Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 177
sequence length 180
ec nomenclature ec 3.6.-.-:
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dsuA00
5CYPA 4WXRA 4AURA 2JIZA 4GFDA 1U81A 2P0EA 4KVGA 4TL8A 4ABYA 2VSOA 4PANA 3IIMA 4PR0A 4LHZA 1Z6GA 4P3YA 4RZXA 2GNOA 5F3WB 3IKJA 4RCZA 4POAA 4L15A 1E4YA 1W0JD 4Q01A 4ZDKA 3PEWA 3OIWA 1GKUB 3AP2A 1W46A 2O0KA 3CF0A 1E3MA 4BFWA 1YZTA 3AUYA 1GL7A 1DAMA 1E79A 5EQTA 2ZJOA 5CJPA 1A2KC 1AIPA 1E2QA 2QY9A 2AWNA 5DHAA 2QI9C 1XB2A 5DHFA 3TGPA 1WDTA 2YZ2A 3B13B 1NSFA 2AHOA 4GZLA 2G9NA 1N0WA 1E2DA 1I4DD 1N6KA 3WNCA 2RH5A 5CK4A 4BECA 3MJRA 1ZUNB 2YNMA 2V6JA 1QDEA 3OEED 5FTKA 2RMKA 4KBGA 5C4MA 2RGEA 1TQ2A 3LNCA 2E9SA 4DVGA 2IYYA 1EFUA 3LVRE 4LJ6A 4LX0A 5EP3A 4F93B 4ON9A 3NWJA 3KXIA 1G1MA 3D7MA 4W5JA 2Z4SA 3PEYA 1H8HD 421PA 3O8DA 3VR2A 5KSPA 4GRAA 2G88A 4NCJA 3VU9B 1NMXA 5AWFC 1WCV1 2G3YA 1G291 3T34A 3JVUA 4QBHA 2HV8A 3RVBA 1D5CA 1YZUA 3MLEA 5DN6D 1KO7A 1TPZA 5KNCA 2AKYA 2ONKA 2IF2A 2JDID 2VA8A 3Q7QA 5EE1A 1M7GA 4HAVA 1XMIA 2V9PA 1GFIA 1AA9A 4AKHA 1XX6A 3RANA 2A2ZA 2ZSBA 1XRJA 2O8DB 3LO5A 2ZI3A 1W0JA 1E1RD 1EXMA 1FPMA 1L4UA 4DUGD 5C1BA 3HPRA 2QPAA 3DL0A 4FN5A 2BBOA 2ZETA 3MSXA 2OHFA 4OJQA 2LKDA 4US2R 5CM8B 4DDWA 5KO2A 3NBFA 2D4HA 2OFWA 1KO1A 3UMSA 1ZD8A 2QPTA 2ZR7A 4TQ9A 5E95A 1FMLA 2E87A 4BLPA 2XNDD 3U7FB 1TMKA 1W0KD 4TLBA 4BE7B 2BKUA 3VQTA 4OHYA 3VKGA 4TLAA 3A1SA 1ESMA 1P62B 1Z06A 1UF9A 3AF0A 2VP6A 5JFGA 1R10A 5FI0B 3RRNA 4HUTA 2ZYVX 1E69A 1G9XA 3DOFA 4B74A 2PLFA 2RHDA 3W8NA 4QC2A 2QP3A 2FFHA 2V8OA 4HAUA 2YC4C 1FFHA 2ZJ8A 4DCUA 2GWHA 4V0LA 4AYXA 1XMJA 3MUFA 2DWPA 3T1VA 2ZTSA 3AKCA 1S96A 4PHTA 2KBEA 2DR3A 1CR0A 1S1MA 4HUQA 1G5PA 1ZNXA 3THOA 4DT1A 5KUTA 2HYIC 1WBDA 4B2LA 1G6HA 1LF5A 3CPHA 3P4YA 4XVRA 1BKDR 4MGKR 4MKGA 3AVPA 1GTVA 1G8GA 1A2BA 1Q1QA 2XZLA 1R0WA 3U60B 2C77A 3KB1A 1G3IA 5EUQB 3CUEF 2I4IA 1TUIA 5BN3A 1JJVA 4D4MA 2FDCA 1YZKA 4NBSA 3TQFA 5KTYA 1E9DA 1T8TA 1N3BA 2F3RA 3L8YA 3GLIB 5DSZA 1IJEA 4PAMA 4EPRA 1N6HA 4JS0A 3FKSD 5AJXA 4QM6A 1VTKA 1E2PA 2XTNA 4A0HA 3TAUA 4DCVA 5JHHB 3THXB 2Q3MA 3C4JA 3VX3A 1LS1A 4DLVA 3FGNA 1GOTA 2ZVPX 1PVOA 1P73A 5KNDA 1KK1A 4MKHA 1YKSA 4OJKA 4FMDF 5FBQB 2G6BA 2ZYWX 1RE0A 2VBCA 3RAPR 1Z08A 2ZREA 5TDHA 3T5DA 2YKGA 4H1VA 4H1UA 4V0MA 5GJBA 2JLSA 4URUR 3MRSA 5P21A 3QUSA 3U3RA 1XEXA 1Z0IA 1XXHB 5DIFA 1G3QA 2PL3A 3L82B 4M1MA 2F9MA 4PO9A 1DAKA 2HF9A 4QHYA 5JSZA 3A6PC 5BW8A 1XEXB 1S0UA 1NMZA 2BMJA 1PJRA 2VHCA 3K0FA 5EE3A 5FOWA 4B44A 1P3JA 3IEUA 1JAIA 4G5OA 5JSZB 5HKKA 2BIFA 2IXEA 1DG3A 1KSJA 3P1JA 3QQ5A 5UKDA 1BMFA 1DADA 1HQCA 2WWYA 1IY0A 1R2QA 3DMNA 1PLLA 1MT0A 5D3QA 2QG6A 4JYCA 4D4KA 1XZQA 5E7JA 4O3MA 4TN1A 2OG2A 4QJ5A 3TSZA 4WVFA 3IEVA 3GEEA 4YMTA 2KSQA 5FBVB 2XSZD 1WBBA 1XP8A 1KNXA 3UPUA 2YINC 1HE8B 4M1WA 4TMKA 3OF5A 2NGRA 3FKQA 5DI9A 4R98A 3CH5A 4C9BA 3THYB 2QMOA 1R6BX 1NMYA 5A0FA 3UG7A 3U7EB 1D6JA 4QNRA 1WP9A 4LC1A 4LY6A 2WAYA 4FIDA 4AWXA 1XBTA 2QGNA 1N2CE 1RYHA 4DEXA 4EFLA 1YR6A 5KYKA 3BFKA 2RHMA 2FPMA 4LPSA 3AQ4A 4DXAA 1PV4A 3NIBA 1I4LD 1TU4A 3AP3A 2XB4A 1NN5A 4MKFA 4AC9A 1E2JA 3QVVA 2BEKA 2VSFA 4A0GA 2OV2A 1HTWA 2ERXA 1R8QA 4AIIA 2ERYA 2Q6TA 3E5HA 121PA 2YOGA 3VTKA 3WNDA 4AK9A 3LAWA 5SZHB 3RC3A 3AVQA 3TR5A 5KHOC 3T1QA 4A15A 1YR8A 2P67A 2BJVA 5L3QB 5JJKA 5G53C 4Q9KA 2RGDA 3SOPA 1MABA 1VHLA 1X6VA 2C5LA 1LS6A 4E03A 3L8ZA 1XTRA 3AF3A 3KKNA 3X2SA 3KQKA 1EFCA 2G83A 3LX8A 3AVWA 4LV5B 1XEFA 1G4AE 1VDZA 1RJ9A 4DKXA 3SEAA 4LGMA 3PEUA 2BBSA 1YRAA 2QMUA 4GP6A 3RNLA 3RSOA 3F3YA 4Q5IA 2XJ9A 3EZ7A 4UKDA 4BRWA 1KY2A 5DISB 4EJSC 4G1UC 3AVOA 1IAQA 3GLHA 4A8JA 4B6EA 3L0IB 1FTNA 1NVVR 3TJZA 4B47A 5D3MA 2GK7A 3BS4A 1PUJA 1QHXA 4EFNA 1GM5A 1X86B 3GJ6A 1MO6A 2ECKA 1E2LA 1KDOA 1NVVQ 2CLSA 4NYMR 4OHWA 5BQ5A 5JLJA 3KQUA 1MRNA 2ZJ2A 3X1XA 4DCSA 4B75A 1ZW6A 3A1TA 3OFND 4NYIQ 3UATA 2J45A 3PV0A 4FINA 2ZRLA 3F5FA 3K0AA 2QP9X 5FUVA 2GXAA 2QA5A 2CMKA 3U44A 4PO8A 4Q1FA 4Z1MD 1GNRA 2FJUA 2WV9A 3ND9A 4BLSA 2NO0A 1GITA 2IC5A 5FBWB 1AGRA 3FHCB 4HDCA 4URWR 2H57A 1Q12A 2WBLC 3A1WA 2IEYA 2I1QA 3WYGA 2BJWA 1N6RA 1U8YA 2REXB 3GLFB 3THWB 4B32A 5C4GB 1JR3E 5C46F 2BMFA 2FPKA 1OLOA 1BH2A 3ZVLA 1EWRA 3PITA 2NPFA 3NBXX 4JLMA 3OIUA 4DLRA 4C7OA 1KJYA 1DO0A 2A5FA 3AB3A 3O8RA 1N6PA 1A5TA 4D25A 5CIQA 2JGNA 1W5SA 1CULC 2GXQA 3EPKA 5CB6A 3FMIA 5CITA 2ONJA 3B5JA 4JLNA 4B48A 1W36C 2JLXA 2J46A 2Q3FA 5AUPB 5L3SB 1UAAA 2ORVA 3B1ZA 2KE5A 1Z28A 1M7BA 2ZROA 3BK7A 3H1TA 4R2HA 4DLZA 3AGQA 3BGWA 2ANCA 3AF2A 1P9WA 4RFSA 2OXRA 4GOJA 2GJAA 2JIZD 2Q9AA 1KSFX 3H2YA 2BV3A 3GJ4A 4BFVA 3LBHA 1ZP6A 4V0OA 1FTSA 3CRRA 5ANRB 1Z47A 4XVQA 1EX6A 1W36B 3IBYA 1WXQA 4UNPA 2YVUA 4PPGA 2O8EA 1P75A 4U5XA 2CE2X 4DIEA 2ZUBA 2O8FA 2GJ9A 4RD3A 1W5TA 2VHTA 5DI3B 2O52A 3ZZTA 4ACAA 2QAJA 3BRWD 2BEJA 3ZYCA 4W7SA 1AKEA 3K70C 2O8EB 3QY0A 3X1DA 3PFIA 1W36D 1N25A 3KFXA 2IF0A 3ZQ6A 1AQUA 3HPQA 3SFVA 4RKEA 1G8YA 1NBMA 3RS4A 5TXGA 1KOFA 1F60A 2OBLA 3JVVA 3ZGXA 2IL1A 2C9YA 2R44A 4Q21A 1ETUA 1N0VC 4MRNA 2GJKA 2UKDA 5H8WA 4YXWD 3KQLA 2VP0A 3EG5A 1KZ7B 3LDAA 4NYIR 5HKKD 1U8AA 2OXCA 4CYMA 2ZXUA 4LHYA 5B30A 1ZC3A 1XF9A 3PENA 2OBMA 2ZI6A 3TH5A 1G7TA 5B58C 2F55A 8OHMA 1AS3A 2D2EA 3KKPA 4FXPA 2DCUA 3B1WA 2ZANA 4LWZA 1P6XA 4D0GA 2QZ4A 2IW3A 3IIKA 3FPAA 1DE0A 3DMDA 4Q4AB 2XXAA 2H7VA 3QKUA 1CR1A 2JA1A 3K70D 1QVRA 4LJAA 1U2RA 2NO9A 4WW0A 5BXQC 2C99A 5J4VA 1JR6A 1ZUIA 2YWFA 2WWFA 3EC2A 3MAAC 3GJ5A 1N5JA 2HCJB 3SZRA 4L8GA 3Q5EA 2NO7A 3CRQA 1HQYE 4KFTA 4GNKA 3I62A 5HCNA 1G3RA 2CLCX 3CO5A 4QG7A 1W2GA 4EPVA 3W34A 3A8TA 4DC9A 1XD2B 4KSCA 2ZRFA 1IN4A 1N6IA 3PQCA 4IEEA 5E7IA 3IHWA 4BLRA 3FOZA 1JAHA 2VPPA 1Q22A 4AY2A 2EFCB 2IYWA 4M1YA 2PT7A 3DVLA 1YJ5A 1E94E 5FL3A 4DLTA 5FOUA 3FMPB 4JLVA 4N0EA 5SZKB 3WP0A 3N2EA 4AG6A 4Q7LA 1Q20A 4GSYA 4JLKA 2XNDA 3GJXC 4LHWA 2L0XA 2F3TA 2FE4A 3X1WA 3M1IA 1W0KA 2QORA 5KSOA 2VTKA 1S2MA 2I1VB 3LQQA 2VRWA 1P72A 1L4YA 2H17A 2C9OA 3WP1B 1IXSB 2FEOA 4HZUB 5FUYA 3MWLA 2JEOA 3B78A 3IILA 1GP2A 1M8PA 2X1VA 3PJRA 1W4CA 2H8KA 4DCNA 4O2LA 1T5IA 1SVIA 1UBCA 1ZINA 1U0HC 1NNEA 4ZO4A 2FGKA 2IS4A 2YV5A 3GLIA 1ZM9A 2HLDD 4DIDA 2QL6A 1E2FA 5GVRA 4ZI3A 3QF7A 2C9CA 2P65A 3UXMA 2P6RA 3EA0A 4BRUA 4AKEA 1E6CA 1G7CA 1P2UA 1Z0KA 2IHYA 2ATXA 2WWIA 1R0XA 1XMSA 3GEIA 3OZXA 4JKIA 2WKQA 2NG1A 2W0SA 5AJYA 3RS5A 2BKEA 1Z2CA 4PSKA 2GEDA 3G0HA 2AX4A 1W1WA 2VL7A 4E5UA 3LXRA 5IF9A 2BOVA 4GOXA 2BDTA 1HEIA 2GCOA 1UKZA 1QRAA 2ZRGA 5JEEA 4XVUA 1EFRA 2ZRPA 4LHVA 4LRWA 2IYQA 1GIAA 5TV2A 1OIXA 2RCNA 3Q5DA 4TYNA 3RS7A 2A7QA 3U7GA 1M1YE 1G18A 1Z07A 1NRJB 3P27A 1S3SA 4OYHA 4ZCMA 3SYNA 4UJ5A 2GXUA 3OEEA 4MYCA 1NN1A 4PZLA 3ZS8A 4K8OA 4O0MA 4OHXA 1TTTA 4N0DA 1KKLA 1NVUQ 4EKDA 2CHQA 2JJ2D 4M1KA 2H16A 4DWJA 5IDVA 3W6NA 1K5GA 1OT3A 2DFKB 1II0A 1ZYUA 1CU1A 3DO6A 4M8NE 1R5NA 1SVMA 1M74A 3WNBA 1KK0A 2YOFA 5GJCA 4R2IA 4Q4LA 2WZQA 3FWYA 4V0NA 3U4QA 1D2MA 2ZJYA 3C7KA 4TTQA 4KAXA 3C5HA 1KJWA 4OQNA 2VF8A 1JQJC 2P6UA 1Z83A 2OUKA 3EAQA 5FBRB 1D2EA 2ATVA 1AN0A 4B3FX 1P60A 1XD9A 4JT4A 1SXJC 4KVAA 4HAYA 1HT2E 5HR5A 1GRRA 3A1UA 4LK2A 5C2JB 2OLJA 3NBYC 5FOVA 4MDFA 3OE7D 821PA 1P61B 3CRW1 4II7A 4BASA 1OHHD 3MJHA 3K0CA 1CR4A 2PCJA 2OAP1 3GQBA 3W3AA 3T1OA 3AV0B 1VECA 4M22A 2GJ8A 3NXSA 1UDXA 4TLCA 4X8OA 4A6XA 5K8TA 1TEXA 1J8YF 2XSZA 4CGZA 1ZM2A 2MMGA 4H9GA 2BM0A 4MYHA 3LLUA 1HYQA 5J5CA 3TKLA 1KDPA 1UDWA 3B82A 4QBFA 3I72A 3X1YA 3A37A 3O8BA 1VCIA 1VKJA 2BVNA 1YR9A 2W2XA 5FTMA 4BFYA 3U3MA 4M2LA 2ZUDA 2R6CA 4LJYA 1E0AA 2GXSA 4C0LA 1YU9A 1JXMA 2W0MA 4U00A 2JJ1D 2ZQ5A 4QBGB 1DS6A 3SHFA 1SGWA 3AP1A 4GT1A 3X1ZA 3EIQA 1XEWY 5H1YA 2O8BB 2RGNC 1UKVY 3EZ6A 4C4PA 1OYYA 4EUNA 2FMXA 3CPJB 4HDQB 2BWJA 2JJ2A 4BFSA 4D0NA 2ZSAA 3U3OA 1VHTA 3KFVA 4RCYA 2FV8A 3K0FB 1Z0FA 4XWKA 1R8SA 3ZVNA 5SZIA 3CZPA 2YC2C 3I8SA 1P2SA 1NY5A 4PHGA 4FWTA 2PBRA 2IWRA 4MRPA 5KSYA 4S35A 1WQ1R 2HDNB 2WJHA 2C03A 2F7SA 5K8LA 4RVCA 4LYJA 1RW4A 3QOFA 4JBWA 1MV5A 2QBYA 4MA4A 4OQFA 4XWOA 3CNNA 1RJ9B 4NYJQ 4TT3D 2IWHA 2ZAMA 3QXCA 4HEJA 1NLFA 4B43A 4F7WA 2ZU0C 3AEZA 2A9KA 2HT1A 2OFXA 1OW3B 4KYIB 3GLGA 2EU8A 3GEHA 1OKKA 2GZDA 3GFOA 3RYTC 2OCAA 2AXPA 3ZD6A 1LY1A 3BB4A 3K09C 1NSTA 4KV9A 2OAQ1 3GJ7A 3HU3A 3NC0C 3K0SA 5DE3A 1OH8A 3U44B 5E4FA 3CONA 1I4TD 2EFGA 1QHHA 5CLQA 1Q3TA 2EFHB 1TAGA 5AK0A 1CR2A 1KHTA 5KNBA 3WMFA 1HV8A 3BE4A 3T15A 4WZ6A 2H92A 1W7AA 1X8JA 1ODFA 3QBTA 2ORWA 4OK5A 4OK3A 1I2MA 4WOPA 2IYZA 2VP9A 4CVNA 3BERA 4W5WA 2IS6A 4P0TA 2ZI9A 2QUZA 4J0QA 4PC7A 2AL7A 4WIAA 1W2HA 4Z54A 2VEDA 3LBNA 4QXAA 2BBTA 4YLGA 4DLSA 1VG8A 2J41A 2J9RA 4LCBA 2BMEA 2GBLA 2RB4A 3ASYA 4XH9B 4YDHB 1QHGA 4AG5A 2J0UA 4QL3A 4C0QC 4DHEA 2D7DA 4ZKDA 3RS2A 4UXHA 4OQXA 2R8RA 5L3QA 4D80A 1CJUC 4LOAA 1MABB 1ZM7A 2FSHA 3PVSA 5JRZA 3Q72A 4A2PA 4I81A 2C98A 4KSBA 3IQXA 3HR7A 1J8MF 1ELOA 1I2DA 2VO1A 2XOKA 5L3SA 4Z51A 4A92A 3TBKA 2G1KA 4HZIA 1J7KA 4GMXA 1GKYA 1H8EA 1SZPA 3VR1A 1BS1A 3Q9LA 4GOKA 4I4LA 2HYDA 4Q4HA 1U9IC 2F1JA 4Q1AA 4RFVA 1Y63A 2V7QD 4NP6A 1TNDA 4HB2A 3PUYA 3K9LA 4KLZA 4Q9LA 2CNWD 2OILA 3RLFA 2RGBA 4OI1A 1KNQA 3ICEA 1T6NA 2YWHA 3VR5A 5CLLA 4LJ5A 1ZNYA 3UMFA 3CLVA 2JLWA 2GK6A 1X8KA 1OJLA 1YR7A 4RY2A 3GLIE 2BMDA 2PMDA 4DSNA 4YC7A 3SS8A 1G17A 3L0OA 4KI0A 3EPLA 2PT5A 1JBKA 4B3GA 4HLUC 5BN4A 2PLRA 3QVUA 3W3ZB 4R7ZA 5TARA 4JVSB 4LJ4A 3LW8A 3CB4A 3UWKA 3CM0A 3LY5A 3EIHA 521PA 4FMCF 4BWYA 4AYWA 4NHOA 3CIOA 5DYIA 3B9PA 5KU1A 4NH0A 4IDHA 4B35A 1Q1ZA 4P4SA 4DDTA 1F2UA 2ZRBA 4OI2A 3GLFA 4M1SA 3THWA 3P26A 1IY1A 1FMJA 2AXNA 4Q1EA 2WWGA 3SBEA 2FG5A 3HDTA 1R5BA 4C7OB 1HE1C 1OV4A 2NPIA 2VYFA 2ODBA 3D6TB 4P31A 3GLFE 4LBYA 1KMHA 1NBMD 2J0UB 1IHUA 4JJZA 2YHSA 2WICA 4OI0A 3I73A 4JT2A 3VR6A 2EYUA 4NZYA 2WSMA 3NG1A 3DM9B 3I3SR 4RD0A 1EESA 2ZEJA 1NIPA 1CKEA 3AVVA 4PX9A 5HTKA 2QRNA 2ZS8A 2FH5B 2H18A 1E0KA 4UNNA 2AKAB 2QAGB 2DFNA 1OF1A 5GJVC 1OFIA 2ANBA 3VKHA 3OAAA 4RD4A 4CEJA 2Q9BA 1M7HA 2VP5A 3QXXA 3NC1C 1OXSC 1J70A 3RS3A 4GMDA 4GP7A 2ZR9A 1U90A 3U61B 1QZXA 1T3HA 1IM2A 3B2EA 1BYUA 4IRUB 4LBWA 3ZS9A 4ASUD 4Q47A 4TMZA 2FOLA 4XD7D 4G0NA 1EX7A 4FI3C 1ZUHA 5H70A 2GETA 1VYVA 1X1SA 4B3XA 3GLGE 1SXJB 4B3CA 1B23P 3WBJA 2QAGC 2W6JA 221PA 5EXXA 3K9NA 1E4VA 1MO3A 3EC1A 3ZIAA 2IYUA 4Y0VA 4MITA 1YVDA 3FYHA 2XZOA 1ZC4A 1W4AA 1T0HB 2CJWB 2QTHA 4NU0A 3R7WB 4LC0A 1LFDB 1RRGA 2V54A 3KX2A 3A58B 1VG1A 4G5QA 4PO1A 5GADl 1LTQA 1V43A 3AVUA 3AUXA 3MWKA 2R9VA 3Q7PA 4LI0A 2XITA 4HZUA 2ZI5A 4JSTA 5F2EA 2PX0A 5L8VA 2RGXA 1FZQA 2V4ZA 1IXRC 1ZNZA 1Q0UA 3K0CC 4QNMA 4TL9A 4A4DA 3C8UA 2R6FA 4HAWA 4TQUS 1AJEA 5DH9A 5LD2C 3ASZA 1EFHA 5L3VA 1XTQA 3T12A 4FW9A 1KKMA 3P4XA 4N3NA 1WRBA 1EK0A 2QQ0A 1T9HA 4QRHA 4YMUA 1KMHB 1CRQA 3TIFA 5HPYB 1ZNWA 3OEHD 4QKQA 4HUQB 4BLQA 1UFQA 1QHIA 4Q4AA 4DT1B 4F4IA 3TUZC 5FFMA 4BPBA 4A9AA 1XTJA 3LQRA 2WWHA 4HDOB 4LJ7A 4F4JA 1UKYA 3SU8A 4IOLA 4PAOA 4NPHA 4IEIA 1GKIA 1E2IA 1MOZA 3BORA 3SQWA 2GBLC 1DAIA 2UZIR 2NOAA 4Q4JA 1CJVC 4KO8A 2CL6X 1LVGA 3UWOA 4RZUA 3AVXA 1OH5A 1WF3A 4I1VA 1P2TA 1A4RA 1IQPA 3KTAB 5B64A 1OFTA 1ZJ6A 3CW2A 2REOA 4MRVA 4DLWA 1BOFA 2WPDD 2ZSEA 2GCPA 2VF7A 2ZSFA 1KY3A 4LV6A 5EP1A 4BFZA 4MGIR 1EFRD 1W48A 1Z2AA 1MKYA 2WHXA 3ZJYA 3I5YA 2NO1A 2Z5FA 4KFUA 5KPJA 4ACBA 4TQAA 4URVR 4QGAA 4NTZA 1SHZA 5JWRA 3K9HA 2D3WA 3E1SA 3T35A 3WYAA 3SI7A 3VR4A 4EQ6A 3W9YA 3TUJC 4MYTA 4JLPA 3H86A 3VNUA 4LYAA 2A5GA 3D8BA 3CPEA 4B2PA 5TMPA 3SR0A 4YMWA 2VP2A 4ESVA 1G8FA 3K09A 2LKCA 3QKRA 4E07A 1AM4D 2NZJA 4R9UC 1OHHA 1J2JA 4HYYA 3ADDA 1T5LA 1Z8FA 4KCGA 3RWOA 4GZMA 3QKRB 4D2IA 1E2HA 3CF6R 3LA6A 3GPLA 1LW7A 2QEQA 5FBLB 4CW7A 2AN9A 2WIAA 4FCVA 1C1YA 1MO5A 5IHPA 2WKPA 2BHRA 5AUQA 2DBYA 2OCYC 2CVHA 2YWGA 3EARA 4DLYA 2ZJAA 1FW6A 3CR8A 1TF5A 2W58A 4DCTA 1N0UA 4XSGA 1H8ED 2WIBA 1VYTA 4MGYR 1SKYB 5EXPA 5EP4A 1SHKA 3OE7A 2ZE6A 1QG4A 4IW3B 4AYTA 1ONBA 2Z43A 721PA 3FDIA 4B76A 1N6LA 2WJVA 4Q9JA 3L0PA 4M9QA 4JKYA 3NDBB 1T3SA 4TLDA 5JZVA 2GVZC 4QHSA 1TF7A 1K8RA 1KK3A 3C14C 3CR7A 3BXZA 2NMVA 1G8PA 3BBPA 4PAQA 3WYFA 5FL7A 5IK2D 3FB4A 4P32A 2QM7A 3KKQA 1E96A 4Z8YA 1JALA 5A4JA 4WA7A 1JI0A 3GJ8A 3H84A 1X1RA 3BOSA 2AR7A 3CBQA 3BFXA 2GKSA 5DLQC 5G3YA 2OCPA 4FMDB 2JLQA 4OHVA 5G41A 5KPDA 1RKBA 1OFUX 1RVDA 1NVWQ 3IQWA 4QHTA 1Z6TA 1RIFA 2NTYC 2NZ8A 2UZ3A 3SFZA 4UNQA 3C41J 3U4QB 3REGA 2WJYA 1QHNA 4TT3A 2CHGA 4QOSA 1ZBDA 3UANA 3AF4A 5AUNB 3W6PA 1BIFA 4UJ3A 5FPTA 2HUPA 2OE2A 3W8RA 1RPZA 4CF7A 3V9PA 1OH7A 3IPXA 2R6DA 4JLBA 4CT5A 2XZPA 1IJFA 3BJIC 3OIYA 1OB5A 1E1RA 2E1RA 4TMXA 3SC3A 4Z8XA 3QXSA 4D81A 3LFUA 1GILA 4PQYA 1AS0A 4WAUA 4D6PA 4RKFA 1VG9B 2ZJ5A 4KHZA 1NVXQ 5EXTA 1YZNA 2VHQA 2K5UA 3A4NA 3TSOA 5J40A 3OHMA 1OIWA 4BZXA 2J3EA 2XB2A 4C0JA 5J4KA 2RGAA 3EX7C 2BM1A 4D0LB 3CRMA 4HSEA 4NE2A 4QJ4A 4ZCLA 1TL7C 4LDJA 1GZSA 1WB9A 2WVJA 3N5CA 4I1UA 1SVWA 2ZITA 3C15C 3FE2A 1LB1B 3I5XA 3AM1A 4V0KA 1HA3A 4RZ2A 4DUGA 3G82C 4NMMA 1GNPA 3I32A 1HY3A 1KI9A 4US0R 3C5CA 5JS8A 1LNZA 2WSSA 1G3MA 2IUTA 1G4UR 3CH4B 3HR8A 3KKMA 4W5HA 5FOXA 1F2TA 2OEPA 1KDRA 4EPXA 1LV7A 1RYFA 3W5JA 2FWRA 5GJWC 5HZHA 1G5TA 2W83A 2O8BA 4L9SA 4PTLA 2P5TB 4Q03A 4Q7JB 1E9RA 2BCGY 4AKGA 1F3OA 4V03A 4DRZA 1HH4A 1DG1G 1S8FA 2ORIA 2CL0X 4GDFA 1FNNA 1T8UA 1XZPA 2FU5C 2HXYA 1UBGA 2KBFA 2AK2A 1FP7A 1IN5A 4ILEA 4ESHA 1YHNA 3ECCA 2QP4A 3DKVA 3FFAA 4WBSA 1NJGA 1CJMA 3GCGA 4YXWA 2EFEB 3ZQJA 1MO4A 3AVYA 3QBVA 1Z6XA 4TYWA 1NBME 2HCBA 2RGGA 4P33A 1FOEB 1G7SA 2FX3A 1CS4C 4K46A 5TB5A 1E9FA 5FH9A 2MSEB 3ADKA 1BYIA 4DBLC 1L8QA 1GRQA 5EE5B 1KI2A 2QROA 4CEIB 1WMSA 2AK3A 3U7HB 4IFEA 1KI6B 2ZPTX 1XU4A 3NH9A 3V4FA 2G1JA 5LBIA 4UXJA 3WMGA 5E3HA 5EJEA 6Q21A 1UM8A 1OFHA 2ODEA 4A2QA 1FUKA 1QHSA 1Q1BA 1G21E 2CE7A 2R65A 1H65A 5FR2A 1XMVA 3GFTA 4NL4H 2PH1A 1E9BA 4DSOA 3MFYA 4IJMA 4URYR 2B7BA 3LXXA 4US1R 3U3JA 2WM9B 4RD6A 2FPLA 4A1FA 3NHBA 2N1BA 2PJRA 4PHFA 1Z5ZA 2J7KA 4OHZA 3TE6A 1LF0A 4IDOA 2ZAOA 2IT1A 2KJQA 4YMSA 1DVRA 4C0HA 4JBXA 3S1AA 2WPDA 5JS7A 2B7CA 3RDPA 2XJ4A 1VMAA 1SKYE 2HJVA 4MYUA 3FHTA 1GDDA 4ITRC 2WOOA 4NKRA 1GRNA 3S1AB 3KUDA 3ZVMA 5DGXA 1X3SA 1NJFA 3UKDA 4C0KA 2IXFA 1AZTA 3TSWA 3WRYC 4HI0E 1E0JA 3NBZC 2F1HA 3L0SA 3BFVA 4JL5A 3SJCA 1JR3A 2OSBA 4R71A 3LRPA 2J7PA 2IYLD 2CXXA 2QGZA 2TMKA 3E70C 2O8CB 1OSNA 4IHQA 4Q9IA 4TZ6A 1AZSC 3KXLA 4PFSA 3RABA 1E32A 4TWZA 2PEZA 2CDNA 2A5DA 3VX4A 3BIFA 2O8CA 4PPFA 1RC8A 3IHLA 3WRXC 3EWSA 2YJTD 3QKSA 2QT0A 1FQKA 1TQ6A 1ZM3A 1XTKA 1Z0AA 1J99A 2IUUA 1FP6A 2O0HA 3ZVRA 4RJLA 3OIVA 2CEAA 1KI1A 4ZDWA 4ASUA 4CEJB 2XX3A 2F43B 1KI7A 2D74A 3P32A 5F9HA 2ASEA 4ZIRB 2VH5R 1L7VC 1Z0JA 3DDCA 2OM2A 4Q9HA 5LB4A 4ZKEA 4LYFA 3PR1A 3PUVA 2Z0MA 4Q1DA 2QSZA 3LWNA 3RRZA 1KO5A 1T4GA 3OESA 1G64A 2RKOA 4CZ2A 1DEKA 4BFXA 3TVTA 1KI3A 1W47A 3U5ZB 5LPNA 4CEHB 3SDZA 1P9NA 4L9WA 2DWOA 2GESA 3CX6A 3P20A 1SXJD 1PZNA 3ONWA 4JJKA 2J87A 3TMKA 1U99A 5DO9A 1QVAA 2IA5A 3R7WA 1L2TA 1ZD9A 2GZHA 3CX8A 3I92A 3QI2A 1KGDA 4JLJA 4L16A 4BQSA 3T1TA 2AWOA 1ZD1A 2G0TA 2JLZA 1F2UB 3AKDA 2FFBA 3B85A 2JAQA 3R9XA 4G5SA 1T91A 4DB2A 1N5LA 1VYUA 2FFAA 2GAOA 4EFMA 3KB2A 5CIWA 5K8IA 2F9LA 1JPNA 2G0NA 2IS1A 3O8CA 2ZRNA 2EVWX 4HLDA 5JJLA 1G5RA 4P4TA 1W49A 3RRMA 4IXMA 3D3QA 2GF0A 4Q19A 3PXGA 1E1QA 3ZH9B 2KI5A 4JBYA 3SBDA 2V3CC 1IY2A 2JLUA 4JMPA 5JCPA 3K9GA 4MH0R 3KJHA 2IX3A 5AJWA 4DSTA 3A4MA 3Q8XB 1E2NA 2R6AA 2FZLA 1AKYA 2EWVA 4AI6A 1OH6A 2BCJQ 1XPUA 2H5EA 3K53A 2ZU6A 1E2MA 1FUUA 3A4LA 5EXSA 2ZIAA 1Q57A 4Q4JB 4NDZA 3NHAA 3T5GA 4D4LA 2D06A 2O8DA 2IUSA 1K5DA 1XJCA 2DY1A 3QJYA 3QPWA 3SN6A 1VCNA 3QSYA 2GDJA 4Z1MA 1O87A 3DHWC 5B2ZA 2ZRKA 3GLHE 3LD9A 3THXA 2NIPA 3GFPA 3HYTA 4M4SA 5JECA 4KLNA 4ZIRA 1W4RA 4PQRA 4RD2A 1W4BA 3VMFA 4LJ9A 1S1CA 4EQ6B 4CT4B 2SHKA 1E9EA 5JBQA 1G41A 2DFTA 3WHKA 1ZMXA 1OXVA 2CL7X 1OXTA 3VR3A 3AKYA 2WJGA 1N6OA 2WSSD 3CWQA 4XJXA 4PSAA 2ZS9A 2CCGA 2ZE5A 2ZRIA 3EA5A 3IDQA 1DPFA 4OBEA 2A3RA 1Z6YA 1R4AA 2IBMA 1CXZA 5EZ6B 3KQHA 3O47A 1U0LA 1H8HA 4ZI2A 2WAXA 1JQLB 4MQBA 1DOAA 1HURA 2ZE8A 5CJ2A 4TTPA 2A5JA 2DB3A 1GNQA 2VIIA 4CRWB 3H4MA 2IYTA 4EJSB 3UK6A 4G3XA 2C95A 4WZBE 1S3GA 2FFQA 3DZ8A 3QE0A 2VHUA 1KO8A 1EGAA 3NEYA 5GVSA 3LBIA 1DAEA 3BB1A 4EJSA 3LLMA 3NTUA 1ZU4A 2J1LA 3SJBA 3SYKA 1UADA 1SKQA 4NCKA 1Z3IX 4XWAA 1T3LA 3EZFA 3Q3JB 4D82A 2R6GA 2HLDA 2LCFA 4OL0A 2B6HA 3BH7A 4PC1A 4IDPA 1KYIA 4I1OA 1TQDA 4PC6A 1E2EA 4PXAA 5FUXA 4BZPA 4BUJA 2EQBA 2X19A 4U7DA 3R9WA 4B3DA 4LBZA 4LHXA 1R0YA 4IDNA 1JEDA 1OXUA 1SQ5A 3IUYA 4KODA 1XEWX 4DZZA 2LWIA 1MRSA 1P5ZB 1Q21A 4JLAA 5FTNA 4HLCA 3ZDQA 1UEIA 1SXJE 2XGJA 3H0KA 3TQCA 2IS2A 2X2FA 2IEZA 3DOEA 4HB4A 2AFHE 2GJSA 3M4YA 1XCGB 4LYHA 4TLEA 1TEVA 3K8YA 5FI1B 4BFUA 2W6JD 3B7GA 1KI4A 1ZRHA 2OO7A 4PQFA 4MRSA 5JCZA 1G6OA 3ZIAD 4OQMA 4PHHA 1XNJA 2CVFA 3LX5A 3V00A 1HUQA 4MGZR 2WWXA 3W6OA 1AQYA 4F38A 5JEDA 5EE0A 1JJ7A 4D26A 3KJGA 2W6ID 2W2TA 3DPUA 4IOKA 4TMWA 5FTJA 2FSFA 3EPJA 1CRPA 4XOIA 3RSLA 1COWA 1NLZA 4Y0AA 1ESNA 5IK2A 3JZAA 2IXGA 5HE9A 1E2GA 1X8LA 3PUWA 2ZRDA 4TYYA 2QT1A 2AD5A 2YWEA 4LJ8A 2RGCA 4ZDJA 1ZU5A 3QKTA 3THYA 1JEEA 5ELXA 2WJJA 2P3SA 3SJZA 2QQEA 4UNRA 4W9MC 2F1RA 1XTIA 5F9FA 4TMVA 2QE7D 1YRBA 3JZMA 4M1TA 4ZV4A 2PX3A 1Z63A 1O3YA 3EW9A 5DYGA 1PLJA 3U6KA 4A36A 4JLOA 1KAGA 4M21A 4TL6A 4A0FA 2WTUA 1GL6A 3RHFA 3TW8B 4I99A 4TMTA 4JSYA 5JHGB 3CNOA 3B60A 2DHRA 2FZ4A 2QBYB 2YYZA 1F6BA 4DDVA 4AD8A 4B3BA 5KOYA 3QXHA 3WBKA 3BD9A 4EDHA 3V4RA 4PC2A 2IHBA 5JWHA 4IXNA 3I1FA 4BLTA 2PJZA 3GLGB 3I61A 2QMHA 2RAPA 3IBGA 2CK3D 3QEJA 3MCAA 5BWMA 3TW4A 2X77A 1D9ZA 1Z0DA 4YDSA 3RS0A 2FEMA 1U9IA 4X8LA 1KSHA 4HAZA 4NCNA 3F0TA 2QENA 2YOHA 3QG1A 5J4YA 3A1VA 4IFBA 3TR0A 1E99A 2JASA 4NYJR 2W6IA 2EW1A 4MUAA 4Q7MB 1AS2A 1F5NA 2OT3B 4A8JC 1N5IA 4Q18A 4QFMA 1NKTA 4TSFD 1IBRA 1XXHE 2FF7A 3HJNA 1CEEA 1GAJA 2R2AA 4B73A 3R9IA 4B6FA 2WKRA 3FHOA 3NVAA 4A6PA 1TF2A 4NCHA 2FSGA 5A5GA 4TL7A 3UMRA 1PUIA 5J47A 4PPNA 3G5UA 4XSHA 5EZ5A 4BFTA 3QF4B 2REBA 3SYLA 4JL6A 5DN6A 2ZE7A 4QGGA 4Q4HB 3ZLJA 1NG9A 1OB2A 4CEIA 4JVLA 1DAGA 3ICQB 1Z29A 1KI6A 3N2IA 4EAQA 3AGPA 2P5SA 1E98A 3M6AA 4OK6A 2AFIE 3IO3A 1II8A 1E9AA 3KDSE 4L5BA 2PEYA 1XPRA 4RFSB 2ZYUX 1VPLA 3QPVA 1II8B 4QGHA 1CTQA 1U98A 1IN6A 2ZYTX 3GJ3A 3PUXA 4URXR 2V1UA 3MWJA 3NKVA 1F48A 1NLYA 1YZLA 1G7RA 3BWDD 5BYKA 4LZZA 3VNVA 4M9SA 5BYJA 3VKWA 3U3KA 3EZ9A 1ZVQA 3MMPA 2GF9A 2DWQA 2ZUCA 2DFLA 4G01B 4A0RA 1GL9B 1NKSA 2QMEA 3BAFA 3CNLA 5TY0A 3ZZUA 2OLKA 3IGFA 1OIVA 2A78A 3LW7A 5LD2B 5FOSA 1Q3HA 4FCWA 1A1VA 1XFAA 1ANKA 1VIAA 1NP6A 3CKLA 2GILA 1CJKC 1R0ZA 1DELA 5AR1A 1Q1EA 1US8B 1TX4B 3ZD7A 1FL9A 3J81k 3VU9A 2GHIA 3IIJA 4QJ3A 2J0SA 1SVOA 3B1XA 3R8CA 2XEXA 5J4LA 1TU3A 3KXKA 4RZ3A 3PEVA 5EUMA 2WOJA 1QBKC 2ZRCA 4E09A 3NEJA 2C04A 3K70B 1G3UA 1CLUA 4LV8B 1SVLA 5HCIA 4EPWA 5JI2E 3RC8A 3ADBA 4Q7KA 4OI4A 1II9A 2JCSA 1KIMA 2D62A 2GTPA 4CIDA 4JVMA 4S2EA 4MDEA 1TUEA 2XNSA 1JR3D 5E7MA 3GJ0A 4PZZA 1XPOA 3QEOA 1ZM4A 2VLIA 4FMCB 3TUIC 3KKOA 3A36A 2RGNA 1EFTA 4X8HA 4BEBA 3BC1A 1AGPA 2VSXA 4RD1A 2X8AA 5CYOA 4CEHA 2G77B 3QG5A 1IN8A 2CCKA 2WJIA 5DI3A 1ZCAA 2HXSA 1U94A 1CJTC 1XJ0A 4JLDA 3FKSA 1W44A 1N6NA 3MG9A 2CNWA 2QNRA 4M9ZA 3OFNA 4DDUA 1KJZA 4CDGA 4M1OA 3T61A 3LV8A 2WWWA 2QSYA 2NO6A 2ZS7A 2HT6A 4C0SA 1WA5A 3AKEA 4I1SA 2CHVA 2FA9A 4BZQA 4P4SB 1NN0A 2QM8A 3QPUA 3KZ1E 2FGJA 4C3ZA 4F4CA 2P2LA 2OESA 2C96A 3FTQA 3LVQE 2JJ1A 1P9RA 1OXXK 1SXJA 4C0BA 4NYMQ 4D4JA 1CBUA 3ETLA 1E0SA 1KDTA 1EG7A 3L43A 3PUZA 4EPYA 4YONB 2CJWA 4B2IA 2ZRMA 2IYSA 3DEFA 1FNMA 5L3RA 4JL8A 1SVKA 2XXAB 1US8A 4RSGA 1R5OA 4TYQA 1U0JA 1OKKD 3KQNA 1RRCA 1UEJA 5G40A 4IVQA 3TRFA 5JWOA 5JJIA 1HT1E 3TNFA 1U8ZA 2ZJBA 3VFDA 3K1JA 4IVRA 2QAGA 3SHWA 2XTZA 2ODNA 1DTSA 3U6BA 3F8TA 3IO5A 3NH6A 3QKSB 5C18A 4TZ0A 5K8UA 1A7JA 5M04A 1XD2A 1VG0B 2B21A 1E1QD 1QHYA 3QNUA 3R8FA 3WMEA 4F92B 1VCMA 2OCBA 2FSIA 2F43A 3AVTA 4PSVA 1SULA 2HF8A 1B0UA 1P2VA 2P6NA 1AK2A 2QRZA 2GCOB 2GRJA 3B1YA 1QF9A 5FPSA 2HJGA 3TK1A 2J0QA 4NCIA 4C2UA 3TVDA 1NF3A 1IOZA 4G5RA 2OBNA 4MRRA 2ZRHA 5EE9A 2MSDB 621PA 4PC3A 4XD7A 2B8WA 2C78A 1P7CA 5LB2A 2JLVA 1JB1A 5FL7D 4ZCIA 4OKSA 1NI3A 2R62A 3KTAA 4BEJA 4BGDA 1XCMA 3SE0A 4B34A 4M0LA 1A82A 5FPHA 5AUOB 2ZI7A 3WXMA 4Q1CA 5EP2A 1KSGA 1XJQA 2F1IA 5KSZA 2JLRA 3HU2A 2QPOA 5AJZA 3I8XA 1KZGB 1Y3AA 2QU8A 2XOKD 2IK8A 1RRPA 5FTLA 1ZIPA 3HYRA 4QBIA 3VHXA 5DNYB 1KTVA 2D2FA 2GAAA 2ZI4A 1UBEA 1VIYA 3EIEA 1CIPA 4HLQB 3SNHA 4B33A 4PPQA 3WY9A 2GCNA 4GI7A 3T06B 2PMKA 3LH5A 2Q3HA 1K6MA 2Z83A 1E79D 1NL3A 2DPXA 1S9DA 1FX0B 2X2EA 2VHJA 4ZPXA 4HB3A 1CF4A 3B8HA 1JNYA 1OPXA 4FD2A 1C4OA 1DAHA 1MH1A 1FX0A 5SZJA 2V55B 1S9HA 2V1XA 5G3ZA 3DZDA 4E22A 1TADA 2Q0HA 2BBWA 3RWMB 3ZZ0A 4XTRA 2MSCB 2KB0A 3EXAA 3PG5A 3N70A 4JYBA 5FUWA 4O2RA 5JMTA 3CF2A 2W2VA 4BLOA 1T0JB 4XIGS 5H68A 2QN6A 3EPHA 2H1LA 3PIRA 5IT5A 1XWIA 3FMOB 1XXHA 1RRFA 1UPTA 1E9SA 1M6NA 2C2HA 3ND8A 4LSGA 1G20E 1ZAKA 3D31A 4DLXA 1PLKA 4ZDIA 4G5GA 4OQLA 5KDDA 2MMCA 2JJ8A 4C0AC 4KBFA 4K81B 5LDDC 1KK2A 2HEIA 2GZAA 2FN4A 4ARZB 1QG2A 3HWSA 1RFLA 2Y8EA 3HU1A 2GA8A 1SVSA 3R20A 2OZEA 2W00A 4IOMA 4LBVA 3SJAA 4DJTA 3I4LA 4TTRA 2B8TA 3BB3A 2BC9A 4HB0A 1GWNA 4ARZA 1DBSA 2JDIA 1NG1A 4DB4A 1NIJA 3IPYA 1JPJA 3CWZA 1BMFD 1G16A 3EWAA 4UXIA 2O0JA 1KMQA 4IKEA 2VP4A 1DO2A 3OAAD 4FMBB 2J0VA 2NQ2C 4QM7A 1D9XA 2O5VA 4IVPA 4FCTA 2C8VA 1NN3A 3CZQA 2J5XA 4NONA 5CM9C 4KITB 3UIEA 5F98A 3B1VA 1G8HA 3QIAA 2QE7A 1EWQA 2IYVA 2PCLA 3GLHB 2VQSA 2I3BA 1R7RA 3DM5A 4HLUA 1GSIA 1GG2A 4DLUA 3NDPA 2JATA 4FWIB 1Q44A 4KXFB 2N46A 2Q21A 4JIMA 4UNSA 2CLDX 5TVKA 3QXJA 2J59A 2QTFA 2PZGA 1F2TB 4M53A 4A2WA 1QHHB 2EWWA 2CBZA 4KU4A 4X8MA 2D7CA 4EPTA 1OYWA 4URZR 4WZAE 1JECA 4KJZA 4YQFA 4GBMA 5HZKA 3C16C 4KFRA 3EZ2A 2Z4RA 1YZQA 3KJEA 3W5IA 5BN5A 2IYRA 3WHLA 5KDOA 2CK3A 3W90A 4Q48A 1IN7A 1KI8A 2GVDC 1FQJA 4Q66C 5FPKA 2Q9CA 3GD7A 4GPTA 1CP2A 1MR3F 3FMFA 2ZR0A 2ZRAA 2ZVQX 4A82A 2EFDB 4O25A 3AF1A 3GP8A 1E2KA 1S4QA 4C2TA 5FOTA 2XAUA 4L4UA 3UG6A 2DYKA 5CB8A 3CRVA 4YMVA 4MUBA 2IYXA 4N1AA 3M0EA 2ZRJA 4MKIA 3TLXA 4KFSA 4AKIA 1Z22A 2J7PD 3FVQA 3OEHA 1TQ4A 4Q1BA 1GVNB 4TSFA 5CK5A 5FR1A 3BH0A 3QF4A 4JZKA 3CX7A 5AJVB 1IXZA 1YE8A 3HP1A 4TYPA 1P4SA 2KWIA 1GUAA 2FNAA 2QTVB 2XTMA 4JVNA 1IONA 2ZM5A 2ODWA 1XCPA 2PZEA 2V7QA 1OE0A 3EASA 5CDFA 4B71A 4V02A 1XDBA 2A5YB 3MD0A 4DEYA 2GEVA 5IRCD 4M9XA 5HE8A 4F91B 5JRJA 1BO6A 4LPKA 5D3MB 3Q85A 5JI3E 4IOJA 2GEUA 3B9QA 1DAFA 3K0EA 3VAAA 1NY6A 4QGFA 5J4HA 2WMNB 1VCOA 3VHLB 1D2NA 3ADCA 3REFA 2PZFA 3KL4A 3KUCA 1JXOA 4IDQA 4KYUA 5FPYA 4HAXA 3BH6A 3MGCA 3U2QA 2WMOB 4A8JB 1M2OB 2UVQA 3K0AB 4ERNA 2O8FB 3MWYW 1V5WA 4Q02A 4EIWA 1KO4A 1G19A 3E2IA 2Z6VA 3FFBA 3KJIA 1M34E 2N42A 2JLYA 4LUCA 4GL2A 2OFOA 2AD1A 3AH8A 3PCRB 1COWD 1E9CA 2B92A 1D8TA 4DSUA 1UBFA 1XTSA 1Z6AA 5CDFE 5B57C 1ZIOA 1RZ3A 3QENA 4UQOA 1XD8A 1YQTA 4PZYA 4Q00A 3RRYA 1UKEA 2ZSDA 5KDLA 3B6EA 1WE2A 4V0ME 4WXPA 1DARA 3GMTA 1YZGA 1ZCBA 1N5KA 3L2OB 2EYQA 4XTCS 2CCJA 3SQXA 1KAOA 2ZJZA 3DKPA 3TAHA 1C9KA 2F6RA 4P4UA 4HATA 1J90A 1UJ2A 2A30A 4U02A 4C30A 2V6IA
chains in the Genus database with same CATH superfamily
2JFWA 4W9NA 2I5PO 4AURA 1PV1A 1J0DA 1M2HA 1NBEA 2OV4A 3M3HA 1K08A 2VSOA 4OKIA 1YS1X 2AJLI 2Q62A 3IIMA 1ETHA 5DXFA 1WUJS 2E89A 1Z6GA 4P3YA 3OVMA 2WVAA 4G63A 5IFKA 3R0JA 4ZQHA 4Z0TA 5IUNC 1E8DA 3F4LA 4ZDKA 5L4LA 3HGMA 3CW9A 5F76A 4BVBA 2O0KA 1E3MA 3DA8A 1BE8A 3AUYA 1JG4A 1O2DA 3JQ9C 3EOZA 1E79A 2VK1A 4FE7A 4PYJA 5ED0A 3WK5A 1ZH2A 1AIPA 4AP9A 4ZVNA 5K8JB 4NE9A 2VHYA 3EAFA 1YS7A 1VHDA 3R4CA 4XYGA 2YJZA 3FCYA 1NQUA 3PDIB 5ER6A 3W6UA 1BN7A 1QWOA 1XZIA 5JISA 1FQOA 3RYHB 4ZO8A 4TUYA 2Q07A 3JYQA 1GG9A 1N6KA 2VXCA 4WXHA 3ORSA 5CK4A 4NG5A 4BECA 3FR7A 1IATA 1MX9A 1ZUNB 3E8SA 4FP9A 4YB8A 2VDJA 4TUYB 5A2QA 4HNSA 4D1YA 1UPFA 4G8DA 4QDXA 5EAIA 2VPTA 1SMKA 2CNBA 2EDAA 2RGEA 3DBHA 3WLAA 3NHRA 3HL4A 1X2BA 4OHFA 5L40A 3GZTB 1ZRSA 2WD8A 1EFUA 1PW7A 2BUAA 4Y9TA 1PFKA 5H4HA 1KHHA 1NNUA 3D7MA 3TAXA 4TMFA 421PA 4XGNA 1ZMOA 3O8DA 5AW2A 4WA8A 1XA4A 3DXZA 4U2EA 2G88A 4QYWA 1QVWA 3V42A 1P6QA 4AP5A 4BMOB 1I1OA 4LY0A 4BQOA 2P1ZA 2O2JA 4FZRA 4QVGA 1G291 3P9XA 2JS7A 3FH0A 1HYEA 4NQRA 3HLYA 4S1NA 1I1QB 3T34A 4C89A 2VHWA 4D98A 1YVRA 1U3GA 1D5CA 1ZS9A 2ZCVA 3LUAA 2PMEA 3OOHA 4PZUA 1ZVKA 4PX2A 3ZUGA 2XE4A 4XYLA 1SUCA 3R3ZA 4MUEA 1TMGE 3BWBA 3WB1A 1TPZA 2QUKA 2AKYA 2PU7A 1XJ5A 2ONKA 5DYYA 5JSYA 5IAKA 2IF2A 5J2TA 1C7QA 4NZZA 3Q7QA 2ZJ1A 3KSDO 4N41A 3QMMA 5AW7A 3OFJA 4JU9A 2C2BA 2V9PA 4TWBA 4NABA 1XX6A 1I9CA 3RU7A 2EJBA 3RANA 4DNFA 3HEBA 1BS2A 2HA0A 1P7VA 1BS9A 2JJYA 1KEWA 2GERA 1FPMA 2P3LA 1ZSYA 1L4BA 2QPAA 2X4GA 3DL0A 3IOCA 4S1VA 3ELWA 4S0ZA 4BGIA 1YZ3A 4A8TA 2OHFA 4OUKX 2PXXA 4CTMA 5BV0A 2LKDA 5K3EA 4RK7A 5I4CA 3NBFA 1GPNA 2HGZA 1KO1A 1KQNA 2B1RA 4TQ9A 2HMAA 3A3PA 4JC0A 4GX1A 5E95A 3U7FB 5KU7A 2EV9A 1TMKA 5AXDA 4FGWA 4BE7B 3H9JA 1DTWB 4EWLA 3GLRA 1Z4QA 3A1SA 1Z06A 1UF9A 2GX6A 4ZRDA 5FI0B 1V48A 2WFLB 4W8OA 3RRNA 2HU7A 2F1KA 5HM8A 4C7BA 2VVTA 3H13A 1DWOA 1UPXA 3AR8A 3DOFA 3QUCA 2WG0A 4GRDA 1HMPA 4ID3A 2PLFA 2Y9MB 2NU8A 3WL6A 4QC2A 3WQBA 1XQXA 1PNRA 4CM9A 4P3XA 3BULA 1VIDA 4G97A 3R75A 1AKRA 2ZJ8A 1A76A 3BGIA 4BVAA 2B5WA 4AYXA 4NLLA 5DB4A 1XMJA 2F59A 5CT9A 1V6AA 5JZMA 4PYKA 2I71A 4ECEA 2KBEA 3F98A 3ZCUA 5J59A 3NI2A 4YIKA 3MAGA 3Q7TA 1WBDA 4B2LA 4C14A 1G6HA 1LF5A 4Z9FA 3PVZA 4Q3DA 4BLVA 3TTSA 3EY9A 2DC1A 3V1KA 4FVTA 4R68A 2QVXX 4PBTA 4A26A 1Q1QA 3GEDA 3LKDA 4LYEA 4W8HA 3NLLA 4W1RA 3EXIB 4YJ2F 1G3IA 4UDXX 4TROA 4EB0A 2EEPA 4ZRNA 5BN3A 3CXUA 4D4MA 3TVYA 1WLSA 3LHFA 1W0CA 5HUJA 1YDWA 3HBJA 4AS2A 4F45A 4OHKA 3PHBE 1N3BA 4RPJA 2HO4A 3L7MA 4EF5A 3TZCA 3HFJA 5JD5A 3R40A 2EJTA 3FKSD 5AJXA 5HXAA 2IKSA 3K5IA 4HVCA 2O2EA 5AOBA 2B2NA 3KWFA 1E2PA 2XTNA 4DCVA 2OGTA 3KUKA 4FMPA 1AV6A 5CVUA 3C4JA 3EYAA 2JAHA 1LS1A 3JU3A 3OU2A 3SY8A 1GOTA 4O4IF 1AKUA 2H5IA 5A06A 1VE1A 1RJFA 2I6SA 3PHGA 5IVKA 4FMDF 1P3DA 4UEWA 2ZYWX 1V16B 2VBCA 3NCHA 5KNBD 1PJTA 2XDWA 3AO0B 3E5RA 4H1VA 5TS2A 3EGDA 4UUQA 5K0LA 4ZARA 2PO7A 3MRSA 5M29A 3K4PA 5TF0A 1ZEMA 3WLLA 5EJ4A 2Q4BA 3DVAA 1ORRA 3S27A 2E49A 3ZCVA 4L0DA 5JSZA 2EZ9A 3A6PC 4YJ2A 5BW8A 1F8UA 1ONNA 2GBFA 3JZFA 3D64A 3WGQA 3KUXA 1S0UA 5H3CA 3U1BA 2AG6A 2BMJA 1PJRA 2O2ZA 2VHCA 1OGYA 4FQ8A 4PONA 1UDBA 4R41A 1Q0QA 1X15A 5JSZB 4QYTA 1BD3A 5BSMA 1R6TA 3QQ5A 4JI5B 5FEUA 3RV3A 3GDGA 1DADA 2CLFB 4RK6A 1UBLS 3RG8A 2WNSA 2WWYA 2SBTA 4U6NA 4ND8B 1PLLA 2QG6A 4JJ4A 4D4KA 4O3MA 2PGJA 3FXAA 2QQ5A 1TCVA 3RV4A 4QJ5A 1ZR2A 1V1JA 1ENPA 3R6GA 3IEVA 4H16A 5LBTA 3ZDRA 1E8MA 4YMTA 5BXYA 5FBVB 2CLEB 3MCZA 1XP8A 3HADA 4YCLA 5IWCA 1CQZA 2IP2A 1SEPA 3H17A 3JPYA 5F3RA 4TMKA 1HG0A 5IH3A 5KHAA 4K6FA 5TJHA 4BU0A 2C8JA 2E6KA 4C78A 1ND6A 4DSAA 3FKQA 4IJQA 1FB5A 2N9UA 4J3FA 5ALDA 2V7EA 3THYB 3PQ5A 1FTQA 1FU7A 1R6BX 3G59A 1NMYA 2JPDA 4TWRA 4R9NA 1MJNA 3JYHA 4QNRA 3UHPA 3L18A 1GYQA 3R44A 4LC1A 4YRJA 2WAYA 4FIDA 2YXLA 2P7HA 2QGNA 4ZAYA 1N2CE 1X9HA 3QU5A 1N33B 2DBRA 1ZSNA 4DCGA 1AD2A 2CB9A 2XWQA 1W93A 1KMIY 3I6MA 4R01A 5KYKA 1EE2A 1S2GA 3AQ4A 2YFQA 2Y4NA 2DF8A 5KYUA 3HDQA 4IL5A 3PRKE 4DXAA 3QVWA 1PV4A 3S40A 4DR7B 2RHLA 3GNSA 1FYVA 4OXYA 1GGVA 2P30A 1BSVA 1XK7A 1QGAA 1C8LA 2IHTA 1Z8DA 3AP3A 2XB4A 4YN3A 3FD8A 2GARA 1I7NA 4OMCA 3DLAA 3O83A 1G8MA 1YDGA 1LQUA 2VRNA 3N7UA 4U0JA 4FEEA 3V1YA 1RHUA 4JUFA 1JJBA 2NNWB 3GBPA 2ERXA 1SG6A 5I7UA 1ZBQA 2BGIA 2Q6TA 2DUUA 1L3IA 1UUFA 1X3LA 5CFRA 3DBVO 4AK9A 2FW9A 1MEEA 1GPKA 2YHIB 3AVQA 3PRJA 3QI7A 4OP1A 3WWYA 1NJ6A 3UUGA 4IXWA 2MOKA 5JXGA 4OGKA 1JFTA 1K6EA 3LS2A 2EZUA 3SOPA 1IWOA 1MABA 3EZNA 3W7VA 4K6KA 2C5LA 4DA8A 1XQVA 3L8ZA 3KKNA 3QMWA 4DW8A 1HKUA 2XADA 4R3WA 3FDFA 2WVHA 1DJPA 2VDVE 1G4AE 3JQAA 2WKWA 1DC6A 2YMPA 3P9PA 5FI5A 4X65B 1VYHA 3M6MD 4DXDA 4RMHA 5E2BA 2BBSA 1YRAA 2JFNA 4GP6A 5A6VA 3D6VA 2PH5A 2HCRA 2ZSUA 2FPGB 4U8HA 1WUYA 4D4GA 4IJKA 3DQQA 2OCGA 2WZDA 3DKRA 4ZAWA 4XGIA 4BRWA 3STHA 1KY2A 1L3BA 5TSDA 2ILVA 2K7ZA 4KX5A 3FJ1A 1IAQA 1MDFA 1E3WA 1B6TA 3L0IB 1FTNA 5AVRA 2F3SA 3BS4A 1NU6A 1YGPA 2IDJA 1W30A 4ZOLA 4QPCA 3HXOA 2XGOA 3IQIX 4LC9A 4WXMA 4WZAB 4LFBB 4PQGA 4BMCA 4RENA 1ZGZA 5J5AA 4DCSA 3X1XA 4PNEA 1CSEE 2ZUTA 3EAGA 1JHZA 1QNFA 3KPYA 3UATA 2PXCA 3JR3A 4YRPA 4ES6A 1M2OA 2P9YA 2ZRLA 3H65A 3K0AA 4WZBB 3LM8A 5FUVA 4BNHA 1MXFA 2CMKA 4IIFA 2OB1A 4RA9A 5JCJA 1CQJB 1TTHA 4R1NA 5A3VA 1PR2A 2D00A 5TNXA 1L9XA 2C3OA 3QH4A 4HQKA 4PX5A 4RDCA 4LVOA 4LDZA 4DUPA 2BEVB 1TA4A 3FHCB 3GF4A 2A1IA 4G4JA 3FF1A 4URWR 5DHRA 1Q12A 2WBLC 4PCAA 1I24A 2I1QA 1N6RA 2NW6A 1K0FA 1W85B 2VN8A 5TS3A 4W5OA 1G20A 4B32A 1JHXA 3I52A 4LJRA 4PZPA 1FDIA 2D5LA 5C4GB 3GROA 1Q0TA 4ZYYA 2FPKA 2AUTA 5M5BA 3OU7A 4KNWA 4UHFA 3F6CA 4X1YB 1Y9ZA 1HM5A 3OCZA 1A2QA 2NPFA 1QFSA 4AZVA 1KJYA 4EA9A 2A5FA 3EGOA 1V2HE 3AB3A 2OP1A 2FQQA 1A5TA 4RAQA 5EGNA 5CIQA 3ZQKA 2JGNA 2O8NA 1QTIA 3L01A 1KZ4A 1L5ZA 1U1DA 2WHEA 3O8LA 1S2IA 1FP4A 3FMIA 1R1DA 4H7FA 1P1JA 3B5JA 4JLNA 4B48A 1GZHB 3O3MB 2Q3FA 3CX4A 1EFAA 3B1ZA 4AN0A 3COJA 1DWQA 1VMKA 4PRKA 4FI3F 1XU9A 2DZDA 1NBAA 1YIDA 5LN1A 2P11A 2VI5A 4LIPD 3FCSB 4WTOA 3ASUA 4ZVLA 4NQZA 3DB1A 5K0SA 2JIZD 3PWZA 4KN6A 4P35A 5EZQA 1KSFX 2BFDB 3SR4A 5B5SA 2VDQB 2XKAA 2YRWA 2VK2A 1A72A 2BV3A 1BHO1 2G70A 2H2AA 3DCYA 3LBHA 4FR0A 1HKHA 3OTIA 4F3RA 3ED1A 2YY5A 4RMJA 1QGUA 4U9UA 5DYWA 1HR0B 3UJ7A 4FOLA 2CLOB 2PJUA 2V98A 4UU7A 3UKJA 3ZWOA 1PT7A 2RD2A 3VH3A 1DQYA 2C7BA 2RK3A 4I46A 1P75A 3HBAA 1GGNA 5AVVA 1J97A 2GJ9A 1ZJJA 4WLVA 3VR5D 3K0HA 3ACDA 1USUA 5JW6A 3ZZTA 2P9FA 2JC3A 1HTBA 2QAJA 2IZOA 4ACAA 5IS2A 2SKEA 1AKEA 2HFJA 2HRCA 4FSXA 3IV7A 3IESA 3QY0A 3E6AA 1F12A 2Z8XA 4LAFA 4KQCA 4BCDA 3JARA 3ZJ5A 1IHDA 4AO8A 3KFXA 3DLHA 3L49A 4HWRA 4ER5A 2CBXA 2FETA 2XRMA 3Q7IA 3HPQA 3A1NA 4IR7A 4KXWA 1NBMA 4S1OA 5LLTA 1F60A 3BXXA 3E23A 3HVUA 4G5HA 2E4YA 4G0VA 2IL1A 2R44A 4MZDA 2GAFA 4Q21A 2XWSA 3F2IA 5DWDA 2QN9A 3FYUC 2GJKA 4MRNA 3ZGYA 3E22A 1NMEA 4ALMA 4YXWD 4Y18A 1LK7A 1UAGA 1KZ7B 1U02A 4CYMA 4NAHA 4KMRA 5K6RA 2FZVA 2OBMA 1ZKMA 2ZI6A 4BO4A 1G7TA 2JAOA 5B58C 8OHMA 3IMKA 4S24A 5ADVA 4MRMA 1JR2A 5DXJA 3N86A 3G0CA 4LWZA 3IUBA 2Q1WA 4HDMB 4BKMA 3KWLA 3UHFA 2IW3A 4WY8A 3UWDA 1PEDA 3QKUA 3TTVA 2JA1A 4FGSA 2PUFA 3AY6A 3DPIA 3MNFA 1QVRA 1Z7EA 3H97A 2NO9A 2O3QA 5J4VA 4CQNA 1LSUA 3PUJA 2UZ1A 4C7VA 4GC5A 5ICGA 1ZUIA 2A33A 3SWWA 2C9ZA 1FFSA 1PIWA 1EVYA 1HZJA 2C4HA 3IC5A 3MAAC 3P52A 1RZRA 2XUDA 1DLJA 1VP3A 4G5XA 1X13A 4L8GA 4KFTA 4WK0B 3CRQA 5AJUA 5ESWA 2Y0BA 4RM3A 5K3DA 3ZBPA 5CDYA 3GC6A 1D8AA 5BMOA 2C9BA 4AUNA 1G8JA 4UQPA 1W2GA 3Q7EA 3A2KA 1JKFA 4BVKA 1OZFA 3ZU6A 4DILA 2EWMA 1EBFA 1N6IA 1DMRA 1GU1A 1SU8A 1JZTA 1M5UA 2D1RA 3AFIA 4JR2A 5E7IA 4QKQA 1JAHA 3UPTA 1HK7A 1TA9A 2IYWA 1TT7A 4ALLA 4OATA 1G5FA 2FMFA 3AEYA 4DA7A 1LH0A 1VB3A 1Y6RA 3PSAA 4LXHA 5ICFA 2A1UB 4DLTA 3SVZA 5SZKB 4N0EA 1MC8A 1XRPA 2G4CA 5CXXA 5ISMA 4YRGA 4Q7LA 1PNOA 4EGSA 2XNDA 1EUCA 2WPNA 3DMGA 3HGTA 2XUZA 3IODA 5CBPB 2FE4A 3X1WA 1C7FA 3RVKA 2VTKA 5DKFA 1YF3A 2H6EA 4FFOA 1QQBA 4NICA 4Y30A 5ARCA 1J2YA 3RIMA 2XODA 2OQIA 2C9OA 1EK2A 3ZE0B 1J1IA 1ZO8A 2FEOA 4I3FA 4JFRA 3ZHYA 3BJZA 5G4KB 1YOVB 3KKLA 4WCVA 3IILA 3T5CA 4N9QA 1V1RB 2WV7A 1MB0A 1M8PA 2X1VA 4PQEA 1PWYE 1TIPA 1W4CA 2H8KA 5B3AA 3VZCA 4DCNA 4RQBA 3V7NA 4LZNA 5JVDA 1USKA 4YRKA 3C43A 1NDQA 1U0HC 4N5DA 5EMLA 1NNEA 3H6GA 2VSQA 4ILKA 1T10A 3TD6A 4F9EA 1SZCA 5EMHA 1ZMBA 3CVVA 1E2FA 3ZWVA 3OZCA 5M7EA 1R8JA 2HA6A 2H4JA 3HI6A 3AEUA 3GIWA 4F4UA 3VJMA 4D0SA 1G7CA 1P2UA 2IHYA 2RIRA 2W2MA 2ATXA 1Y1KE 1R0XA 2E5LB 1G21B 3OO1A 5AJYA 5AKEA 3RS5A 3I37X 3KLBA 5JCOC 3L07A 1FSPA 1PTJA 2CZGA 2I6XA 4PSKA 3BMNA 4ER0A 2XE6A 2ZDGA 3HTXA 4HKTA 3WK9A 3MBIA 3O5AA 2GD2A 4N18A 1W1WA 2VL7A 1XKXA 4E5UA 4PAGA 4TN5A 3ITDA 1T5HX 4GOXA 1GUYA 4HWKA 1HSOA 1NUPA 4K9NA 2FW0A 4R84A 2IPXA 5CGQB 2AVNA 5C7YA 1X7WA 5IBPA 3HN7A 1QR2A 4WOCA 1H42A 1VZ3A 3OP1A 4LRWA 2CDBA 2IYQA 3CZRA 5TV2A 1OIXA 3EEOA 2ZOSA 1U11A 1LRJA 3F8SA 4JA2A 2W42A 3FB1A 3N74A 3UBMA 3L4JA 1VL6A 2QTWB 3I5UA 1NRJB 2B35A 1QV7A 1KEKA 3I05A 2GO7A 3GFBA 4DZRA 1V7QA 1EH5A 4CR7A 4IKPA 3JSAA 4PZLA 3W78A 1BDHA 2RIPA 3HCEA 5LP1A 2BE9A 3WGHA 4N0DA 1NVUQ 4I5GA 3ZNQA 1ZITA 4MX8A 5EESA 4EB3A 4DWJA 3CC8A 1CK4A 1PZHA 4B87A 1OT3A 3KVNA 1TI7A 4YDRA 4I1YA 4BNDB 4QOFA 3EQ7A 1M1NA 1W8DA 3B20A 2IE8A 2L17A 2HAEA 3J80A 3G5AA 3FCAA 2VT7A 4RGYA 4WJZA 1QO7A 1L7EA 4D6XA 3TI9A 1KK0A 3ZHBA 3C8ZA 3MTEA 2HIMA 4E5YA 2CWWA 4NY1A 2QX4A 4BYMA 3U4QA 5HVNA 3RYIA 3ZLVA 5D6OA 2FEKA 2RHCA 3C5HA 3ZCPA 1RCTE 9MHTA 4JYMA 4K6CA 2P6UA 2QZPA 3EAQA 1D2EA 3C3AA 3F3SA 4XDHA 2JEYA 3CVUA 2V0GA 4TLMB 1SXJC 4KVAA 1WNTA 2Y0PA 4DG8A 2HI0A 1HT2E 5C2JB 1A9RA 5FOVA 1D2HA 2V65A 3KSMA 3OE7D 2JCGA 4HNAB 4KWIA 1ZH8A 4L0MA 5T67A 4MMYB 4MYDA 3UY4A 2C9MA 3MJHA 4WLFA 2PCJA 1QX3A 5HDBB 3N53A 4TPKA 3F6BX 4O2BB 1G63A 2GJ8A 4JR0A 4TLCA 1PYOA 2QLJA 4KWTA 1TEXA 4YQZA 1EDEA 2LW7A 3HKBA 1XNGA 2MMGA 1N7JA 1MB4A 1O03A 3GRRA 2R1VA 3NJ4A 3TMYA 5L4NA 4OU5A 1N2HA 5KQMA 2QGFA 4ZT3A 1F7VA 1I2AA 2BGRA 1O54A 1F2DA 2QT9A 1MG5A 4HADA 1VKOA 2GZRA 3LCMA 4KN5A 4BATA 1YO6A 2R1VB 1C3VA 4MEJA 2Q5HA 3HBMA 4BFYA 4D46A 3K6SB 4JT9A 1TTPB 3HDGA 1FC0A 3ODGA 4JXJA 1XDZA 4IH9A 2UYYA 4M2LA 3W3AH 3GWGA 3EC7A 3EMVA 5TT0A 1T4BA 2WR8A 1JXMA 1RYYA 2G9ZA 2W0MA 3E82A 1OLUB 3MCVA 4MPDA 4U00A 5TEVA 3ZWWA 2ZQ5A 2YZNA 5F52A 4ZHSA 3X1ZA 1SGWA 3A6HA 5H9WA 2HU8A 4C4PA 5KQRA 3CUKA 3OFKA 2FMXA 4OSPA 1XSEA 3EGXA 4D0NA 4GSLA 1EIZA 1CUYA 2GEBA 2ZSAA 4RZHA 4ZV7A 3H1GA 5JQGB 4QVKA 5I8ZA 1KDYA 2O1EA 1Z0FA 3DXFA 3HFSA 4QAJA 1R8SA 4QICA 5BSUA 3WOHA 2VHVA 3B1JA 3CZPA 2IEBA 3I8SA 4O4HF 2DKFA 1P2SA 4GP9A 4LNHA 5BW6B 1HE5A 4RUKA 3LYLA 1GZ6A 4FHGA 4PHGA 1XLTC 2PBRA 1MDBA 5KSYA 3VM6A 4S35A 1FDVA 3R77A 2HDNB 2HA3A 3N1UA 4RVCA 2H5LA 1RM5A 1RW4A 3NUQA 4YH1A 3ROTA 4JBWA 4TMYA 1JH9A 1ZOSA 4DIFA 3FPCA 1WHTA 3D6UA 3T7CA 2TMDA 3DFFA 2ZAMA 1L3CA 2IU3A 4R2MA 3OTHA 4B43A 3AEZA 2HT1A 2OFXA 1BHSA 3T7IA 2GZDA 1IDOA 1I6MA 4WOKA 4B0OA 4WHMA 3B48A 4BO9A 1PGOA 4NAVA 5IBCA 2IZ1A 2GZ1A 2ZIVB 2YQ5A 4PLHA 4U1RA 1VL2A 4AQ7A 3K0SA 1UFKA 2I7CA 2WJZB 3BDVA 1YI0A 3U44B 3LK6A 3TTWA 4AP6A 3HK2A 3A1EA 3WMXA 2BI8A 1RXVA 2HWYA 1Q3TA 5KZMB 2GM3A 5AQ1A 4P7KA 2NXWA 2OVFA 1U3FA 3MJTA 4F8EA 5K7SA 5BR1A 4UMDA 3WMFA 5AT1A 1RAGA 3TZKA 1HV8A 2IDKA 2IU4A 3BE4A 4FLMA 5GV8A 4WZ6A 5FFNA 1G59A 1F20A 1RI2A 1L8OA 1RAFA 1SPBS 1W7AA 1ODFA 1CDZA 3NWPA 1I2MA 1WTCA 5PNTA 3G49A 2DUJA 4W5WA 5JTTA 3L7CA 1KVTA 4P0TA 3HVRA 3TLGA 4L3VA 1EFLA 2CZCA 3CZAA 4O5AA 3OJOA 1LLDA 4XFDA 4PC7A 1SBYA 1ENYA 1U5BA 1W2HA 2QNBA 3M9XA 4LOHA 4X54A 5B7GA 2JGKA 3LBNA 4QXAA 4FYMA 4KWCA 2OFFA 1YB4A 3WK4A 4PN3A 1H93A 4Z4FA 4DLSA 1VG8A 3ASYA 2GBLA 1KYVA 4TM8A 2QPLA 5EKTA 1QHGA 4AG5A 5HP4A 3W5AA 3GIDA 5IABA 2X1LA 1NVTA 1N75A 1FVHA 4ZKDA 2OK8A 2DLNA 5K4HA 4R7GA 4OQXA 2R8RA 2BGWA 4JP3A 1XZBA 5F7JA 3KVYA 1XVTA 6ADHA 4P0QB 3F6RA 1ZM7A 2IUFA 3PVSA 5C80A 4EY8A 4A23A 2WMYA 4BZZA 1B41A 4Q9DA 2AG8A 5G02A 4IG9A 1XMPA 1XQ6A 3I4FA 3HR7A 1J8MF 1BDJA 4TS1A 5AK3A 1KY4A 4MB0A 1C14A 4GW3A 4K9DA 4WKOA 1G5IA 1J7KA 3R3HA 4N01A 1H8EA 3E9ZA 4EMBA 1RJDA 2HLNA 2Z3WA 4H17A 4GOKA 3SSMA 2PL1A 3F97A 4H1TA 3AIKA 4Q4HA 5KHLB 1TFRA 2D4AA 3HS3A 4ITVA 3INTA 1TPYA 2PUVA 1UOQA 2WSLA 1Y63A 2V7QD 1ISGA 3QBJA 1G8SA 2OORC 4EMTA 1PJSA 1SC9A 2CNWD 2AI2A 3A2NA 3RLFA 2G36A 4JBNA 1DOZA 2C54A 4HFRA 4NCAA 1T6NA 4DIOA 4K1XA 3NEAA 2OCXA 1LPAB 3KZKA 3HUFA 4JB3A 1GTMA 1E7QA 4Z9XA 3RJ5A 1ZNYA 2I2CA 4ZXPA 2GBGA 1C1DB 3AV3A 1X8KA 2GK6A 4RY2A 3GLIE 4UE3S 4PLVA 4DSNA 2YHBA 3M3PA 4FFWA 3VGJA 4AZTA 3B6ZA 1VKZA 3EPLA 1Q77A 5CNMA 3ESXA 4IVNA 1MVOA 4EG4A 4FGUA 1H5QA 1DGQA 4WXYB 2PMFA 2JBAA 1GGMA 5CPBA 4EITA 4YP9A 3TQRA 3TRIA 5B6IA 1HNNA 4ND5A 1J23A 3LY5A 5T4BA 4RHTA 2X7XA 2XYRA 1C5KA 3F47A 1VSTA 3DMFA 4O6VA 1SBZA 3OTQA 4NH0A 4IDHA 2YVLA 4DDTA 1C50A 1R0RE 2JI7A 3ZJVA 4GEKA 4AMUA 4M1SA 3THWA 4JI4B 3AG6A 4IRMA 1YT5A 3ABQB 1AGYA 5EWLB 1Z8HA 2AXNA 1FRQA 4D97A 4Q1EA 5TVGA 4EP1A 3PC3A 5IX8A 4P8RA 3SBEA 3L7LA 1EZ1A 2NNLD 3H5NA 3U39A 5ALUA 3VPGA 1CJBA 4E3WA 5I9MA 1TJPB 2G8NA 5IT9A 5K3SA 5KVAA 2FZCA 2QRKA 1L5QA 2O1WA 3QE9Y 3GLFE 3Q3HA 4LBYA 1F3LA 2J0UB 4R8MA 4EHIA 5A02A 1VIMA 2CJPA 1Y37A 4JT2A 4CQLB 3EEFA 3T6KA 3VR6A 3UO8B 2J4FA 5K01A 4Y9RA 2WSMA 2Q1YA 2XYVA 2X0RA 2QHXA 5B58T 2YNMC 4RD0A 1EESA 1DRKA 2DWCA 2E5FA 2BD0A 3AVVA 4CQLA 4QXMA 4EJ0A 2EATA 2HNBA 4BNXA 1NW9B 2OO3A 3NAMA 3P9CA 4UNNA 2DFNA 1RWWA 2QAGB 5L53A 4XVHA 2YJNA 4IF6A 2X4IA 1IOWA 1SUDA 3U80A 1LLCA 3WWEA 5FLXA 4TKLA 3KR1A 3VKHA 5FX2A 3S7ZA 1E1MA 3JV7A 1UK8A 3QXXA 4GICA 4MW5A 3VO8A 3ERCA 3IVXA 2Y1OA 4RVDA 4GMDA 3DG9A 2VNJA 2WIFA 3VISA 1JVNA 1U90A 1XMOB 1QZXA 1T3HA 3QVSA 4GF5A 3ZPXA 1M1ZA 3B2EA 3ZS9A 3SEQA 4Q47A 4H4EA 3QX7A 4J4TA 5K4GA 1GZUA 2AX3A 4FI3C 1JQBA 1P1BA 3JD1A 1O94A 3VV2A 4PWYA 2GCGA 5LQSA 5KTRA 3L4KA 1X1SA 2UZAA 3LRTA 1T43A 2QAGC 1RKXA 2C42A 1TW2A 5EXXA 1MO3A 2H65A 1NXXA 1QQ7A 1NTOA 2W6ZA 1XRMA 2IYUA 4NECA 3CNHA 3C74A 3FYHA 5CA1A 4AY6A 1W4AA 2CJWB 1YJBA 2F64A 2YNMD 4YT2A 1BVYF 3QX9A 4MHOA 4LC0A 1RRGA 3A58B 1KDVA 3MXTA 1A3CA 2ET6A 2ZLBA 5FNVA 5GADl 2WU0A 2CUZA 3MWKA 5CA1B 3KKKA 1VC2A 1DEOA 1UINA 2GN6A 4KEAA 2RSLA 4LI0A 4FKZA 2W22A 3WWCA 3GLKA 5DULA 1RP1A 2PX0A 2RGXA 2EG5A 2W7TA 1TLLA 1EK5A 1U7DA 2H1FA 1IXRC 3K0CC 4QNMA 1CUZA 4QQNA 4A4DA 3C8UA 1P33A 5DH9A 1DP4A 1PFUA 1RHKA 3IP1A 4TYYA 2PBZA 3IB6A 4FR2A 1RPTA 3ASZA 4DA6A 1HNWB 5L3VA 2OD7A 2QLTA 4HRVA 4WSOA 3KZCA 4D56A 4DDMA 4X62B 1E7YA 1EWVA 5DEIA 3P4XA 5K0NA 1JBQA 1EINA 1WRBA 1BXRA 1EK0A 1LBIA 1Y4DE 3CLSC 3E1KA 1H0KA 3IKVA 5DFAA 3TIFA 3EUAA 2W2PA 1VBMA 3BD8A 1ZNWA 1DUSA 3PNVA 1T5TA 4KGDA 5F2OA 4B8YA 4BLQA 1NW5A 1OFGA 3H75A 2HIAA 5DP2A 4DT1B 5BVHB 4AZSA 4CDMA 2WWHA 4QU0A 2G76A 3SU8A 3BE5A 4IOLA 1IPHA 1YS9A 3EXHC 3QEMA 5C8DA 3ZY4A 3QX3A 4OM8A 1LSJA 3BORA 2IHNA 3F46A 3T38A 1DBQA 5B4VA 1Y82A 3GFSA 4Q4JA 5IC5A 3DMHA 5FWXA 1A9OA 2CL6X 1SAYA 1LVGA 2ZYSA 2OV6A 3LKVA 3UWOA 3EB9A 5AHWA 2J8ZA 4DG5A 3AVXA 5A5VA 1A4RA 2XH8A 3F9IA 5B64A 1E64A 1ZJ6A 5ICMA 4E1BA 4N6GA 4DLWA 2ISSD 5HZMA 3A6ZA 3LPNA 3CR3C 3RAEC 4C1BA 5BSWA 3FN4A 1KY3A 3JQ8A 3OICA 1XMXA 3C3WA 4MGIR 4YJ2B 3GU3A 1N5OX 1XCBA 2HXGA 2WHXA 2XOEA 4PW0A 3RFUA 3IAM1 4ITUA 3HCWA 4CLXA 1TZBA 3R76A 2PSFA 2WUVA 3JRNA 5KPJA 2GRUA 3A6JA 2NVUA 4NTZA 1HI9A 5CA1F 1SHZA 3RIEA 3HL0A 5JWRA 4LWQA 3K9HA 3E1SA 1PWEA 4E08A 2P9BA 4MLCA 1W5FA 2BSXA 2FPUA 2C94A 2JCBA 3W9YA 3TUJC 1NFQA 1EG2A 3HO6A 4JLPA 4MYTA 5CIYA 4UDOA 1GGFA 3KNZA 3I64A 3NT2A 2W5UA 3TDNA 4WNYA 2A5GA 3HJBA 4CQMB 1A97A 1QGZA 1ZISA 3S68A 5LMCA 5TMPA 3W2GA 2WYIA 4MCAA 4YMWA 2VP2A 4E07A 5CCXA 3S2SA 4L1KA 1FNSA 3U5TA 1W1IA 2FR8A 4MJLA 1XV5A 3JALA 1E2BA 1WX1A 3BSFA 1OHHA 3ADDA 3KOMA 2B2XA 1TMYA 4KCGA 1AX9A 4TTIA 2PKEA 5C3UA 1XNRB 1WU8A 5BYAA 4WDRA 1FFGA 3LWDA 3GPLA 4JBLA 4CW7A 1RBYA 1MO5A 2X8LA 2D2XA 3B6KA 2FKNA 2WKPA 3DVQX 3LGSA 4K6MA 4E6PA 5IHPA 3W06A 2UYHA 2VBGA 3F5DA 3RIXA 2FMHA 2H07A 1Z5VA 2K6GA 3U4DA 3GAMA 1KQ3A 2YUIA 3HR4A 2ZT6A 1OWMA 3NHYA 2NUAA 3CR8A 4XM2A 2OOSA 3AM4A 3DFIA 4RELA 1N0UA 4HY3A 4DFDA 1B3BA 3LZ6A 3FUVA 3GI1A 2CMHA 4MK4A 1GQRA 5DX0A 5EY5B 3PJRA 4MQEB 1HYBA 1DC7A 2OSVA 1SZDA 1QG4A 3OZRA 1XTUA 3KE9A 3KPUA 2R5WA 2YFYA 2D0PB 4AX8A 2V7VA 2QRPA 4P08A 2G9QA 3HB0A 3HKEB 2MTBA 3PQ4A 4QYIA 5L6LB 3N9IA 1JLSA 1N6LA 3L7YA 3AERA 3V4ZA 5I51A 3L0PA 5COBA 3V9AA 3WB0A 5CFOA 1T3SA 4KXUA 4TLDA 4B7AA 4GH5A 3GA0A 2YIJA 4EJMA 3KJZA 3BTSA 5BWCA 5L9AA 5BP7A 1A77A 3HJHA 2NMVA 2C1ZA 1C9MA 1MB3A 3TIXB 5IK2D 3QTBA 5KC9A 4PF1A 2QM7A 1P31A 5FI3A 1TAUA 2I34A 4Z8YA 4IMRA 1L4EA 4JP2A 2WILA 4MS1B 3EEQA 4E1VA 5LXTA 4H3SA 2A67A 3BOSA 5DT2A 4JV5B 2J5BA 2XQGA 3CBQA 2GKSA 5BSEA 2OCPA 1POWA 3DEKA 4IDGA 4FMDB 2I8CA 1JEQB 4DR2B 5HK8A 1OFUX 3CMMA 4P86A 1MC4A 5AI5A 4P3NA 3HKDB 3VJKA 1CUCA 3RVPA 1Z6TA 4NHEA 4BX9A 2VJLA 1U1EA 3GQVA 5EUCA 1RIIA 5JXIA 4UCFA 1OX6A 1DKLA 3HYSA 1FVXA 3RSHA 3C41J 4NJEB 4QOSA 8LDHA 3N2GA 4U9IS 3T5TA 1X14A 4RVUA 5AUNB 5FPTA 5KWEA 1EGQA 2HUPA 2PZKA 3FSEA 1ZN8A 4J8PA 4QTZA 3IJ5A 1M5RA 1PD1A 2B36A 2X2PA 3QFSA 3L8DA 4NZPA 4FFPA 4TMXA 3S2ZA 1X1QA 4ZHQB 3QA3E 4D81A 1CY4A 1CY8A 3SKYA 1EM8B 1GILA 1GPMA 2IGBA 4PQYA 5HIIA 4H0NA 3IJRA 2JKYA 3L4EA 3PPIA 3I1IA 2E85A 4G09A 3AONB 2VHQA 5J40A 3OHMA 1QKJA 2OGUA 4F8JA 5J4KA 2VCEA 3MFQA 3ZK7A 5CDGA 4EATA 2I91A 3DP9A 4Y6GB 2QTZA 4UBJA 2JD1A 3MSCA 5F64A 5JSKA 1YI1A 4BBAA 2VJMB 4ID9A 4C7KA 3GV0A 2O3JA 2ZITA 2P0YA 4AZ0A 2AC7A 3I5XA 4OB8A 3AM1A 1EDBA 1VRWA 1RJEA 3FNHA 2CLLB 4NIMA 2YYSA 4DTIA 1BW9B 2IBSA 1GNPA 3I32A 4Y6SA 1HY3A 4HNVA 4B3MB 1VJCA 2VRCA 4KDFA 4LOKA 4I4TB 1G3MA 2HHAA 2IV7A 2DLCX 4BC0A 1V47A 2BJHA 4W5HA 2VF2A 3K15A 1F2TA 1IZYA 4KPGA 1O1YA 4X1KB 1RYFA 2CXRA 1L7QA 4YGXB 3RIHA 2FWRA 1FYXA 1GSHA 3DDOA 4O2AB 4A73A 1G5TA 1CUVA 2AE2A 4Y3UA 4EX7A 5HZHA 4AN4A 4MVJP 4PTLA 3T9FA 4Q03A 4ND2A 1K7XB 1V41E 3TL3A 3TECE 4X1KA 3C3CA 1DL5A 2ZWVA 1PJLA 2VKQA 3D5TA 1VPWA 1VGQA 1DDOA 3IDSA 4FBGA 4INPA 2ORIA 4GDFA 5IAGA 2V7BA 1XZPA 1IBCA 4J1SA 1ZIYA 1H85A 1UBGA 3EN0A 3Q9NA 1DKQA 1FP7A 5KJ6A 3GLTA 2WSYB 4DSZA 4GKAA 4H4DA 1ODKA 1T4CA 1NJGA 1XN4A 2EFEB 3LLCA 1E1LA 1MO4A 3Q40A 3UMBA 4BCCA 2Q3DA 4ADSG 4TYWA 2Q28A 1INLA 2YV4A 3KOXA 1GTL1 1QP4A 4KR3A 2QL7A 2AB0A 4LXGA 4N8EA 2Z04A 3U7JA 1LVUA 2DLDA 5FWYA 3O3OB 4IIEA 3NJ8A 1BYIA 5I7EA 2A3NA 3ZW7A