4DT1B

Crystal structure of the psy3-csm2 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
211
Chain Sequence
LKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVYPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 60
structure length 211
sequence length 234
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1B00
3ASYA 3WBKA 1K5GA 5BN5A 2VP9A 4FMDF 3SC3A 4F7WA 4PHTA 4TSFD 2ZU0C 2PEZA 3GJ5A 4MRVA 2CJWA 3MJHA 4LJ9A 1LS1A 2QQ0A 4NYJQ 1A4RA 1GL7A 2QPAA 3SFVA 4AKIA 2PMKA 3GLHA 4BWYA 3E70C 3N2IA 1CP2A 2R44A 5TDHA 4ARZA 3KTAA 1SXJC 1Z0JA 1XJCA 1SXJE 2CHVA 2GEDA 4IVQA 5FFMA 2LCFA 4DXAA 4PQRA 1XPOA 1KY3A 1W4AA 4FMCF 2FZLA 2PMDA 2E87A 3OEEA 1OFUX 4PX9A 2GNOA 3T61A 3ZIAD 1W4RA 3IUYA 3AH8A 1WBDA 4UKDA 2BDTA 3SQXA 2EYQA 5JHHB 4Z1MA 4YMWA 4WBSA 2QGZA 5EZ5A 1Z0DA 3LY5A 4NDZA 4V02A 1HYQA 4TSFA 1KDRA 3VAAA 1YR7A 5JWOA 2NO0A 3A4LA 2GXQA 3FMFA 3GJ6A 1KK0A 3SJBA 4AY2A 2GF0A 1IXZA 4XOIA 3UANA 2V9PA 4LC1A 2NOAA 3OIWA 4M0LA 4PC6A 1JR3E 4UXJA 4BFZA 2PT7A 3AVOA 1KAGA 1R6BX 5DI9A 3UK6A 2Q9AA 4CGZA 1RFLA 2BEKA 2C2HA 5F9HA 3PITA 1FPMA 3MG9A 2Y8EA 4IDOA 3NC0C 4Q4JA 4KVAA 2XEXA 2GK6A 3K1JA 4QNRA 1XPRA 4LOAA 1P4SA 4NYIR 2J7KA 4XSGA 2AD1A 4Q1FA 1P2SA 4B32A 4BECA 4RD4A 4C0KA 5B57C 5G3ZA 1EFCA 1G9XA 2QGNA 3KXKA 4OHZA 3THOA 1EESA 2P65A 4M1OA 4OKSA 4RY2A 4DLSA 3RRNA 4IFBA 4LI0A 4LX0A 1Z0FA 2WSSA 4NYMR 3NBXX 3QVUA 2CNWA 3K8YA 4JLOA 4BEBA 4EPXA 1G5RA 1R5BA 2Q9CA 4PC7A 2N42A 3NDBB 1Z6AA 2OFXA 5DYGA 5E7JA 1YZUA 2BC9A 2DY1A 3I92A 4DZZA 1W2GA 1ZCAA 2CLCX 3AV0B 1CR0A 2GETA 2IYLD 4I1OA 4O2RA 1W0KA 1Z6TA 2CK3D 4JSYA 5G40A 3ZVLA 3Q85A 4V0NA 3QXHA 2AFHE 1KSFX 2XZLA 5TARA 4M8NE 1KI4A 4KBGA 4OYHA 4C0LA 3DZ8A 2JGNA 2ZI7A 2ZU6A 1I2MA 2QM7A 4MDFA 3U4QA 1T9HA 1XDBA 1K8RA 1DPFA 4ARZB 2P0EA 4CF7A 4LHXA 1S1MA 1UF9A 1XCGB 2ZSDA 2PX0A 5KOYA 1NLFA 2J1LA 4FCVA 5EJEA 3V4RA 2UZ3A 2P67A 2GXSA 2X19A 3AF3A 4HLUA 2ZVPX 3OAAA 1IY2A 2QRNA 1OXSC 3KQKA 4TT3D 3BJIC 4DDUA 3WYGA 2CK3A 3IILA 1N5JA 5HTKA 4BEJA 1W0JA 1J7KA 1NMZA 4BFYA 3AVXA 4PHFA 2Q9BA 5EE0A 2O8EB 1XB2A 2EVWX 2ORIA 3AVWA 5AJWA 1R4AA 1E96A 1YRAA 2BM1A 3AUYA 4AKGA 2GF9A 4R7ZA 2FNAA 1E69A 3QIAA 3B78A 4TYWA 4LBYA 2O0HA 1KAOA 4LZZA 3ZYCA 1UPTA 4KAXA 2V6JA 1RE0A 4Q9HA 3L0SA 3ZVMA 1JAIA 2PZEA 1KY2A 3H84A 5CJ2A 4D4MA 4AK9A 4DC9A 4GRAA 4LYHA 4ZDWA 2ONJA 3S1AB 4B34A 2O8FB 3X1XA 1OYWA 1XX6A 2CVFA 2J9RA 2LKCA 2EW1A 4C3ZA 1W36D 4HI0E 4ZI2A 1XEFA 1E2QA 1Q1EA 2G0TA 3B9PA 3B60A 3KZ1E 1D9XA 5C2JB 2NO7A 2OO7A 1TADA 3L0IB 3QVVA 1P2TA 3NH6A 5DN6D 1OH7A 2OHFA 2JCSA 2JASA 2P6NA 2QENA 2VP4A 2YJTD 2V55B 1JQLB 3W3AA 2O8CA 2VYFA 1DBSA 1SXJD 3GJXC 2V6IA 1I2DA 1YHNA 4M22A 4MGYR 4W5WA 5L3QA 2W83A 3C5CA 4MH0R 3U61B 4Q48A 4D2IA 1F48A 2ZI9A 3VKGA 3KQNA 3AVUA 2HT1A 2ZR7A 1G7CA 2ATXA 3U44A 1HY3A 5EXPA 1KSJA 3BC1A 4JZKA 3CONA 2AFIE 2LKDA 5CLQA 2ZRCA 3A58B 2I1QA 3TVDA 3HWSA 1YKSA 4L9SA 4Q02A 2NO6A 4GZMA 3MWKA 4BLRA 1Q57A 1R0XA 1HH4A 2OCAA 3GEHA 4KI0A 5UKDA 1GOTA 1HT1E 4OQLA 2DCUA 2OBNA 2C04A 1M8PA 2EFCB 1GSIA 1UAAA 3SR0A 5KPJA 1OPXA 1S1CA 3LX5A 4I1SA 1XJ0A 5DYIA 1FP6A 4QHTA 1KO1A 1KI3A 2L0XA 2XOKD 4MDEA 1L7VC 2GVZC 2IEZA 1HE8B 2FEOA 1IOZA 1M74A 3NBFA 4IVRA 1DADA 3DZDA 2BV3A 1QVAA 2VF7A 3Q5EA 3MGCA 1AKEA 4JKIA 3FGNA 1OFHA 4LBZA 4YMSA 1QG4A 2R8RA 1N0UA 2R6CA 4TL7A 4Q4HA 2Z4RA 1AS0A 2ODBA 1MOZA 3PUXA 4JT4A 4DHEA 1YZTA 4AG6A 2XITA 4D81A 5JLJA 4NP6A 2HYIC 3SZRA 5BW8A 3I4LA 1BYIA 1V43A 4MUBA 4PO8A 4D0LB 5J4YA 4GI7A 3DM9B 2FFAA 1YQTA 2JJ1D 1XD2B 3C14C 2G1KA 3QSYA 2OAQ1 5JFGA 5FUWA 2H16A 1M7GA 1VPLA 4D4KA 2DFTA 2OE2A 3D7MA 3MFYA 3C5HA 4B3DA 3U60B 1KZGB 1OIVA 3Q9LA 1DAIA 1XMJA 3FMPB 1NSTA 1XTSA 2PBRA 4CW7A 4YMVA 4P3YA 4URXR 3ZIAA 2IXEA 3EC1A 1OV4A 2J45A 5F2EA 3UATA 4CIDA 4XWKA 4XTCS 2GEVA 5TVKA 3J81k 2F9MA 1MRSA 4U5XA 3ND9A 4WA7A 3FKQA 3MD0A 1O87A 3OESA 2W58A 5FOVA 2QMEA 4CT5A 4Q1BA 4KXFB 3QQ5A 3KB2A 5DI3A 1IXSB 2DYKA 3JVUA 5K8TA 3BRWD 3VR2A 4U00A 1P9WA 1RJ9A 3KKQA 5FR2A 4A2WA 3BXZA 3UKDA 3LX8A 4TLEA 2ZRLA 3ADBA 1E2DA 3ADDA 3ADKA 1TU4A 3BB4A 4JMPA 1ZNXA 4B6EA 4DLZA 4RD1A 4I99A 3EASA 4BRUA 4JLVA 3CH4B 2BIFA 1OFTA 4PO9A 3FKSD 3TLXA 4M1YA 2YC4C 1SHZA 1SGWA 2DWQA 4TQAA 2NG1A 4MKGA 1IN8A 4G5QA 1Z6XA 4M1MA 2QT0A 1TX4B 4DBLC 3MLEA 4LHVA 4F4JA 1P60A 2HJVA 5CDFE 1XD9A 4C0JA 3OFND 4TLCA 1FW6A 4W7SA 1V5WA 5C4GB 2EFGA 4YXWD 2B92A 3DMDA 3TRFA 2ZS9A 2A3RA 1XEWX 3QG5A 1CF4A 1KOFA 3BGWA 1BOFA 2IUUA 1KMHB 3LBNA 3NVAA 2NPFA 1E9AA 1E9CA 2ZI4A 2ZRJA 3ICQB 4OQMA 4DSTA 5JMTA 4RKEA 1NG1A 1D8TA 1AA9A 3AF0A 3LO5A 3HU1A 2RB4A 2R9VA 2FGKA 2CL6X 2YWEA 5EXSA 4FINA 2VTKA 4NCKA 5EP2A 4M9ZA 2WZQA 4E09A 5A4JA 5B2ZA 3TBKA 1VIAA 3NHBA 5D3MB 3KL4A 4PC3A 1OJLA 2D7CA 3M0EA 3OFNA 4CT4B 1PLKA 5KSOA 2GRJA 3C8UA 4ASUA 1CR4A 4HLDA 1G6OA 5DI3B 3QE0A 1UBCA 1FQJA 1ZUIA 1KNXA 2GCOA 3LH5A 3CPHA 1GKYA 4UXIA 1NJFA 1NVXQ 2ZS8A 3SOPA 4C0SA 2YOGA 4X8MA 2OBMA 1VIYA 3CF0A 4M1WA 1G4AE 5SZHB 3GLIA 3SYKA 5AJYA 5DIFA 1CJVC 3AP2A 1U0JA 2GCPA 4JVMA 1QHSA 4LPSA 1NNEA 1FTSA 1Y3AA 3HJNA 3HR8A 2IS2A 1R10A 1TAGA 2EWVA 1A82A 1RVDA 2WPDD 1F2TB 3NC1C 1ESMA 3TK1A 2WICA 1LV7A 4TMXA 4JBXA 1NL3A 2P6UA 1OH8A 1NRJB 1KI6A 3KQHA 4A36A 3IIMA 3TW4A 2BMDA 521PA 3HU2A 5FL7A 1SXJA 4OJKA 1T3SA 2RAPA 3SJCA 2W0MA 2A5GA 5EE9A 3D8BA 1E32A 2I1VB 1U8ZA 1G6HA 4EQ6B 1RRGA 4MKIA 3HPQA 3L8YA 1G7TA 1Z0KA 1E3MA 1WP9A 1IY0A 1RKBA 2FF7A 2BCJQ 2VRWA 1AM4D 5D3MA 2PZFA 5KYKA 3QF4A 2AWNA 4HATA 3IQXA 3BS4A 3G0HA 4B3XA 2YINC 1IJEA 3AVQA 4HB0A 2VSOA 4B35A 4EDHA 5HE8A 3NIBA 4CVNA 1GRQA 5E4FA 4JL5A 2H7VA 3WMEA 4AYXA 4HAWA 4G01B 4TYYA 1LY1A 2XOKA 3IKJA 2WJJA 4TLDA 4Q18A 3G82C 2VSXA 3A8TA 3E5HA 1E2LA 2GJ9A 3QXCA 5JWHA 2WBLC 1IBRA 2Q0HA 2RKOA 4Y0VA 4B3FX 1NY6A 621PA 1DAGA 1W47A 1W36C 1SKYE 2EFEB 3LW7A 1OFIA 1W1WA 3HYTA 3WMFA 2F1HA 3CR8A 2VSFA 1E98A 1KO5A 1CU1A 3A1UA 1JJVA 4UJ5A 1AKYA 5A0FA 4AKEA 2H8KA 2WAXA 5FH9A 2ZRGA 3CPEA 5DSZA 3VKWA 4Q4LA 1SVKA 2AHOA 2IUTA 2BBSA 2XJ4A 3IIJA 1IHUA 1JPJA 2CCGA 4MRSA 1X1SA 3FFAA 3PUZA 4TMVA 1RYHA 2J87A 3LD9A 1N6LA 2YNMA 4IFEA 4EQ6A 1OYYA 1FMLA 3PUVA 2YVUA 1AZSC 1Q1ZA 1DAHA 1GM5A 1W5TA 4LGMA 2F55A 1G16A 2ZRAA 4TQUS 2MSDB 4PSAA 4D0NA 2WIBA 5EP1A 1I4TD 2ZAOA 1XEWY 4PC2A 1M34E 3U6KA 2ZYTX 4HLUC 1JR6A 1UM8A 2FFQA 2I4IA 1S0UA 4LCBA 3VNVA 1QHGA 2GESA 1NKTA 4DCTA 4RFVA 3T1TA 3UG6A 2QSYA 4F4IA 4R2HA 5KPDA 1GRRA 3P27A 1GITA 1G8FA 2UZIR 1DO0A 1KYIA 2MSEB 2BKUA 4FCTA 2IS6A 2LWIA 1G8GA 5FPHA 4LJ5A 1LTQA 3Q7QA 3AGPA 2IYZA 4HB4A 4LYFA 4R2IA 4QBFA 2WWWA 4JLDA 1II8B 2ZROA 1LVGA 1DAFA 5GJVC 3W5IA 3BE4A 3WXMA 3D3QA 3GCGA 2J0SA 1AN0A 1CKEA 3FMIA 4ERNA 3KJGA 5KHOC 3GLFB 1E79A 3HDTA 1S2MA 4N0EA 4ZCLA 2WWFA 1PLLA 3QG1A 1WF3A 4KSCA 1TF5A 2ZUBA 4NBSA 3I72A 1N6IA 2PCJA 3PV0A 3REFA 1A5TA 1P62B 1Z0IA 3AP1A 2RHMA 4YDSA 1Z22A 3ZQ6A 3A1VA 2G88A 4EPWA 4OK3A 1H8HD 3O8RA 4M53A 1XMVA 3PG5A 3ZZTA 2C77A 1NI3A 2IW3A 2J5XA 3BERA 4EFNA 1KI6B 1ZM2A 1XFAA 2VBCA 4FW9A 4L8GA 4BUJA 4URWR 2CL0X 1IN7A 3LAWA 1GUAA 2GVDC 2YV5A 5E3HA 3UWKA 1HQYE 2OCPA 4HYYA 1JXOA 4NYJR 3ONWA 4BFXA 5FPKA 1VECA 1N6KA 2V4ZA 1L4UA 4PAMA 1KIMA 2KBEA 2QEQA 2HXYA 3TMKA 1K5DA 1W4BA 4PPQA 3TH5A 2IYWA 4LJ4A 1SQ5A 3W6OA 5JJLA 1R5OA 5EXXA 3DPUA 5CITA 2QP4A 3K9LA 2YHSA 2DR3A 3KJHA 2F7SA 4BZXA 3VX4A 3V4FA 4D4JA 5HPYB 2KSQA 2ZSEA 1X6VA 3P4YA 4LJ8A 2XZPA 2XXAB 4BLSA 4DWJA 2CVHA 2OLKA 5H8WA 5FTNA 1XXHA 4F4CA 1M7BA 4DSUA 4DKXA 3GLFE 2JLXA 2QQEA 1QHHA 4JLNA 3IHLA 2OXCA 3W90A 1EFTA 2DFKB 3ZLJA 1KKMA 3EIQA 4RVCA 4CEHB 3Q8XB 4ACAA 5J4LA 4X8HA 2W0SA 4HZIA 4OHWA 1J70A 2W2VA 4NH0A 3RS2A 4RCYA 2IS4A 3I5XA 3KJIA 5JRZA 5FUVA 5FI1B 1N5LA 4WIAA 3THWA 2Z43A 1X86B 4NZYA 4ZKEA 4Z1MD 2K5UA 1L2TA 1R7RA 1E2IA 3AKDA 3LFUA 4HUQA 4N1AA 4I1VA 4QC2A 4UNNA 2O0JA 3VHXA 3THYB 1G3RA 1U0LA 2Q3MA 4QXAA 2V1UA 3TE6A 2QSZA 1X8KA 3JZAA 1R2QA 1A7JA 3CPJB 1E1QD 1KZ7B 1G4UR 1DARA 2F43A 1KK3A 1XTIA 5K8UA 2GJKA 2OFOA 4V0ME 1EFHA 1UEJA 2EU8A 3P1JA 2B8TA 2RGBA 3OZXA 2HJGA 1U8YA 4KU4A 3O8BA 2ZM5A 1E0SA 2OEPA 3C41J 1R8QA 2Z83A 3OE7A 4HUQB 2WHXA 5DNYB 1SVOA 3CB4A 5GJWC 1HTWA 1UEIA 1D2NA 1P5ZB 1TQ6A 5JEDA 4HLCA 3RHFA 3PIRA 5H1YA 4NYMQ 4EJSA 4U02A 5LB4A 5IK2D 3NKVA 2JJ8A 3N70A 3RDPA 5P21A 3AQ4A 3AM1A 1C9KA 1QHNA 3KDSE 4Q1DA 2ZJZA 2CCKA 4RD3A 4ASUD 5JBQA 3A6PC 3BFXA 3K70C 1DAEA 2JEOA 4BZPA 3H2YA 1RYFA 4G5OA 4CEHA 4URUR 5J4VA 4YMTA 1NVVR 2FU5C 2ZRBA 1NIPA 4V0LA 5GVRA 3SS8A 3T1QA 4DLVA 2GK7A 3IDQA 3Q3JB 1KDTA 2QU8A 3SHFA 1E9DA 1RIFA 3EWSA 1F3OA 3TVTA 4DDWA 2ZJ2A 3GQBA 1HQCA 2ECKA 2ZETA 3GJ3A 5IDVA 2WWYA 1ETUA 2GJ8A 2ZRDA 3I32A 3SHWA 5JECA 1OT3A 1YZNA 1SVSA 1Z29A 2V8OA 4PC1A 4PO1A 5JS7A 2WKQA 3RANA 3QKRA 4ZO4A 3K0AA 2XTMA 3ETLA 3SQWA 2QMUA 4F91B 2PH1A 4BFTA 4I1UA 1PUJA 4BGDA 4QGAA 4IEEA 3P26A 4JKYA 2YC2C 4HDQB 4IOMA 2QPOA 3K09A 3KX2A 2RGNA 4V03A 4DCUA 1VCNA 4E5UA 2FMXA 4TYNA 2A5DA 1G8HA 2IWHA 1KK2A 3VFDA 2CEAA 4FMBB 1DAKA 1XEXA 1CEEA 4TN1A 5BWMA 3PJRA 1Q44A 1E2KA 4D82A 1RRPA 2A9KA 3EARA 1BYUA 5FOSA 3EC2A 3GEEA 1NN5A 1P3JA 4B6FA 2MMCA 2W6IA 3BAFA 1CULC 3JVVA 4A1FA 4B3BA 2BEJA 1JXMA 2CLSA 1ZM9A 2VHTA 5LPNA 1US8A 3I8SA 1AS3A 1OXVA 1SXJB 1DEKA 2FSIA 3IBGA 4WXRA 2RGEA 4B73A 5AUPB 3U3OA 1Z06A 2HLDD 4JIMA 1E2NA 5JCZA 3WMGA 3E1SA 5JI2E 2ZI6A 4AKHA 3KB1A 2C99A 2IT1A 2J0UB 2VA8A 2FOLA 3IEVA 1MKYA 3MMPA 2ZRPA 1E79D 1MABB 3C16C 2YWFA 2AXNA 1JJ7A 4RZ3A 3CF2A 3X2SA 2C9CA 2D62A 2X8AA 3RC3A 1EGAA 2WVJA 1ZMXA 4HDCA 2QN6A 3AKEA 1CLUA 4MRNA 5DO9A 4OI4A 3UMSA 1S9HA 3K9HA 1QZXA 1OF1A 1HURA 2JA1A 3CUEF 3NEJA 4QFMA 4NCIA 3TAHA 1YR8A 2OILA 5KO2A 4DEYA 4MRPA 2VP5A 2O0KA 4JS0A 4A9AA 1QHHB 1GVNB 3EA0A 2X77A 1ZC3A 2Q6TA 2KI5A 4ZIRB 4NL4H 2N1BA 3LNCA 2ZE7A 3EZ7A 5K8LA 1VYTA 2WWGA 3FWYA 4KCGA 3BK7A 1HA3A 4CEJA 3ZDQA 4PSVA 1W5SA 5G3YA 2EQBA 4DT1A 5TB5A 1Z3IX 1G41A 4OI2A 4TTRA 1YZGA 1IQPA 1KHTA 3DMNA 4HAUA 4YQFA 2GAOA 4Q1AA 2UVQA 1H8HA 2WWXA 1G8PA 5JS8A 2R2AA 2ODWA 1NN1A 3QBVA 4F92B 4IXNA 4DSNA 3O8DA 3QI2A 3DKPA 1PZNA 3DVLA 2JLZA 3EXAA 4LK2A 1U90A 4US0R 1F60A 1GDDA 1P75A 1N25A 3BWDD 1G21E 2ZI3A 5FL3A 3IBYA 4TYQA 1DELA 1D2MA 2OUKA 4RJLA 1NKSA 3FKSA 1US8B 1G18A 4OK6A 1T5IA 4GP7A 1VTKA 2AX4A 1GKUB 4Z8XA 4AD8A 4WXPA 4C9BA 2QE7D 2VHJA 5JHGB 1DS6A 2WWHA 4XSHA 4GT1A 1UKEA 1Z2AA 4D0GA 1E9SA 2VQSA 4UNPA 1VYUA 4KBFA 3WP0A 4QJ5A 4P33A 2XSZD 2XJ9A 2GXAA 1Z6GA 4KYUA 4MKHA 4QM6A 1XEXB 2OV2A 4JVLA 3RS0A 2EFHB 4Q47A 1EFRA 4L4UA 1X8LA 1OB5A 3B2EA 1LFDB 4C2TA 1W44A 2JJ1A 3T5DA 3GLHE 1IAQA 3RVBA 4TMTA 2CNWD 3EX7C 2VEDA 4LHWA 3VU9B 4ZV4A 3OEED 3K0AB 3SJAA 2FDCA 4JBYA 2OM2A 2IYRA 1FOEB 4G1UC 3EIEA 4RSGA 4DCNA 3CR7A 4A0HA 3B1XA 1ZU4A 1FP7A 1GILA 2BMEA 3EZ2A 4Q9IA 2FA9A 3L2OB 2H5EA 2C95A 3B1WA 5SZKB 1JI0A 3R9WA 2QROA 2G0NA 3LW8A 5HZHA 1N6OA 3U7FB 4QGHA 2DB3A 1GG2A 3KKOA 2QORA 5TV2A 3GMTA 1QHXA 2IUSA 1BO6A 1M1YE 1Z07A 3SBDA 1KI7A 1KI8A 2NPIA 1N0VC 3QKSB 3U3RA 2W2TA 3L0PA 1Q1BA 4LHZA 1ZYUA 1VG0B 4NU0A 2ZE5A 2VHCA 3MWLA 2ZYVX 2ZREA 3LXRA 1H65A 1KO8A 4GPTA 2QBYA 1TEVA 1GNPA 2DWPA 5JEEA 3BD9A 2RGDA 4EJSB 3K53A 3LQRA 3KXLA 1XP8A 1AQUA 2IS1A 4X8LA 1XRJA 4US2R 3PUWA 4ZI3A 1ZM7A 3SFZA 2IHYA 3QNUA 5AK0A 3A4MA 4IRUB 5KDLA 1WRBA 4II7A 2G83A 1E1QA 2G6BA 2HCJB 3GP8A 4PZZA 4US1R 4L5BA 5CM8B 3L82B 4P0TA 2VHUA 4A8JC 3TUZC 4A8JA 2ZRHA 1CJMA 5KNCA 3GLIE 2BBOA 2QZ4A 2HCBA 4K8OA 5J5CA 3GLGE 4B47A 3P32A 1G7SA 3ND8A 1VDZA 1ZUHA 3OIUA 4HAXA 1DTSA 5JJIA 2GKSA 1MH1A 3AEZA 3QF7A 1FNMA 3TQFA 3GLGB 4TQ9A 3R7WA 3RSLA 2VF8A 4TYPA 1JAHA 4ZKDA 4NTZA 5IF9A 5B64A 4R71A 1G7RA 3A36A 3UMRA 3SE0A 2Q3HA 4DLWA 2W6ID 1G19A 5CYOA 4QHSA 5JSZB 1G5PA 4IDQA 5KTYA 4Y0AA 4PHGA 1RRCA 4RCZA 1GIAA 1T8UA 5KSZA 1P2VA 2Z5FA 3NBYC 5EUMA 2O8CB 3NG1A 2CJWB 2RGGA 4WVFA 4NCNA 3QEJA 5DHAA 1SKYB 2XTNA 3W8RA 1RC8A 4KSBA 1XZQA 4W5HA 4NONA 1OLOA 1T91A 4K46A 2PCLA 4AI6A 2PEYA 1XTKA 3MWJA 2BMJA 1FFHA 2QNRA 4DUGD 4HB2A 5G41A 3CRRA 4ITRC 1WCV1 1U0HC 4XWOA 721PA 3QBTA 4CYMA 3Q72A 2J46A 1ZM3A 3B8HA 3WRYC 1F2TA 3FHTA 1IY1A 5FOUA 4BLTA 1AJEA 1P7CA 2X1VA 3IO3A 1S9DA 2ANCA 5CB8A 2FSHA 2VP6A 4MQBA 4QBIA 2YKGA 2BJVA 3CNNA 1Q22A 4F38A 1SVIA 3GLIB 1NY5A 2KJQA 5JZVA 1ZIOA 3ZS8A 3D6TB 1KJZA 1N6HA 1TQ4A 1S3GA 1G20E 2C8VA 1E6CA 2C96A 4IVPA 4LV5B 1GAJA 2QG6A 5LD2C 221PA 2IL1A 1SHKA 5LBIA 1E2JA 3KKPA 1M2OB 4MYUA 3N2EA 4OBEA 2VP0A 3CW2A 4GOXA 4GP6A 4IDHA 4TLAA 4S35A 4Q5IA 1FMJA 4BFVA 3U3MA 2BOVA 3LQQA 3ZVNA 1T0HB 4EJSC 4WZAE 821PA 4Q4HB 4M9XA 1ONBA 2FE4A 2MMGA 1LNZA 1Z5ZA 5FI0B 4ACBA 3PR1A 5LD2B 3NWJA 3HP1A 3QPUA 5TMPA 4W9MC 3U3JA 3W3ZB 2IXFA 1E2PA 1CJUC 1R0WA 3FMOB 5EE5B 2GXUA 3TW8B 5EP4A 4XIGS 2ZRMA 4NPHA 3LVRE 3THXA 4TZ0A 4FCWA 1YZQA 1D2EA 3SN6A 1EX7A 4IOJA 4OHYA 5EP3A 1E99A 3DKVA 5CK4A 5DLQC 5B58C 1FUKA 3CO5A 1F2UA 2RGCA 1EK0A 2XGJA 3BH0A 2CXXA 3BOSA 2F1RA 3EZ6A 1KKLA 1KI1A 4KFUA 3KFXA 4Q7KA 3AVYA 5CK5A 4JT2A 1FTNA 2C5LA 2DPXA 4DT1B 3ASZA 4LWZA 3WBJA 1GFIA 1Q3HA 1VCMA 5L3RA 3IHWA 2OZEA 4FD2A 1ZC4A 2AL7A 4P32A 4TTQA 4TL6A 1YZLA 3B6EA 2YWHA 2ZUCA 1PLJA 2ZR0A 4C0HA 1ZNZA 2V54A 1ZUNB 1LW7A 1TNDA 2UKDA 4AG5A 4EKDA 2QAJA 5CLLA 3I1FA 4H9GA 3FHCB 4UQOA 1G17A 4Q21A 4EPTA 1UBGA 3EPJA 1QRAA 2ZRKA 3GJ4A 4M1TA 4DJTA 4D25A 5DHFA 3KQUA 1C1YA 3T34A 1DG1G 2EFDB 3CH5A 3I62A 4BFWA 5GJBA 4BE7B 1Z2CA 2VHQA 1CRQA 2GILA 2IWRA 1N0WA 3UWOA 2ZTSA 2A78A 1O3YA 2HEIA 4XVQA 3VR6A 3B82A 4IW3B 2QTHA 4HAYA 1TF2A 1UDXA 2QT1A 4M2LA 2QP9X 4HDOB 1Q12A 2JLWA 2EYUA 3ECCA 1U94A 1H8EA 1OH6A 3TNFA 1EFRD 3ICEA 4M9QA 2OG2A 2IF2A 2AKYA 4AYWA 4LY6A 4D6PA 5FBVB 5FOWA 4DLRA 5AUNB 3C7KA 3BFVA 2IA5A 1M6NA 2XB4A 2JLQA 2RGXA 4CRWB 3GD7A 3K0FA 4YLGA 1CS4C 1LF0A 2DFNA 3HYRA 4GOKA 4KFSA 1TUEA 3TKLA 1OB2A 1LS6A 3VR3A 4PAQA 4UXHA 1SVWA 2BCGY 4AC9A 2OT3B 2ATVA 4M1SA 421PA 2QE7A 3REGA 1KO7A 1QF9A 3I73A 1S4QA 3NH9A 5J4KA 2REXB 2V7QD 1ZU5A 4JJKA 4B2IA 3PEWA 3WYFA 3EZ9A 2J41A 4Z54A 2VIIA 2C78A 2XSZA 2OLJA 1GTVA 5HR5A 2GWHA 4RZUA 3CKLA 1E9RA 2GEUA 3OIYA 5IT5A 3IO5A 4Q1CA 1KSGA 2IC5A 2DFLA 1N5IA 1E0KA 2A30A 2QPTA 3M4YA 3MAAC 3X1WA 3X1DA 3A1WA 5EZ6B 2VLIA 3C15C 3HPRA 2RMKA 4V0KA 4B2LA 1XNJA 5KSPA 3FPAA 3W6PA 4AIIA 3EG5A 4OI1A 1F6BA 3W9YA 1VYVA 4G0NA 4TWZA 1NMXA 3I3SR 2DWOA 4C30A 4GZLA 2D74A 4CZ2A 5L3SA 4LDJA 2AK3A 3RYTC 1Z63A 4JLBA 2VH5R 1W36B 1YR9A 1IN4A 2WTUA 4JLJA 4OQXA 2IHBA 4GOJA 2IX3A 4MYCA 1JBKA 2CHGA 3GJ7A 1XTQA 1KJWA 2ZXUA 1YU9A 2FGJA 3AF2A 4A2PA 4PZLA 5FL7D 1M7HA 4BPBA 2SHKA 2CBZA 1GZSA 3RS4A 2CL7X 4BLPA 4PPFA 4LHYA 2DHRA 3RRZA 5L3QB 3RS5A 3FTQA 2WJHA 2HT6A 1NN3A 1KNQA 2FJUA 4IDPA 3TIFA 1LB1B 1OW3B 2NO1A 2IBMA 3CX7A 3OAAD 1JNYA 4QJ4A 4LC0A 1ZINA 4IOLA 1KDPA 4JLMA 3W34A 4LPKA 4JYCA 3TSWA 3GPLA 5E95A 4H1VA 1G3QA 1E94E 1DAMA 1NBME 1W0JD 1G3MA 4IKEA 1XD8A 4DLXA 3PUYA 2O8FA 4GDFA 5FTJA 4ABYA 1U81A 3QEOA 3QXSA 2ZS7A 4QL3A 4DSOA 3OEHA 3B1ZA 1SVLA 1UADA 4B3CA 2R62A 1MV5A 3CWQA 3H4MA 4AYTA 1RPZA 2EWWA 3CRMA 1AS2A 2ZPTX 4WW0A 2RHDA 2PT5A 4PZYA 3SI7A 3WY9A 1P2UA 4OQFA 4XVRA 1Z6YA 4TLBA 4QGFA 3C4JA 4DLTA 3BB3A 4LUCA 1AK2A 4ZCMA 2HF8A 3P4XA 2JIZD 2KE5A 1EXMA 4MRRA 1WB9A 2O8BA 2ERYA 3AVTA 2B6HA 3CZPA 3T1OA 2P6RA 1Q20A 1JEDA 2JDIA 3CNOA 2ZYWX 4K81B 2BBTA 3QKUA 2G1JA 2WPDA 4C2UA 1Q0UA 4P4TA 3QPVA 2QL6A 2XAUA 5ANRB 4AURA 4DCSA 3KTAB 4ZIRA 2O52A 2H57A 5J4HA 1X8JA 2Z6VA 3KKMA 3F0TA 3OEHD 4ZDJA 1E4VA 1W46A 3K09C 4QM7A 4RZXA 2HLDA 3RS3A 1WXQA 4EAQA 4M1KA 4QHYA 2CE2X 2ERXA 3F5FA 3JZMA 2V1XA 1G8YA 1MO5A 3U5ZB 4DLYA 1IM2A 5TY0A 4JL8A 2B7BA 2XNSA 4G5RA 3W5JA 3HR7A 4M9SA 2H1LA 1G3UA 1L4YA 1HT2E 3U7EB 2REOA 1KDOA 1MRNA 1QG2A 3B5JA 2WIAA 3OHMA 2JDID 3H86A 2MSCB 4IOKA 2ZUDA 4PTLA 1E1RD 1OHHA 1ZD1A 3B7GA 4HSEA 1ZRHA 2X2EA 4DB4A 4BFUA 1AZTA 2ZR9A 4BASA 5FUYA 1Q21A 3GLGA 3RNLA 1YZKA 2I3BA 3AB3A 3FFBA 4PPNA 3FYHA 1P61B 1CJKC 5FPYA 1E2HA 1P73A 2O8BB 5H68A 5KU1A 2D7DA 5C46F 2ORWA 1S3SA 4A8JB 1U99A 4O2LA 2QAGC 3WP1B 1W4CA 2FPLA 1DO2A 2JJ2A 1FNNA 3B85A 2R65A 4JVNA 5AUOB 4MGZR 4ILEA 1TUIA 3L0OA 1IONA 3UG7A 3ZD7A 4LYAA 1XTRA 3GEIA 4P4UA 5HCIA 1E9FA 5EE1A 3BB1A 4CDGA 3AVVA 1COWD 2ZYUX 4Q03A 2ZVQX 1HV8A 5KNBA 3RC8A 1ZP6A 3AP3A 3G5UA 3UIEA 2CHQA 1KO4A 1EG7A 3I8XA 2FV8A 2R6AA 2RH5A 5JJKA 3RRYA 4M21A 3R9IA 3BH6A 1WMSA 4DLUA 2J3EA 3D31A 1VCOA 2ZIAA 1KI2A 1I4DD 4Q9LA 1B0UA 1WDTA 3K0SA 1XWIA 2KWIA 1P9NA 2O5VA 2C9OA 4N0DA 4P31A 1PVOA 2WJIA 3OF5A 1E2MA 2ZSBA 3T12A 2GZHA 4R98A 3LA6A 2QI9C 4KVGA 4FIDA 1GRNA 4KHZA 4F93B 5DH9A 4BLQA 3MJRA 4DDVA 4Q00A 1AGPA 2WMNB 1EX6A 1KMQA 1MR3F 1U9IA 2J0UA 2QTVB 3NHAA 4FWTA 4A0FA 1II9A 1NG9A 4B3GA 1DOAA 2IYYA 2QMHA 4CEIB 3A4NA 3VR1A 3THXB 4B75A 1SKQA 3FVQA 2OFWA 2ZE6A 4NCJA 2BHRA 4Q4JB 1BKDR 3O47A 3ZJYA 4HLQB 3GFOA 2WMOB 4LJ6A 3VTKA 1D6JA 4XWAA 2AKAB 5CB6A 2FZ4A 3PVSA 4XD7D 2R6DA 2PLFA 3K0EA 5CJPA 1E0AA 1T4GA 1JPNA 1ZAKA 3Q5DA 1XJQA 2P3SA 2PL3A 2H18A 1U2RA 3SEAA 1AIPA 4G5SA 2CCJA 4U7DA 2JAQA 2W6JD 4TTPA 4KLNA 1R8SA 4ESHA 3PEYA 3U2QA 4URVR 5CIWA 1R5NA 2P5SA 4QJ3A 5E7MA 4LJYA 4B76A 5HKKA 3WNBA 1QVRA 4KLZA 2P2LA 3M1IA 2YWGA 3WNDA 2RCNA 4I4LA 5EXTA 1XU4A 1KMHA 3AF4A 1FX0B 1FX0A 2F6RA 2BBWA 4A92A 1NIJA 4BRWA 2C98A 4Z8YA 1E2GA 3PXGA 4JBWA 1LF5A 3A1SA 1JALA 3VQTA 3THYA 1JR3A 2CE7A 3MWYW 4XTRA 2J0VA 2B7CA 3LBIA 1XXHE 2ZI5A 1ELOA 2GA8A 3TSOA 4KODA 1WE2A 3B13B 1KJYA 2JLSA 2V7QA 3CIOA 1SZPA 1I4LD 2XTZA 1RW4A 4D80A 2GCNA 1DVRA 1Z8FA 3CRQA 2FSFA 3EA5A 3F8TA 3L43A 4GFDA 2IEYA 4V0OA 3T06B 3TR0A 4BLOA 1ODFA 3QY0A 4DIDA 2OESA 3I5YA 5F3WB 1QBKC 3A37A 3GFTA 1P9RA 4O25A 3RABA 3W6NA 3UMFA 3AF1A 5FPSA 3H1TA 4FWIB 1RJ9B 4Q4AB 4UJ3A 4WZ6A 3X1YA 2ZJAA 3DOEA 5SZIA 1VCIA 2GHIA 3CX6A 3KXIA 4NYIQ 4PR0A 4RD2A 2RGNC 3F3YA 4KV9A 3U6BA 2FN4A 1XCPA 5A5GA 1WBBA 1T5LA 4P4SB 4KFRA 2J0QA 1EWQA 2XNDD 3KKNA 3MSXA 3TUJC 3IEUA 4B71A 4IHQA 2QA5A 3LVQE 3IPYA 4A0RA 5KUTA 3FB4A 4RKFA 3RWMB 3SU8A 1OIXA 1F5NA 3KUDA 4LV8B 5JI3E 1SVMA 1CRPA 4FN5A 4LSGA 5FBWB 4BQSA 4XVUA 4A15A 1E2EA 1Y63A 2PZGA 3BORA 1GL6A 2HXSA 4YXWA 5BQ5A 3SDZA 4ZPXA 1NBMA 3NXSA 2IYXA 1XF9A 1ZVQA 2NIPA 2B21A 4TMZA 3VU9A 2FG5A 1FUUA 2YZ2A 3U7HB 3T1VA 5EE3A 4Q9JA 1OE0A 5SZJA 3TSZA 3T5GA 2NO9A 4C0BA 5CIQA 4POAA 5JRJA 4TL8A 2XNDA 2X2FA 3FOZA 1NSFA 5J47A 5JWRA 1BH2A 2D2EA 1MO4A 1UKVY 2HF9A 3K9NA 2QBYB 2IYQA 4IDNA 1JB1A 4LBVA 5FOXA 4JSTA 5C1BA 3T35A 3IGFA 4O3MA 3ZQJA 4UNQA 3KFVA 5TXGA 5KDOA 1IJFA 2FPMA 4N3NA 4KJZA 3CM0A 3QKSA 1SULA 2WAYA 3SYLA 3EPLA 1ZD8A 1E2FA 1NBMD 4LBWA 2VL7A 2PLRA 1T6NA 5F9FA 3WHKA 2D06A 3KJEA 4JVSB 2QAGB 1OSNA 1TTTA 4C0AC 4CEIA 1VKJA 3SJZA 4DRZA 2R6GA 1DG3A 3R20A 1HEIA 4QKQA 4A4DA 2CLDX 4RD6A 3RRMA 5GADl 1B23P 1CIPA 2IXGA 4Q19A 4NHOA 3V00A 2G77B 5FBLB 1CJTC 4B33A 1GNRA 4WZBE 2XX3A 2PJRA 2GTPA 4PHHA 5HE9A 4E03A 3AKYA 3LWNA 1COWA 3EPKA 3MCAA 3X1ZA 5BN3A 2NMVA 4L9WA 1AQYA 2OBLA 1IN5A 3GFPA 2O8DB 2VP2A 4P4SA 4EPRA 2VPPA 1T3LA 1AGRA 1U9IC 2GCOB 5DGXA 3RSOA 2FSGA 5BYKA 1YE8A 2ZJOA 2WJYA 1A2KC 2WJVA 2ZITA 1VHTA 4QGGA 5CM9C 1TMKA 3IQWA 1S96A 2E1RA 1OXXK 2OCYC 1TF7A 1WQ1R 1Q1QA 5FBQB 5FTLA 2OAP1 5JSZA 3QUSA 4FMCB 5BYJA 1P6XA 2A5YB 2FFBA 1X1RA 2A5JA 1CBUA 2P5TB 1A1VA 4LJAA 4Q7JB 4JLKA 3GLFA 4OQNA 4PAOA 3RS7A 1R0YA 3RWOA 3K0FB 4XJXA 1Z08A 4GMXA 2WKPA 4LRWA 4JL6A 1EFUA 2PJZA 1YR6A 2VO1A 1OKKD 1XCMA 1XMSA 2NZ8A 2ZJBA 4QBGB 1BMFD 4HUTA 3IIKA 3CWZA 1P72A 1XD2A 2F43B 2HYDA 2V3CC 4URYR 3PCRB 3BH7A 1ZD9A 2YOHA 3LLMA 5E7IA 3QPWA 5FUXA 1ZBDA 3E2IA 3WYAA 3TQCA 4YC7A 2O8EA 1FZQA 4FMDB 4KFTA 1MO3A 2JLYA 1DE0A 1G3IA 2WOJA 2CDNA 4S2EA 4C0QC 4OHXA 1R0ZA 1N5KA 4G3XA 4NE2A 2HUPA 3RAPR 1HE1C 1OH5A 4KYIB 3VNUA 4DIEA 4FXPA 4FI3C 2WSMA 3LRPA 2AR7A 4GBMA 4LYJA 1MO6A 3B1VA 1H8ED 1CR1A 5FOTA 3ZH9B 3AUXA 1T8TA 2BJWA 1TQ2A 2WKRA 4JYBA 2F1JA 4QRHA 4ZCIA 4GMDA 4MKFA 2ZJYA 1GWNA 2J7PA 4HB3A 3NEYA 1W49A 2XXAA 1UDWA 3PEVA 1D9ZA 4B44A 4EFLA 4XD7A 5AR1A 2JLUA 3CX8A 2O8DA 3DOFA 1ZNYA 2NTYC 1YVDA 4OK5A 1FQKA 1MABA 3IPXA 1TPZA 3CZQA 1X3SA 2HDNB 3T15A 2W6JA 5L3SB 4DB2A 1N6NA 4HAVA 1E4YA 3QKTA 3LDAA 4Z51A 2QMOA 2GBLA 4B74A 3K9GA 4Q7MB 4X8OA 1GP2A 3H0KA 2Q21A 3PEUA 1JQJC 3AKCA 2WJGA 4PSKA 4C7OB 2ZJ8A 3K70D 2ZEJA 2W2XA 4TMWA 3FE2A 3RLFA 4L16A 4B2PA 2FPKA 3B1YA 2C9YA 2QAGA 5EUQB 4LJ7A 5AUQA 4OI0A 3WRXC 3R9XA 1QDEA 2ZSFA 4KITB 5C4MA 1GNQA 4MITA 1XMIA 1UFQA 4I81A 1JR3D 3VR4A 1W2HA 4EIWA 1NP6A 1OXTA 3AGQA 5GVSA 1C4OA 4D4LA 5B30A 4D26A 4DEXA 2HV8A 5LDDC 3PFIA 4IXMA 1CXZA 1E9BA 1JECA 4RZ2A 2TMKA 4UNSA 4EUNA 4EPYA 2AXPA 1N2CE 2ZE8A 4ESVA 5FTKA 3R8CA 3SYNA 2E9SA 5HZKA 4MUAA 3DL0A 3LLUA 5HKKD 3A1TA 5CYPA 1TEXA 2GJSA 2ANBA 1NMYA 4BZQA 3U7GA 1K6MA 1BIFA 1VMAA 5BN4A 3Q7PA 2YOFA 1G5TA 4ZDIA 1VG9B 1UBFA 2BM0A 2NZJA 5FBRB 2FWRA 1VG1A 5DE3A 3QJYA 1KI9A 3QXJA 4PFSA 4G5GA 4TMKA 3EPHA 4MGKR 4M4SA 3QKRB 1J8YF 1XBTA 3BFKA 2N46A 4GL2A 3DHWC 4MGIR 1OXUA 4YMUA 1T0JB 4HAZA 1Z83A 4B43A 1W0KD 1RZ3A 3UPUA 5J40A 1D5CA 4DVGA 5IHPA 3EZFA 2IYUA 3CRW1 4HZUB 1PJRA 2XZOA 1G291 3O8CA 2AN9A 3NDPA 3AVPA 3EAQA 2H17A 1ZM4A 4C4PA 3GLHB 3ZGXA 1KTVA 1N6PA 4KO8A 2F3TA 1L8QA 2ODEA 4R9UC 5AJVB 1Z28A 3ZS9A 5L3VA 4TZ6A 4PANA 5AWFC 3VKHA 1S8FA 2G9NA 1QHIA 2FH5B 3CNLA 1Q3TA 2WSSD 1XXHB 1Z0AA 4DCVA 2ODNA 2JIZA 4HZUA 1UBEA 121PA 4RFSB 4TT3A 1YJ5A 3UXMA 4B48A 2Q3FA 1UKYA 4PXAA 2BVNA 1JEEA 3FDIA 2A7QA 2ZJ5A 5KNDA 4JJZA 1ZCBA 4E22A 3TGPA 5ELXA 5F98A 3KUCA 4ZDKA 1QHYA 2CMKA 3TJZA 2WV9A 5D3QA 4QOSA 5KSYA 1F2UB 2ASEA 4O0MA 2JATA 2RGAA 1ANKA 1N6RA 2ZQ5A 4PPGA 5FR1A 2NGRA 5EQTA 3DDCA 2D2FA 2D4HA 2FFHA 2ZANA 2ZRFA 4L15A 5LB2A 2ZRNA 1UKZA 4GNKA 4A0GA 3OE7D 1NVVQ 2ZRIA 3WNCA 4A82A 4CEJB 4JLPA 2ORVA 1GL9B 5M04A 3BIFA 2JLVA 2B8WA 4TL9A 1J99A 1BS1A 5IK2A 3FHOA 2KBFA 3MUFA 3QF4B 3ZD6A 1VHLA 5FPTA 4Q9KA 2GBLC 1J2JA 1EWRA 2QUZA 1N3BA 3GJ8A 1NN0A 2YYZA 3EWAA 4AWXA 3LXXA 3ZZUA 3TUIC 1W48A 3M6AA 4J0QA 8OHMA 1KGDA 2WWIA 2BKEA 4PQYA 2QTFA 1XZPA 3U4QB 5AJXA 3BBPA 4BFSA 2BWJA 1A2BA 1G64A 1U98A 3CF6R 5HCNA 4OL0A 1BMFA 3NBZC 4LV6A 4OJQA 1W7AA 4C7OA 1NJGA 1PUIA 5GJCA 4HEJA 3NTUA 4A6PA 5JCPA 3N5CA 2A5FA 2H92A 5IRCD 1Z47A 2G3YA 3GJ0A 2ZAMA 3OIVA 2Z4SA 1XPUA 1T3HA 1RRFA 4DUGA 1TL7C 2ONKA 3EIHA 2A2ZA 1J90A 2Z0MA 2NQ2C 3DO6A 4QG7A 3CBQA 1U8AA 3V9PA 3CRVA 2C03A 3I61A 4YONB 2DBYA 4EPVA 3U44B 4JLAA 3W8NA 3QXXA 2IYSA 5DN6A 4Q66C 5AJZA 1FL9A 3VR5A 3DM5A 1WA5A 2BMFA 2QP3A 4RD0A 1II0A 4Q01A 2GZDA 5H70A 4GSYA 3ZVRA 5KDDA 2J7PD 3WHLA 1NVUQ 1NVWQ 6Q21A 4MA4A 4Q4AA 2GZAA 3KQLA 3SNHA 3K70B 1G1MA 2F1IA 4Q1EA 2QRZA 1E9EA 3VX3A 1CTQA 2D3WA 4WAUA 3L8ZA 1XTJA 2KB0A 3PENA 4MYTA 4UNRA 1J8MF 2REBA 2GAAA 2OCBA 2R6FA 2GJAA 3TAUA 2FEMA 1ZJ6A 4WOPA 1CR2A 1GKIA 2PX3A 3B9QA 5C18A 4QBHA 1UJ2A 2OSBA 4URZR 1OIWA 4YDHB 2GDJA 2F9LA 1ZIPA 1E1RA 1OHHD 1ZNWA 4IEIA 1NLYA 1IN6A 4MYHA 5K8IA 3R8FA 4NCHA 4Q7LA 3S1AA 2AWOA 2W00A 4NMMA 3R7WB 2QY9A 2IYVA 3DEFA 4QNMA 3P20A 4V0MA 1KSHA 3QENA 4A2QA 2IYTA 1NLZA 4PQFA 5L8VA 3MRSA 4W5JA 2OXRA 5FTMA 1OKKA 3LV8A 3VHLB 1ESNA 1II8A 1VG8A 1TQDA 1YRBA 2IK8A 4ON9A 1NF3A 3K0CA 4H1UA 5DISB 3VMFA 5BXQC 2F3RA 1IXRC 2JJ2D 2J59A 1ZW6A 3K0CC 2AK2A 3CLVA 3SBEA 2ZSAA 4EFMA 5CDFA 3TR5A 1PV4A 2XB2A 4OHVA 2JLRA 4E07A 4A6XA 2QM8A 3QOFA 3PQCA 1E0JA 2WOOA 3HU3A 1MT0A 3LBHA 4IJMA 4XH9B 5G53C 1KK1A 2FX3A 4DDTA 2IF0A 3U3KA 3ZZ0A 3EW9A 3ADCA 4RFSA 3THWB 1HUQA 1TU3A 2AD5A 2WM9B 4NKRA
chains in the Genus database with same CATH superfamily
5THQA 3PJGA 4HEHA 4F7WA 4PHTA 5EIHA 1LC3A 1KVRA 2WT9A 5DKFA 3L4JA 3MJHA 3U39A 2AI2A 3DFKA 1TD1A 1EVJA 2HK8A 1VE9A 3EQ6A 2C4MA 2VR1A 1A4RA 2DAPA 2QV0A 2PMKA 2D59A 2PXXA 2YH2A 3GLHA 5JZOA 3E1GA 2IOFK 4HDMB 1TU0A 3ETHA 4UZSA 1P4JA 2O05A 1XE3A 1W9MA 3KE9A 3Q3CA 1UKCA 3HM2A 2B3TA 1KY3A 4FOOA 1L5LA 1SBTA 3V48A 4TV8F 4ENTA 2WB4A 4F96A 4U2EA 4YCSA 3M4NA 1W4RA 1YS4A 2HBZA 1XLUA 4IWNA 4X1OA 1ZQ9A 1WBDA 4ARSA 2BHLA 2X22A 1Y7LA 3A6FA 4QDZA 2FW6A 3SQXA 5JHHB 4IBOA 4YMWA 4HH1A 4WBSA 3EDRA 1LPNA 2VF4X 4V02A 3MXOA 3IR7A 5KC9A 2BI8A 4NENA 2B20A 3C6XA 3T99A 5G1NA 3NTXA 3VAAA 3ZDAA 1C4XA 2XKAA 1YR7A 5JFOA 4X71A 3DAYA 3AYZB 3IJ5A 3T9FA 3AF6A 1MUUA 4OP1A 3KYCA 4HDRA 4NBWA 3U1TA 3V8QA 4DCCA 4YJ2B 4RZSA 2GO7A 4G0XA 3MTJA 3EMKA 3GDWA 4EA6A 2HW8A 3R0JA 2NOAA 1LDYA 2B1GA 4PC6A 4IMRA 2PJUA 4JWTA 1AQJA 1M8GA 5T4HA 3IFSA 4UXJA 5K5EA 1J0DA 4BFZA 2PT7A 5FCDA 3HKEA 4OHOA 4Q3NA 3AVOA 4AKSA 2YJGA 1RQRA 4IH1A 1R6BX 4TSRA 4MVJD 5ARDA 4JB0A 5LA6B 1A69A 4QLOA 1CFZA 4CGZA 3A3KA 3G8CA 3MG9A 1FU4A 4ZREA 5E1OA 1X1QA 2YJ6A 4KVAA 4EA8A 3PFWO 4N18A 1NQTA 3N0VA 4UC0A 1ZH2A 3DDUA 2ZCVA 4XSGA 3TINA 3WVNA 3IDSA 5TPWB 1WXHA 4BECA 1KERA 1BU5A 5JAUA 1G9XA 2PGOA 2Q4DA 3IJPA 1SIWA 2V0GA 4DQXA 1TA0A 4PNPA 4RPLA 1EESA 2WMDA 4ZA2A 4OKSA 4M1OA 4P82A 5EYPA 1AHIA 2ABWA 3DVAB 1UBKS 4YAGA 2WSSA 3IOEA 4XUGB 1IUPA 3U80A 2CNWA 5KHAA 4XGRA 3TOSA 1G5RA 2Q9CA 3PDIA 3DB1A 1HDZA 5DYGA 5KYXA 5KYXB 1OWLA 5TPZA 3I92A 4I55F 3C3JA 2WDZA 3AV0B 2GETA 3LBAA 4IQ4A 1GU0A 3D3KA 4GYJA 4O2RA 4CLRA 2PZAA 3KTOA 3T9DA 2ETVA 5LBTA 4MUNA 4V0NA 1W5FA 2AFHE 4WZBB 2XZLA 5KNCH 4KN8A 5A4AA 3TF5A 1ZZGA 2AEMA 4G1FA 4UZFA 3WLFA 4C04A 4KBGA 4BNXA 2VDLB 3HXKA 3T5AA 4Q7EA 4RA9B 1I2MA 5TC4A 1IQRA 2O2DA 4JP2A 2DSTA 1X7ZA 1H1LA 3NUGA 1K8RA 1DPFA 4TQGA 3WE7A 4LHXA 2BRUA 2WLSA 2ZYSA 5JO9A 4KXWA 1UF9A 4RHCA 3NYRA 3QX7A 1XL1A 4S1VA 4X54A 1WV0A 3A2MA 1PGJA 1NLFA 5F5NA 4IJUA 5A06A 2VAPA 5EJEA 3ISVA 2X19A 3B3JA 1QV7A 2ZVPX 2JIDA 1QV9A 2BUCA 3STTA 2BLLA 3W2FA 3ZE1B 3LJKA 4MR7B 5CIYA 1PR0A 4AIRA 3KQKA 3BJIC 1K7CA 4J03A 4ZVOA 3P0JA 1APBA 1DP4A 4HY3A 3UPDA 2IH5A 1U6JA 1C3XA 3IILA 4P58A 3IP3A 1LWOA 2P9HA 2BFFA 3JWHA 5HTKA 5EIOA 3S81A 2EKDA 1J7KA 1NMZA 3K5WA 5KOHB 3AVXA 2Q9BA 1QQBA 4H18A 1XN4A 2ORIA 3AVWA 1I7NA 1E96A 1ESZA 2F2TA 2ZZMA 1YRAA 2B25A 4P1ZA 1JEOA 4YMLA 2DQSA 4R7ZA 4G89A 4UUQA 1E69A 2JGEA 2ODTX 1DU4A 2PGIA 3CG0A 5TEVA 3W9SA 4TYWA 4YIHA 1KAOA 3KEMA 3ES9A 2QVLA 1AY0A 2CDBA 1R9MA 3ZYCA 1Y81A 3ZIDA 2RK6A 1MHPA 1EDOA 3SE7A 1DKUA 1KPIA 2CNBA 2EZ4A 1JAIA 1U5CA 3BHMA 3DCJA 4IHJB 2NWQA 4Q9HA 4TMFA 3TSCA 4YEDA 1QGED 4AJ1A 3C3PA 2X8BA 3SZGA 3DVRX 1JEYA 3PYLA 4LGYA 3T7KA 3ND5A 3KKLA 3RK0A 4P3XA 4OHFA 4G0MA 2YBDA 3I53A 3GDOA 4YAUA 5IDXA 4N48A 3Q88A 3PYMA 3G2OA 2ZWVA 3RUEA 5ELLA 1UZAA 4UOEA 1RQXA 5C2JB 3N3BC 4JD5A 4BO3A 4EYGA 3A6LA 2PV7A 3KWMA 4M54A 4NBNA 4HPWA 1Z73A 4B31A 5JDIC 5LQMA 5EJGA 4JV5B 5EMNA 1SXJD 1R6VA 1I2DA 2VUSA 2EARA 3KLNA 3UGTA 1M34B 2DOKA 2YWRA 3EXG2 4KQHA 5L3QA 3A6EA 3FUVA 4MH0R 1NJ6A 1OI2A 3BMCB 3L02A 3U61B 1K06A 2HNAA 3PNBA 4F4DA 2Z04A 3ACBA 2IXAA 2AN3A 4UUAA 4K1LA 1OXKB 3ZX4A 3WMRA 3WLLA 4XWWA 4L76A 2AGVA 1G7CA 3EEFA 3UH0A 4MVJF 2POCA 3D6AA 3GP3A 1L5HB 2RH9B 2WYWA 5EXPA 1KSJA 3OCYA 4EHNA 3CZRA 3CONA 2AFIE 2LKDA 5CLQA 5B5SA 3A58B 4L9SA 3FWNA 3GO4A 3HP7A 4EMUA 2H4XA 1G9SA 2NO6A 4JBLA 4QAJA 3BCRA 3BQMB 2IYPA 3TW0A 4XX0B 4V38A 5TJ9A 5A5VA 1USKA 1MVOA 1THMA 3GEHA 5UKDA 5K09A 2X5KO 1GOTA 1SD1A 4OQLA 2DCUA 1O6BA 3ST7A 1DKQA 1M8PA 3IBFA 2DFVA 2WMYA 1F8YA 3FYDA 3NBQA 1GGKA 1S1CA 3OM0A 3OTGA 3QU4A 3PCTA 4I1SA 4EYSA 1HYHA 4R1LA 4RKWA 1O96A 1KO1A 1KI3A 2FR8C 2WE7A 1O97D 4RTKA 4QU8A 3H5VA 3I58A 2PE5A 1C8BA 2IEZA 2ZVJA 3KTFA 4O4JB 2BF7A 2BI4A 1UIRA 4MW5A 1EJBA 1XU9A 2O1SA 4JX9A 1B15A 3DZDA 5F4ZA 5AQ1A 3NKFA 4L7VA 4L95C 3QPDA 5BRJA 5I3ZA 2R8XA 2ROQA 1QAQA 2R68A 5GV8A 1V48A 3NTOA 3IBCA 2DUUA 4N3GA 5AVTA 5MFZA 2Z4RA 1ODCA 2BGWA 2QR2A 1DIOB 1Y4DE 4JT4A 4EHKA 3NHLA 1E3DA 4UW9A 1Z39A 4DHEA 5AM3A 3SF0A 1SELA 1JA0A 3I5UA 4AG6A 4D81A 3S4YA 3T3MB 2UXCB 5L40A 1EGQA 3ELBA 4ZARA 4N41A 1BYIA 3T9AA 4BX8A 2ECQA 1RXYA 1QX4A 3EPJA 4GI7A 2ZQYA 2Y67A 2HZBA 5DYNA 5BQPA 4DKJA 2Y0DA 3QLEA 4F3NA 2HMWA 2XADA 3C14C 3GMDA 1F9EA 2G1KA 3VYSB 1U3DA 2OAQ1 2EGHA 4BMZA 1EB8A 4D4KA 1A27A 3HGQA 1NQ5A 4C5BA 1R15A 2AOWA 3C5HA 3U60B 1OIVA 1H4SA 4PZUA 1XMJA 3AUFA 1NSTA 3WJAA 1T6ZA 4G0QA 3LYUA 4P3YA 1YVRA 2PV0A 3PKIA 5KEIA 4JYPA 2IXEA 1M9NA 4AUMA 1R6XA 3DZHA 4X1IB 1OLUA 3JPYA 1E5VA 3HKDB 4QEZA 2PM8A 1I6MA 4GPEA 3JYNA 3I04A 1KYWA 4LDQA 1NBEA 3BEDA 3DL2A 3EXHC 1K3FA 4NE7A 4WA7A 4DV2B 3KFLA 5DTMA 3SF8B 4UVGA 4FDMA 1P1FA 2W58A 4D8VA 2UZ1A 2I4LA 5FOVA 4RH0A 2NXNA 3BMCA 4KJXA 4CMIB 5JQGF 1PG2A 1SKBA 3HVKA 2P41A 1ZJ5A 3JVUA 3KB2A 4WKBA 4EG6A 1WTCA 3BRWD 5K8TA 2I2BA 3ENVA 4X64B 4A2WA 1RJ9A 1N2IA 5C1PA 1HOTA 2FEAA 3BXZA 1Z13A 3LX8A 1ZH8A 4OQDA 1E1NA 1XSEA 2P69A 1RTTA 4HGNA 4YNBA 5LZ5A 1ZK0A 1E77A 4RD1A 4BRUA 3CH4B 4KWTA 1ONSA 2CLHB 1OFTA 3AO0B 3I6YA 4LE2A 4BGIA 1B0ZA 2DWQA 4YAKA 4TQAA 4YRIA 3GJZA 2NG1A 2D5IA 3HCNA 4MKGA 1IN8A 4N54A 1Z6XA 2GPWA 3I2JA 1NC3A 2WV7A 1P60A 3PWTA 4LHVA 4TXJA 4F3YA 1WULS 5I8PA 2DG2A 2O3RA 4TLCA 3PXXA 1FW6A 1S2IA 3NBAA 4W7SA 4UCQA 5CA0F 5C4GB 3BCUA 2ZS9A 3RSQA 3D1VA 4MNTA 2C7OA 3QG5A 1NE2A 4UASA 3ZV7A 3ZGZA 1SKUA 4IM7A 1BOFA 1BX1A 3UQYS 3RT1A 4ALMA 4YAJA 1KMHB 5C8XA 3PSAA 3HBJA 1E9AA 1E9CA 1Z0SA 2RHRA 1WIWA 2ZRJA 3A6GA 3JYOA 4UM9B 5HVNA 5JMTA 1X87A 1E4EB 3OZUA 1QM5A 3AHJA 2FGKA 1RYEA 2YWEA 4OHPA 4FINA 5FLKA 1DWPA 1J0CA 4NCKA 4YRLA 1NW7A 1YQXA 5G4LA 5A4JA 4MVJA 4KMRA 1WCYA 1OBVA 1L5MA 3PGXA 4TKLA 1NXXA 3KL4A 3AK4A 3E5NA 5KYGA 2A33A 2ICAA 3M0EA 1K08A 1SB9A 4QYSA 1SCBA 3GL9A 4GU5A 3MT8A 4ASUA 2VUTA 2B1RA 2Y99A 1M2OA 1SVUA 3H2GA 2JANA 1DLJA 1CY0A 1Z33A 1AUVA 3EQ2A 3GFFA 2J9XB 4JYAB 2JIMA 3BGVA 2KM1A 3Q3GE 2Y1LA 3ZHQA 1H6AA 2WYHA 5E6SA 1E3QA 1NVXQ 5LZ7A 4PEVA 1VC2A 3KIPA 4C6TA 1EM8A 1P18A 2YS6A 4V0QA 1VIYA 3CF0A 4D1YA 3GLIA 3SYKA 1ISIA 3VC1A 2FZWA 2GCPA 3GG9A 7REQA 3TZBA 1NNEA 3QXGA 2F1OA 3B6KA 3F67A 1DQYA 4FXOA 5HKLA 1NWHA 1R10A 3LF2A 4H60A 1TAGA 1TO1E 4IZOA 4E2XA 1T9GR 3GFVA 3WRYA 5I7WA 1F2TB 1P2GA 2OQRA 2BE7A 3BA1A 1LV7A 2CMFA 5AK6A 4XLZA 1JHRA 4JBXA 2O2JA 4E32A 3UXYA 3IQDB 1NRJB 1TM4E 3PP8A 4E2FA 3IIMA 3FB1A 3UGQA 3IAAA 3WGNA 521PA 1NBIA 3PHHA 3VHQA 1UBLS 1T3SA 2HGSA 3VUFA 1T2CA 4X90A 2ZR8A 3FYUA 4K9LA 1M8FA 2HMAA 3D8BA 5EE9A 1X80B 1U8ZA 5GPBA 1SCKA 1DV1A 3U7JA 3L5KA 4H35A 3B5EA 1S8NA 3KOYA 2YV3A 4OATA 3S8MA 4Y2TA 1PFQA 1Z56C 3KPWA 5T57A 4UATA 2RBEA 4C01A 2QRKA 4ZODA 2BH2A 4LKRA 4PS0A 1QORA 4BB0A 1LBTA 1GGJA 3QVXA 3WLKX 2I9KA 2VSYA 2X8JB 1L7XA 4GBGA 4J0DA 4JP5A 3F2VA 4RU1A 3F9CA 4OSOA 5JDCC 3R9XB 3VO8A 2O2ZA 4OLAA 4N82A 1K92A 2YCLA 1BGWA 2YINC 4BYGA 4OHRA 3J80A 5A03A 5HE8A 4IUBS 2I4RA 2OO5C 3ETEA 3ELWA 1NSYA 1L1EA 2PHZA 3EFOA 5E4FA 2H7VA 5HOEA 1NC1A 1Y1SA 2HC9A 4JEUA 2E3JA 3L7AA 1WSDA 1OX5A 4G01B 5I9LA 1D2AA 1LY1A 3PFHA 4OHUA 4RXUA 2WJJA 2W2LA 5LQAA 4QXOA 1RRVA 3AU9A 2IZ5A 1A76A 1E2LA 3MJCA 4UEKA 3HYNA 5HUJA 3VPCA 2E37A 2WBLC 4B3FX 2RKOA 2M1ZA 3EQ7A 4JI5B 2C2ZA 3SC2B 2EFEB 3WMFA 1DWOA 1OFIA 1W1WA 1E92A 1S89A 4Z9YA 4FFMA 1F0PA 4KAJA 1KO5A 5ALJA 4GSKA 4Z0HO 4OU4A 5AVKA 4QJIA 1V7CA 4OFWA 1AKYA 4R16A 3WI7A 5EUCA 2BFDA 2HPZA 5F1PA 5A0FA 2EEZA 5LMNB 3AW8A 1RNLA 4EYKA 3SOZA 3VKWA 4H1TA 1ZN7A 1R0LA 1U7HA 1DZ3A 1M6YA 2HBRA 3H2BA 5CXUA 2VVTA 3IIJA 1JPJA 2CXHA 2PNFA 3BSYA 1LBSA 1X1SA 5AICA 1Y89A 3RFXA 4TMVA 3RD5A 1DPGA 3TIVA 1RYHA 2J87A 1QQTA 2I55A 1N6LA 2HO4A 2YNMA 3LD9A 3OZVA 4IDCA 3WJ7A 1QP7A 4MLDA 1OD6A 1SXPA 3ZC3A 2YVUA 4D9FA 1D1PA 2PVCA 3CUYA 3KYIB 2ZRAA 1U1FA 3BXOA 3ZEIA 4PSAA 2V7TA 2WIBA 3GNQA 4OBWA 4BU0A 4B82A 2WVHA 4NEQA 1UOEA 1RP7A 3RRFA 3DMTC 2H08A 4P84A 2ALJA 3H2IA 4F4IA 1SBQA 1RM3A 4U2CA 3U40A 5LMUB 4BWFB 1G8FA 1W85A 3WXBA 1WNTA 1DO0A 3DYVA 4LXIA 2IE8A 3QVJA 4Q37A 1KPGA 2MSEB 2IS6A 1G8GA 4RA6A 4XB1A 2HA2A 4IXDA 1M73E 2Z6AA 3W2HA 1JX6A 2EP8A 3CH6A 4MPDA 3BYZA 1FFEA 4HB4A 3IPAA 2YW2A 5DLPA 2I22A 3CCBA 2ZROA 4BQPA 1LVGA 1DAFA 4RHFA 4EY7A 1YDGA 1Z17A 2QMQA 4MW6A 4A0SA 1AE1A 2GUGA 3KOUA 1KS9A 2Y1EA 2N75A 3WXMA 3GCGA 4O4IF 4N8DA 3KQOA 1AN0A 2FI1A 3FMIA 4PU0A 1XVAA 1THZA 2X8JA 1E79A 2XMRA 1S2MA 3TNYA 5KHOC 2B36A 1V1JA 2C7QA 2WWFA 2QUAA 2NQTA 3DV0B 2VAMA 5KAPA 3ZLBA 2KQUA 3QBJA 3VR4D 3GJSA 1U1GA 3U26A 1TF5A 3T3OA 3I72A 1N6IA 3E81A 1RQGA 3CR3C 1W94A 3PV0A 1OVGA 3REFA 1B0PA 1A5TA 2FR1A 3AP1A 3TIIA 4DYDA 2WIJA 5DYTA 4P08A 1ADJA 2PWPA 4YDSA 5FI5A 3VDMA 3QYFA 1XTUA 2G88A 2P2DA 4EPWA 1PJTA 1SBIA 3WB1A 3X3HA 4IIBA 3KZOA 4RABA 1SZDA 5BUZA 1MENA 2C77A 2EV9A 2JGLA 2WLTA 3MOSA 4RVUA 2Z95A 2X4IA 1EDZA 5K0ZA 2H4JA 2IY9A 2GEKA 1X2EA 4JQOA 3DULA 4FLFA 1IN7A 2YV5A 3EPPA 1U0TA 3PGMA 3UWKA 4CKBB 4F45A 1JXOA 2BFPA 4B40A 1UMDA 2G4LA 3LYAA 5IKPA 1QQ7A 4AMVA 1H9BA 4K6CA 1N6KA 1JAZA 1L4UA 2EQ5A 5FA8A 1KHHA 2B2NA 2DX7A 1YS9A 2KBEA 1EFVB 3L4EA 4LISA 7MDHA 2FZKA 1W4BA 4TS3A 4E5KA 3TH5A 4PTYA 5EN4A 1R5OA 1VHJA 2M6KA 1DC5A 4BEWA 1QBGA 1FS5A 1CUCA 1ORRA 2EKQA 1SCDA 3K9LA 4D4JA 3P5SA 3V4FA 1ZI9A 5HPYB 2ZSEA 1AF7A 2HL6A 2WD7A 4XB6B 4DWJA 1W35A 1R8XA 4DG5A 5C37A 1IBKB 4P98A 2OLKA 1VFPA 5EPUA 1GFWA 1SWWA 3V80A 2J3DA 3MS4A 4EITA 5LLTA 1M7BA 3I52A 1D0VA 4DKXA 1Y5LA 2QQEA 3M33A 3WS7A 2PTHA 3QZUA 3GJTA 3WBBA 3U1VA 3ONEA 1USIA 3O2NA 4KNVA 1IH8A 4GVPA 1P4RA 3B2QA 5IVDA 5HIMA 4PZDA 3AXSA 4CEHB 1VL0A 1SUWA 2W0SA 2ZJ3A 1FDRA 3OQ6A 4OHWA 1X1EA 1USUA 1CETA 3U48A 4RCYA 2IS4A 4CMKA 5ICGA 2FR0A 3I5XA 5FUVA 1LBQA 1CY7A 1N5LA 3F46A 1RIIA 3INYA 3RV3A 3TTTA 2PUBA 4Z1MD 2EX4A 4MSUA 3W2IA 3AL0C 5L4LA 4BZQA 2GS9A 2QD2A 2YJZA 3ZU2A 5ALUA 1T15A 3KHTA 1G3RA 1WMAA 3B20A 3TE6A 1QH9A 1R2QA 1YU6A 5LC1A 3UJCA 4BN4A 3CPJB 2JKYA 3PWSA 1T2VA 4C22A 1DARA 2F43A 3COVA 1KK3A 1DJQA 1AHPA 4NOJA 1Q19A 3TG2A 4FNAA 2EU8A 1GPBA 3P1JA 1YTUA 2JH9A 2HF7A 3R3YA 4UMFA 4WDQA 4FUQA 3OZXA 4LX8A 4MZDA 4IQFA 3O8BA 6REQB 3C43A 3S1SA 3OE7A 3H4TA 5IT0A 1R8QA 5L4NA 1FSPA 1OZGA 3CB4A 1ZWLA 2GEJA 4UFNA 2B7LA 3N39C 2H2DA 4QPDA 1TQ6A 3PCXA 3RHFA 5JFTA 2VAWA 4P36A 1PO7A 1MOSA 2BGKA 3CLHA 2VEOA 3RDPA 1RDFA 3I34X 4JEIA 2QUKA 2XOXA 4K3VA 5E2IA 3WV5A 1GYPA 3CYFA 4GEKA 9ATCA 2QBYB 3ORQA 3W8DA 5J1SB 1X42A 2D0PB 3EIOA 2CCKA 1O5IA 4ASUD 5BR4A 1Y1PA 2ZIWB 1PG5A 4KIJA 1CZRA 3K70C 1DAEA 1YQ9A 2JEOA 2XODA 3HN2A 1HT3A 3KSBC 4N39A 3RROA 3DV9A 4LHEA 5GVRA 1L5NA 4M1ZA 3GMSA 4YMTA 1K6JA 1LBIA 2GK7A 2ZSJA 4LA4A 1PD1A 1KDTA 2YDYA 5KNDH 3BILA 1RCUA 3ER9A 8GPBA 3O26A 3VDRA 3IIEA 4H7HA 4C07A 3EWSA 5L7WA 1Y1TA 1WKBA 1MJNA 1YWGO 1VE6A 2ZJ2A 2VDWA 2ISSD 2RBKA 3KS9A 3AETA 1R6AA 5C3MA 3ZW8A 5IDVA 2XW6A 5FPPA 1M8KA 1F38A 4N6NA 4OHKA 5AFSA 1H94A 1WSAA 3ICWA 4E51A 4RYDA 1K3TA 5JECA 4LYEA 1SVSA 4PC1A 1GPH1 4PO1A 1ZRMA 4K26A 5BSGA 3EPRA 2YFQA 3QKRA 3AUJB 3R0ZA 1KJIA 1EYZA 1OA0A 2IV3A 5JOQA 3DFUA 1VGVA 4F91B 4I1UA 1PUJA 3MFQA 4KUEA 3V1NA 5I8WA 5ALTA 2R7LA 5K0JA 3P26A 2FZ5A 3TLZA 1DBVO 3DG9A 2QPOA 5ICCA 2HSZA 1T2UA 3KX2A 2RGNA 4E5UA 2FMXA 4XYMA 4D4HA 1OZAA 2A5DA 3AHIA 1EXWA 5FDFA 2QVZX 4ETNA 4HH3C 4LZOA 4N0MA 4ZOQI 4X92A 4INOA 4NV3A 5KVCA 1XEXA 2HQOA 2W42A 5KTSA 4J29A 2HDHA 1E2KA 2NVWA 3EEYA 3QH4A 1KFJB 4D82A 4D92A 4O08A 1Z5PA 1K0UA 1NVEA 1TA9A 4UZEA 5FOSA 3RF7A 1Y37A 3PEFA 2XNJA 2J6IA 2HUNA 3AEKB 3GEEA 2FLVA 4PVDA 2ZB7A 1TTQB 2YXDA 2HIMA 4F71A 5T41A 3WO0A 4K9NA 1N2CA 3RG8A 1O0BA 4BXOB 3RVSA 1JXMA 1ZGJA 2CLSA 4ZVRA 2HHLA 1OXVA 1YKGA 2FSIA 3R7NA 3U3OA 2QG9A 4JQCA 2XR1A 5JCZA 5JI2E 4AMZA 5BSWA 4Y1RB 3GRPA 5GIPE 4HGQA 2VA8A 5TR9A 2FOLA 2Q8NA 3ZXIA 4ALIA 5L51A 4UHBA 2H63A 4YY3B 4JOCA 1ZJ4A 1F3LA 1W85B 2B9VA 2YWFA 2EFYA 1JJ7A 4KN9S 3WYBA 3WTBA 3LWDA 2ZQZA 2OWEA 3MUNA 4KQXA 3B38A 1HE3A 1K97A 3IESA 3MXTA 3E03A 4PAWA 4ZEWA 1OWOA 1O0CA 1QTRA 3AKEA 4QPCA 5F1YA 5C8YF 3HDJA 3SDSA 1QAMA 1BEZA 4DXHA 3NRCA 5KS2A 3C3EA 4EY8A 4YB8A 3AI1A 2HWXA 4LMAA 3UO8B 3QWIA 4W99A 2IYEA 3NEJA 2C2WA 3LS2A 2PZMA 4EMBA 1NI5A 1MJ5A 4RS3A 2IUEA 5FYDA 1LTKA 3ZQUA 4CL8A 2O0KA 3VISA 4YCMA 2X77A 3TQHA 1XRPA 4MGHA 1BVUA 1ZC3A 2OWDA 4LZAA 1P9OA 4CMIA 1EIWA 1J06A 4NL4H 2PK3A 2EX1A 1DIRA 2WWGA 2VNSA 1OCEA 2A7XA 1LLDA 3H87A 2XWJI 5FULA 3QMVA 2H9IA 3C87A 1HA3A 3FTDA 4O4JF 1ACMA 4CEJA 1I2AA 3DMRA 3IRVA 3KPUA 3OBBA 4BO4A 3VR6D 4DT1A 4TTRA 2IH2A 1YZGA 4CHGA 2VWQA 5DM0A 3UOGA 1O77A 2GAOA 4O02B 2E21A 2V7XA 3GDHA 1T9CA 1GEGA 1O9GA 3M1AA 4OMCA 3RK1A 5BSEA 2ODWA 5JS8A 1NN1A 1OGJA 1L7BA 3EISA 1NXOA 5HHTA 4DSNA 1A5SB 3ELDA 1G2QA 5BXYA 1FJXA 3DPSA 3MWDB 1PZNA 2GN0A 4QVGA 1RI4A 3DVLA 4U9IS 2VTBB 1U3VA 2WA2A 1PS0A 4KACA 4LK2A 4QATA 1L5RA 3F1KA 4UPDA 3WJ2A 4GKJB 1Y4UA 3IEMA 1RHKA 1DELA 4RJLA 1N2CB 2OUKA 1NKSA 1US8B 2N3ZA 3U4MA 3HYCA 1D2RA 1W1UA 1XZAA 3L7KA 3D5TA 4YV0A 3MTQA 1P7PA 2PSSA 1IWOA 1SD5A 4H6VA 3V8BA 1DDGA 2F62A 1FFWA 2JFWA 3MK31 2VQSA 2CMDA 2QRMA 4MWSA 3V4OA 4N5LA 1NYLA 2ID7A 2GUWA 2A57A 2L17A 2C94A 2QX9A 2XSZD 4K03A 5G1OA 1GQSA 3VDNB 4E1VA 2ES4A 3OZWA 4MKHA 4QTZA 4JI1B 2E55A 5AW4A 4Z4EA 4QM6A 1PU2A 3RS0A 2H2IA 4MARA 1OB5A 5J5VA 5IASA 4KI7A 2FPGB 4ZVTA 2PX2A 3ZCPA 1W25A 2FZVA 2HX1A 1I3CA 3T5DA 1E1LA 3QFCA 3FHJA 3DE1X 2MR5A 1Z8HA 1VJRA 3ESZA 3NT2A 4MWGA 3RJMA 3L4KA 2H1RA 1L1QA 2FRDA 1EWYA 2B94A 1L4MA 3PQEA 4LHWA 5FLEX 4PPYA 1HWYA 3VU9B 5KX5A 2C4WA 1M0TA 4ZV4A 4UTVA 3VO2A 4G1MB 1R9JA 2JKZA 3R24A 3DCNA 3TI9A 3R41A 3GRAA 1ZU4A 1ENOA 2O3QA 2P90A 4Q3AA 1PE0A 1C3LA 3T4EA 1BMDA 2FA9A 2NAFA 4Q9IA 5C7YA 5DBFA 3B1WA 3KWJA 5DGDA 2HHAA 1YB1A 3D02A 3LC1O 4EF5A 4WBNB 2G0NA 1IHDA 3LW8A 2EL9A 3KT8A 1TRHA 3I30X 4KDFA 4ENWA 4YMGA 2P8JA 5T4EA 4CFSA 3L1VA 5TV2A 1X1TA 2AFRA 2IUSA 4CTNA 1S7GA 3SBDA 2HCFA 3TLMA 4BEVA 1C1HA 4M7PA 3K1AB 4YCJA 4B84A 1PW5A 1JI3A 3VBEA 5TGZA 4WKOA 1J42A 3MZ0A 4IMPA 5DWVA 2CF6A 3I0NA 3TOCA 2AOTB 4ZGBA 4Y7DA 1KZ6A 3K2BA 2H1CA 5CFMA 1JA9A 3OZTA 4FEYA 3N0TA 5B53A 3ZE2B 4RTMA 3LXRA 2Z3WA 3KETA 4DMUB 1TEVA 1DTWB 1ISMA 3H5RA 3UOWA 3E5RA 5HRUA 1U8UA 2GHRA 3K53A 4NCXA 3I45A 4PM4A 2JIRA 3KXLA 2JA2A 3ITEA 4RHTA 3L7DA 4RNCA 5FQNA 3ZW9A 4V1CA 5KJFA 4US2R 4EZIA 2G5CA 2VJCA 5K3BA 1LC0A 2IHYA 3D3NA 2W2QA 5AK0A 4EUHA 4IRUB 2IITA 4L51A 2TECE 3UB4A 1KVUA 5KTNA 1WRBA 4D96A 2HCJB 3EYWA 2YTZA 4OXKA 1PCXA 3KVOA 3B9BA 2H0QA 1EG2A 2QT9A 1NP7A 1RRMA 5CM8B 4P0TA 2OPHA 4OGWA 5DLYA 1CJMA 5KNCA 3GLIE 4GS5A 2DSNA 1NXSA 5CNIA 3GLGE 2WYOA 3AHEA 2X5JO 3D8TA 4RHEA 3V4ZA 1HLPA 4WLNA 4RKYA 5D7NA 3CFYA 5K05A 4QGBA 2EJWA 5JJIA 5FRDA 2GKSA 2Z3VA 3AEZA 1FNMA 3AIMA 3OPYI 4G5YA 4L4YA 3TQFA 2G5GX 3IEXA 2IGTA 1W6RA 1FLVA 3ESXA 3FJOA 4OBBA 1O95A 1TK9A 3WX0A 3NXKA 1JAHA 1E6LA 2NUBA 3DOJA 3SQMA 2BAGA 5CW1A 4ZCQA 4R71A 1QF6A 4DLWA 2QD3A 4YAEA 5IJAA 3SE0A 1KDYA 4X66B 2IHNA 5CYOA 4HRVA 4X95A 1G5PA 5DNAA 5TS3A 3NHWA 2PU7A 4UEQA 4PHGA 4E21A 2BFBB 4DA8A 2O9JA 1P2VA 5CXXA 3GK3A 4ZOLA 5EUMA 3NG1A 5HEKA 3BMNA 1XP5A 2WDPA 3AWDA 5AXCA 3R6DA 1X80A 2XTNA 2XQJA 3BTOA 2HI0A 4NONA 1OLOA 1QJ4A 2JFXA 3AZOA 4Y9RA 3MWJA 5BUQA 2IDKA 4JNKA 2PQMA 4DUGD 2QD5A 4HB2A 1IJKA 1KRWA 4ITRC 3LQ2A 5IVKA 4G24A 4CYMA 4C08A 3FPKA 3HVIA 3HHEA 1MG0A 1U0EA 3CY6A 3L6CA 1F2TA 3FHTA 2IYNA 3SYMA 4EHLA 4F3CA 5FOUA 2YIJA 5FWDA 1AJEA 4ZXFA 1AXGA 4LZPA 1LU9A 5JNLA 4MW4A 4AT1A 1E8NA 3D3JA 4N7JA 4JFRA 4KLCA 2YKGA 3CNNA 4S1PA 5IN4A 3SBXA 1JH9A 3CBGA 3GLIB 3ABRB 3T6KA 2HQ1A 3HFRA 3ZS8A 3PXAA 3IEPA 2WJPA 3HH8A 5A3RA 1TMOA 1N6HA 4IXWA 1F5SA 3IULA 4FIZA 1JLMA 1SR8A 2YMMA 2C96A 3P19A 1RAEA 5MGBA 5LD2C 1SCQA 4FUTA 1FCJA 2YW9A 4RLHA 1JILA 1SIUA 2XMBA 3OLVA 4HDKA 4KDCA 4RKRA 3KJFA 3IT2A 4ED9A 4MYUA 1DIAA 4KHPB 1KP2A 4TLAA 3UAOA 4BFVA 3NDIA 2YRFA 2BOVA 1RPTA 4WZAE 4RORA 4BO7A 4M9XA 5LWQA 5LP1A 5HS4A 2GFHA 3P9SA 2JFUA 4IIEA 4E94A 4ZK2A 5JYDA 1GGNA 1Z5ZA 2C5HA 2O8NA 3N86A 5E6RA 4LDNA 2KX7A 5TMPA 4W9MC 2M32A 4P54A 1Y3HA 2IXFA 1YULA 2SECE 1R0WA 2Q4TA 3LUBA 3QE3A 2GXUA 3MVEA 2F3PA 2AYXA 3URKA 1XPJA 1KQNA 4N01A 4UVDA 2G72A 1GA4A 5CA1F 1DMRA 2IZ7A 1SK8A 1EK2A 3LVRE 4FCWA 4MRMA 3THXA 2OBFA 5K4AA 4K88A 4JR2A 1X9HA 4Z99A 3EJWA 1XQ9A 3DOOA 1C7QA 2DBQA 4BJ5A 1N33B 1XAGA 1DJPA 4OHYA 1E99A 1J56A 1FJGB 3VR6H 2Y2VA 4R1NA 2L69A 2Q50A 1LK7A 3NHKA 4M88A 4ZT4A 5CEEA 1F2UA 2XGJA 1CUUA 1EK0A 1I3OA 1WUHS 2BEWB 3CG4A 2Z5LA 3M5WA 1Q17A 4R9NA 3Q8KA 1HYGA 3ZBPA 3BOSA 3ZOZA 3W7AA 4YUAA 4C88A 4Q7KA 1PX2A 3KFXA 4JDPA 4R31A 4JT2A 4PWZA 2VHEA 3MEQA 4QD3A 3FCCA 5CK5A 5DVZA 3EXIB 3UM9A 1QGYA 3WBJA 1GFIA 2VSNA 1K3UB 4NVRA 5L7TA 4L4ZA 2GERA 4TL6A 2LDXA 3RVRA 4V24A 4MVJP 5T6BA 1MAVA 5K3FA 4QODA 2ZR0A 4F0JA 1GCOA 2XKBA 3MJTA 5FNVF 1RJDA 2V54A 4R9VA 2HNKA 1ZUNB 4JT9A 5JXGA 4M0KA 1TNDA 1EBFA 1R74A 1ISFA 1VP3A 4AG5A 4EKDA 2QAJA 2NTVA 3BXHA 5CLLA 1OUMA 4H9GA 2X0IA 2GQ0A 4EPTA 5EHZA 4PYJA 2CUTA 1UBGA 1QRAA 2ZRKA 3GU3A 4KWCA 1E1KA 5DBGA 4D25A 4FGSA 3BTUA 3KQUA 1KMMA 1MFPA 3R5JA 1N9GA 3M4XA 2G09A 2ZIVB 2EFDB 3DC2A 3RT7A 1U7TA 3WQBA 1YA8A 4ZYYA 2ZDGA 4GR9A 2GILA 4YRNA 2DULA 3UWOA 1T4CB 1V71A 2ZTSA 2Z2JA 3IOYA 3T0IA 5HQJA 4KRFA 1PR1A 4G0WA 1PNVA 4XVQA 5CAEB 1PQPA 4PFJA 4XQEA 3EODA 1F4VA 5B37A 3SLGA 2D8AA 4ZYXA 1ZPDA 4G9BA 2QP9X 4YBZA 5T6MA 1Q12A 1WB6A 3VI3B 2EYUA 4Y9DA 1NOJA 1U94A 2CFOA 4FOTA 3NOXA 1X39A 2XNKA 1H2AS 3GZ4A 4U7HA 3EHEA 2OG2A 2G1PA 3EXEB 4UTNA 1H1DA 4BBAA 3FBGA 2YYSA 3OF3A 4FVTA 4AYWA 5FOWA 4DLRA 3DHYA 1ZUWA 4H3VA 3FF4A 2XB4A 5JAIA 2OAGA 2RGXA 3ORSA 4H1HA 4HMPA 3FM9A 1CHDA 1IPEA 2VK2A 1TK3A 5C31A 1CS4C 1WETA 3HYRA 3Q7IA 1QZTA 1OB2A 5G0SA 1X13A 1KP3A 1UPCA 2GN1A 4PAQA 3HK2A 4UXHA 1RLUA 4D9GA 4MV3A 5HDQA 2BYTA 2EAUA 4LOHA 4M1SA 3GAFA 3HXPA 3OCJA 3OX4A 4YREA 2QE7A 3R6WA 1QF9A 2F67A 3AM3A 3H17A 3RIEA 1JSLA 1PQ4A 3AFOA 3IXLA 3LXMA 4FC6A 4E2ZA 2REXB 3VI4B 4A16A 5I9MA 5J4KA 1WMBA 3BDVA 2NXEA 4YJGB 3VHRA 2Q6IA 3WYFA 4FJ1A 4B2IA 4XRGA 1SOWA 4NU8X 3H5OA 4Z54A 4OOEA 2OCXA 5AVJA 4LF5B 5KBYA 1ODIA 4Z0TA 2XSZA 4CHTA 2NV2B 1X74A 3UWSA 2AG1A 5ADWA 3TD9A 3CKLA 2GEUA 5AW3A 5IT5A 4M0UA 3FRJA 3TGLA 2C5AA 3ENQA 3IQHX 3BRWA 1YIAA 2XBLA 2RFLA 2IC5A 3P2IA 2ZBVA 4Q1CA 5ES3A 5FYQA 1E0KA 3M4YA 4X85A 5K4HA 1I14A 4OTZA 3CLSD 3ROGA 1QVZA 5EZ6B 1GPKA 1O96B 4V0KA 3PLAE 4ZOCA 1ST3A 2X9LA 3FPAA 1VRCA 3B53X 4FBMA