4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
1KSFX 2CLCX 3MG9A 4HB0A 4OQLA 1NMXA 5LB4A 4FI3C 1EX6A 1E9FA 1N6NA 3A1SA 3T1OA 1N6IA 3U3RA 1JPNA 1O3YA 1FFHA 1Z2CA 4TZ0A 2MSCB 3CKLA 3DHWC 4RZUA 2ZAOA 2BVNA 4EPVA 3I1FA 2WTUA 4QFMA 3NKVA 4IOLA 4LUCA 4AKHA 3H84A 4MUAA 1RC8A 4IDQA 4Z8YA 1MH1A 1U8YA 3L0OA 3KKPA 3OHMA 2ORVA 4IOJA 2JLRA 4YMSA 4O2LA 2PX3A 2G6BA 2FU5C 4RD4A 1NF3A 4JLBA 5K8LA 1E9AA 1NY5A 2F9MA 3AVQA 3GJ5A 2WJIA 3BH0A 4J0QA 1KI6A 3W8NA 1MABB 3GCGA 2ZI7A 1JR3E 2BV3A 2JLQA 2AD1A 3WNBA 3FPAA 1NNEA 2RMKA 4I1SA 2FWRA 5TDHA 1VG0B 4M9QA 4UKDA 1JR3A 2ZS9A 3C15C 2RGGA 3TR0A 3P26A 4A36A 3KXKA 4FCTA 2W2TA 4Y0VA 4ZV4A 3IIJA 4M1SA 2QGZA 4ON9A 1CR1A 4HB2A 2WJGA 3NXSA 2XJ9A 4OQNA 5B57C 2YWFA 1J99A 3QG1A 1OH5A 1DAKA 4D0NA 4G5GA 1A1VA 1Z6TA 2FG5A 3GJ4A 1LNZA 3N2EA 4C0HA 4YDHB 3C16C 3AUXA 4K46A 4TYQA 3RS2A 3GLIA 2XOKA 4OI2A 4UNSA 2XGJA 1T4GA 1NN0A 3WHKA 4OI0A 1MV5A 5IDVA 3LBIA 3N2IA 1IHUA 1P73A 3QE0A 5E4FA 1ZUHA 3B13B 1W2HA 1V5WA 2OLKA 2FH5B 2GEUA 4JVMA 3GLFE 4Q03A 2JLZA 3AVWA 1F2TA 2CJWB 3ASYA 4KFUA 2QEQA 3JZMA 4LYJA 5IHPA 3MMPA 1GSIA 1P3JA 4QGFA 4ESVA 3V9PA 1DVRA 4Q7LA 3CR8A 1RJ9B 1G7CA 5IK2D 3BFXA 1E2GA 1EFTA 1EK0A 2V7QD 3K70D 1UAAA 1CU1A 2GILA 3ZLJA 2GCPA 3QENA 5JECA 2V7QA 2AN9A 1XXHA 2AK2A 2B8WA 4S35A 1RRGA 3U3MA 3I61A 1XF9A 3CB4A 2OM2A 5AWFC 1N5KA 2BM1A 3LVRE 3U61B 4BZQA 3BFKA 2G0TA 3WY9A 5L3QB 1N5JA 4R2IA 1J90A 4YQFA 2D7DA 2NO0A 2A5YB 2WPDA 3V4RA 3FVQA 2NPFA 3B8HA 3H4MA 3P27A 2JATA 1TQ4A 1AZSC 1DADA 3QJYA 3OEHD 4OK6A 2I1QA 2DB3A 1FUKA 2CVHA 5GVRA 1R0ZA 1U99A 1XD8A 4AD8A 3I8SA 3FDIA 5EXXA 5C1BA 4HAVA 5AK0A 2O8FA 5EJEA 3EIHA 2GESA 3KJEA 1E1RD 3AKEA 3FWYA 1K5DA 4M1MA 1IN6A 4Q9JA 1VDZA 2NGRA 4KITB 4LHZA 4MYCA 3K0SA 2GXAA 3PVSA 4DXAA 3GLHA 2RGAA 4PQRA 1G7RA 4NH0A 4RVCA 4PSAA 1ODFA 721PA 2BMJA 3C8UA 2QP4A 1QG2A 2N42A 3BAFA 4LDJA 5CYPA 2ZRMA 1M1YE 2JA1A 2J0UA 4AKEA 1E6CA 1X8KA 2F1HA 3M4YA 1BIFA 1FTSA 3RDPA 3RANA 5JCZA 1KI4A 3BJIC 2JJ2D 4DSUA 2BC9A 2QMEA 1VCOA 4U7DA 1FW6A 2HDNB 4YXWD 3PUYA 1GNRA 4DCVA 2KE5A 4OJQA 2QTVB 2C8VA 4URWR 1XRJA 2ZVPX 3SE0A 3A4NA 2C9YA 2F43B 1CXZA 1L8QA 4EFLA 5L3SB 3I3SR 1DEKA 2IYZA 4WW0A 2R6CA 2WWFA 2V1UA 2OE2A 2CCGA 4QL3A 3T5GA 2ZU0C 4V0ME 2OT3B 2OXCA 4C0AC 3K0EA 4HZUB 1PZNA 4TYPA 1C9KA 1F5NA 4BEJA 3U6BA 2FV8A 1PLKA 3VMFA 1ZD1A 1KDRA 2AKYA 1KJYA 4RZ2A 2BKUA 1XEWY 2VSXA 2WVJA 2IYTA 2YWGA 3B1YA 4HEJA 4N0EA 3ZZ0A 4LWZA 2E87A 4QJ5A 1YRBA 2CE2X 1E0JA 1OH8A 1ZCAA 5IF9A 3GPLA 1EWQA 4B3BA 3DM5A 4WXPA 1KO7A 3B78A 1OB5A 4LJYA 2ZM5A 1WA5A 4DIDA 1OH6A 5DI9A 3HU1A 2CCKA 2P67A 1JI0A 2D74A 3FMPB 3GFPA 3LAWA 1OB2A 8OHMA 2XXAB 3K70B 4URYR 2NZJA 3SYKA 1VHTA 2ZAMA 2UZ3A 3I73A 3L8ZA 3RHFA 1Z63A 1ZNWA 2WPDD 2XB4A 2R9VA 1JB1A 4KO8A 1NKSA 3CW2A 1SXJE 1N2CE 5HPYB 3IGFA 3UG6A 3ND8A 1UBFA 4O2RA 4WVFA 4UXIA 4KU4A 3TSOA 5EXPA 4ZCIA 5KDOA 1OXXK 1XPUA 1II8A 1AS3A 1OFIA 3EASA 3MRSA 3K1JA 1QVRA 2REXB 2JLYA 1PV4A 2VHCA 4TL8A 3SHWA 3SFVA 2OILA 3PUVA 1R5OA 2R62A 5BN4A 5TV2A 3NH9A 4EPWA 1JECA 1ESMA 1Q0UA 5HKKA 4AI6A 2R6DA 5FTMA 521PA 3GMTA 1EFCA 2OV2A 1P75A 2D7CA 2J9RA 3ZVMA 4WZBE 2EWWA 2QNRA 5DI3B 1DAEA 1G3UA 1R7RA 2XTMA 1G5RA 2QSZA 3W34A 3CX6A 3OAAD 5L3QA 4Q7KA 4EQ6A 1G3IA 3D3QA 4CDGA 1S9HA 1SHZA 2EU8A 3LW8A 1NMYA 2CLSA 1ZNYA 4I81A 4G5SA 1W5TA 1WB9A 2IYWA 1M2OB 1UEIA 2C9CA 4BGDA 3CNLA 4CEJA 2G1KA 2BBWA 2PEZA 4JL5A 4UQOA 2GVDC 3KQKA 5JHGB 3D31A 1KO4A 2KBEA 3RWMB 1Z0JA 3KUCA 4NMMA 4Q21A 1XPRA 1Q1ZA 3SBDA 1IN5A 1SKYE 4BFUA 5LDDC 5F3WB 1ZVQA 3GQBA 2A5FA 2ZU6A 2ZEJA 1MR3F 3VX4A 3MWLA 2B92A 2PT5A 5BQ5A 3GLHB 4DC9A 4M1YA 4FD2A 1TAGA 3QF7A 1NBME 5KO2A 4GNKA 2VP4A 1KJWA 2O0HA 2OBLA 2VSOA 4LJAA 2J7PD 1JQJC 1OFUX 3CF2A 3BK7A 1BMFA 3ZIAD 2QROA 1ZD8A 1E1RA 1ZRHA 5DHFA 5CB8A 4PPQA 2J7KA 2GTPA 3N70A 1RRPA 1CJMA 4OQMA 2DY1A 4Z54A 1WQ1R 3U7EB 1HE8B 4NZYA 4QRHA 4LHYA 3BGWA 4QNMA 4POAA 2DFNA 4KAXA 2Z4RA 4EPRA 2OHFA 4Q4LA 3A4MA 3RAPR 3KB1A 1Z47A 1XTJA 2ATVA 2YINC 2AL7A 3J81k 2FSGA 3LNCA 5JLJA 5K8UA 4TMWA 2XNDA 3RC3A 2ERXA 3HDTA 5DHAA 5JI2E 3A37A 3O8DA 2HLDA 1QHXA 3KX2A 2GZAA 3RSOA 5KU1A 1SKQA 4G01B 4LPKA 1G8YA 2VHJA 1K8RA 4JLKA 2ZJYA 4B3CA 2ZI3A 4C7OB 5JZVA 3F0TA 2G88A 4B35A 4NL4H 4A8JA 2W2VA 1JBKA 3QKRB 4FWIB 2J0VA 3E5HA 4YLGA 4HAXA 4ASUD 1GAJA 3UKDA 1W4BA 1SVOA 2R65A 2GHIA 2YV5A 4IEIA 1W49A 2YJTD 4RFVA 4AYWA 2QZ4A 3AP1A 3B6EA 1D9XA 1HE1C 3CPJB 4Q7JB 5CB6A 1ZU4A 2NG1A 1N5IA 3T35A 1JJVA 4GP6A 4HAYA 4IDOA 1HQYE 4FCWA 1IN8A 2NOAA 2QT0A 1FPMA 3BWDD 3M1IA 1X1SA 1FZQA 4KXFB 2QBYB 4ZKEA 2MMCA 2X19A 2B21A 5IRCD 2C99A 2W6JD 4W7SA 3SJCA 1TQ6A 3W6PA 1OKKD 1W0JA 2ANBA 3IPXA 3VR1A 3BIFA 1LVGA 2LKDA 4U02A 4EPTA 3O8BA 1RRFA 1Z5ZA 2CBZA 3B1WA 3LX5A 5D3MB 4LX0A 2J41A 3NEYA 2WWYA 3DMNA 1E2QA 4QBIA 4D80A 1TU4A 2ZSAA 4TTQA 5G40A 1GVNB 4YMUA 2WAXA 2D2EA 1E9SA 2QM8A 3ZJYA 5EUQB 1CULC 1P72A 2Q9BA 3CM0A 4X8MA 5FOUA 4GZLA 4RJLA 3WXMA 1JJ7A 6Q21A 3AVVA 1IM2A 2EW1A 1GL6A 1HQCA 3K9GA 5AUQA 2OFOA 3CNNA 2GJSA 4B47A 4BE7B 1ZJ6A 5E3HA 1OHHA 1XEWX 4TTRA 3FMIA 1VCIA 121PA 2R6FA 3ADBA 3R9WA 1DPFA 3CH5A 4L15A 2C9OA 3UK6A 3KQLA 2FPMA 2Z0MA 3CPEA 4JLVA 2O8DB 2YC2C 4EJSB 2OAP1 1XCGB 4S2EA 1HY3A 5DGXA 3AF2A 3B82A 1GRQA 1US8A 1ZC4A 3MWYW 2XJ4A 5TVKA 1JEDA 5KNBA 1X8JA 5TARA 4B3GA 1T0HB 1AS0A 1AKEA 4D6PA 4BZPA 2C04A 1JXMA 1E2KA 1XCPA 1Z0AA 1YKSA 2FFHA 3ZZUA 2IEYA 1P9RA 3TR5A 2ZJOA 4F4CA 1B23P 3GJ3A 2JCSA 3ND9A 1N25A 1N6OA 4OKSA 1Z83A 4B3FX 4B2PA 5KHOC 3UWKA 1BYIA 1P4SA 5J4LA 3B9PA 4V0LA 3BORA 4XVUA 4RCYA 3DVLA 2QN6A 3LQQA 4LCBA 4XWAA 3UMRA 2BMEA 1L7VC 1XMSA 3BERA 1LF0A 3ZQJA 4PO9A 1G19A 2Q9CA 1ZM9A 4DKXA 2GRJA 1YZQA 1T8TA 4I1VA 3U44B 2GJ9A 5B30A 2ZRPA 2WOOA 4ZKDA 5FR2A 1OV4A 3GLIE 2HCBA 4XTCS 4DDTA 4BFSA 2J87A 3G5UA 3W3AA 4A8JB 1T5IA 1U90A 1N6KA 4OK3A 3TQCA 4Q4HB 2ZRGA 3GLFA 2JLWA 5SZIA 4NYMR 1GTVA 2RGCA 2GEDA 3F5FA 4B71A 1CJUC 1W7AA 4L4UA 5JRZA 3KQUA 4EJSC 1AQYA 1FMJA 3BXZA 2VTKA 1E4YA 1P2VA 3DZDA 1XTSA 4CEIB 2OBNA 1TQDA 2JLXA 1XTQA 2HT6A 3SJZA 1H8EA 4IDPA 4CEJB 3GEHA 4I1UA 2QM7A 2RGDA 1ZINA 4LYHA 1G7TA 3DEFA 2KI5A 5DLQC 2O8EA 2HUPA 4KSBA 5KPDA 1L4UA 2BBTA 4JYCA 1I2DA 4DCTA 4URVR 3Q8XB 3BE4A 1I4TD 4DUGD 3RLFA 4GZMA 3BB3A 4AWXA 4U5XA 3FKQA 5FPSA 2QSYA 3JVUA 2BKEA 1KK0A 4L9SA 5FOWA 5DH9A 1KAOA 3ZD7A 4Z1MD 1ZCBA 4WAUA 4YDSA 4KVAA 5CLLA 2QG6A 5GJBA 3KJHA 3MWKA 2CNWA 4RD1A 1T3SA 1N0VC 5HR5A 5TB5A 3LW7A 3LXXA 5C4GB 5J4YA 2F1JA 2VF7A 4HZUA 2QU8A 3RWOA 3U5ZB 2ZR9A 1G291 3QVUA 3PCRB 1G8FA 3EAQA 1KMHB 1OSNA 2GA8A 3PUZA 4XD7D 5EUMA 3RSLA 1TF7A 4Q4JA 2WAYA 4O0MA 3D7MA 4NONA 3R20A 4NU0A 4FINA 3BFVA 5GVSA 1GKIA 4RD0A 3FKSA 3CPHA 5FPTA 4IDNA 1E9CA 2PLFA 1XTIA 2O8DA 1AQUA 3WMGA 1KSGA 2A30A 3CRMA 4BFYA 3B1VA 5FBVB 3AEZA 4TLAA 4TN1A 1L2TA 2V4ZA 1GZSA 1YZNA 2ZUDA 3U6KA 4ZI2A 4B43A 3TE6A 1N3BA 4F91B 3QPUA 3OE7D 4UXJA 3SHFA 4QBFA 3RC8A 4X8HA 3KKQA 4OQFA 4MITA 2OCAA 4BECA 2IS4A 3DO6A 2P6UA 2ZE6A 3D8BA 3HU3A 3KB2A 2QL6A 3SR0A 1GWNA 4M8NE 1XU4A 1MRNA 2ZRIA 1XJQA 1N6RA 1AZTA 2WICA 4L16A 3MSXA 2AXNA 2ZS8A 4NCJA 1CP2A 1KHTA 2G83A 2XSZA 2WJYA 1AK2A 2O5VA 4GOKA 4JL6A 4WBSA 1RPZA 1E3MA 5JRJA 2R44A 1ZBDA 2ZJ5A 4V0OA 1IN4A 2WWHA 4MRRA 2ZTSA 4FN5A 3WP1B 2QAGC 1ZIOA 2ZRCA 2PZGA 1U81A 4IVRA 1M8PA 1LY1A 4L8GA 4P4SA 1GRRA 2V9PA 3FKSD 1GG2A 4LOAA 5GJVC 1PJRA 3VHXA 4C2UA 1CF4A 4Q48A 1QG4A 3K09C 2Z5FA 4ZIRB 5KSZA 3VR2A 4GOJA 4XD7A 1Z07A 2Q3MA 2ONJA 3THWB 3FMOB 2V1XA 4DB2A 1WXQA 2UVQA 3QF4A 2ONKA 4DLSA 2DCUA 5KTYA 4RFSB 3W6OA 2OUKA 2ZYUX 2H5EA 2J3EA 4BZXA 2QMHA 4C4PA 2YWEA 4A2WA 5JCPA 3AVTA 3RRYA 1EFRA 3I8XA 1W36B 2BJVA 4LJ8A 1FP6A 3A4LA 1UF9A 3U60B 5AJXA 1COWA 3QKUA 5A5GA 4URZR 1IXZA 2BIFA 4Z1MA 2EYUA 3FHCB 2PZEA 3LWNA 5CITA 4Q1FA 4M1OA 4TYYA 3I72A 2IXGA 2ZI6A 3AGQA 4JLDA 4DWJA 5J47A 1Q1QA 5G41A 2W58A 2YC4C 5K8TA 4AC9A 3AF0A 3THXA 3MFYA 4HAZA 4EDHA 5F2EA 4B3XA 4M53A 4YMWA 2C77A 1UEJA 5DN6A 4ZCLA 4HAWA 1SVLA 4C0QC 4Q01A 1G3QA 4UNPA 5EXTA 5G53C 1F2UB 3R7WA 3FE2A 4OHXA 2P6RA 2H8KA 2G0NA 2ZRBA 1C4OA 3RRZA 3LQRA 3TVDA 2ASEA 3PEUA 1K5GA 2CDNA 3WHLA 2ODBA 1E2HA 1M6NA 2RGNA 3IHWA 2QAGB 4QJ3A 1X3SA 4X8OA 5LD2C 5C4MA 1UBEA 1Z8FA 3EPLA 4IXNA 4CZ2A 2A2ZA 5KNDA 4OYHA 4Q1DA 3U2QA 3AKCA 1BH2A 1YRAA 3NTUA 3ICEA 4QHTA 2RKOA 2JJ2A 1JR6A 3A1WA 2QAJA 1SZPA 3K0AA 1UKZA 2YNMA 3WMFA 5JJIA 2IXFA 3ZGXA 3GD7A 4PANA 3Q5DA 4PFSA 1LF5A 4II7A 4LBZA 2NO9A 1IAQA 1KY3A 2WJVA 3WNDA 1KKLA 1U0JA 2GK7A 3AVYA 4PC2A 4QM6A 1UBGA 4B76A 2RAPA 3EZFA 1FTNA 3MJRA 3R8CA 4TZ6A 2C96A 4C3ZA 2C2HA 1GNQA 2ZANA 2GAOA 1IY1A 4WZAE 1E1QA 2GCOB 3K0CA 3LBHA 2W00A 4HDOB 4YMTA 4GBMA 1S1MA 4C0SA 1NKTA 2VHUA 3RS0A 3AKYA 2J1LA 4Q1BA 1GKUB 1DARA 1NVVQ 4TMXA 2VF8A 4TMVA 2JLUA 4HB3A 4V03A 1BMFD 4PZZA 3MWJA 1ONBA 1D6JA 2X1VA 1TL7C 2IHYA 2KBFA 4BLOA 4AKGA 4MRSA 2FX3A 4TMKA 3M6AA 3I4LA 4BEBA 4DLUA 4GRAA 4OK5A 2VPPA 5TMPA 3LLMA 1NSFA 1GILA 1S96A 4HZIA 5JWOA 1IXRC 4D2IA 3IEVA 1KI6B 2RGEA 4Q9LA 2VP9A 2ERYA 1OXUA 4RCZA 4CEHB 3SU8A 2WJHA 4HUTA 1D2NA 1OW3B 1G4AE 1B0UA 2XTZA 1JALA 1I2MA 4PO8A 4QC2A 5KSOA 2ZI9A 1JAIA 3R8FA 2OLJA 1WP9A 4ZIRA 3L82B 3T15A 1H8HA 4R7ZA 4TMZA 2L0XA 3NDBB 3AH8A 2FZLA 3AP3A 1Q44A 2YYZA 2ECKA 2J0QA 1S4QA 2IF0A 2ZETA 3U3OA 3Q5EA 1IQPA 1R0YA 1XFAA 1LW7A 1R2QA 3MAAC 1BOFA 2J45A 4BFVA 1G20E 1EFUA 4TYWA 4R98A 2GXUA 1QHSA 1RFLA 2C5LA 5CDFA 1XP8A 3REFA 1CBUA 3MD0A 2VSFA 1VMAA 3QNUA 2QE7D 1C1YA 1RZ3A 3ZVLA 3PXGA 3A58B 1BO6A 4DBLC 3O8RA 3AGPA 3CX8A 2PL3A 3HPQA 4BFZA 5CK4A 2ZVQX 5JEDA 1P60A 2WMOB 1L4YA 4IFBA 4JYBA 1E2JA 3GFOA 3VU9A 4V0KA 4BRWA 1E32A 4QJ4A 5KDDA 1AJEA 3CRVA 1KK2A 3T06B 3TUIC 5AJZA 2A5DA 5J40A 1TNDA 3QPWA 4JMPA 1ZM2A 4M22A 2QT1A 4D25A 1S2MA 5JWHA 4MGKR 2Q3HA 1J7KA 5CIQA 1NY6A 1XD2B 4PAMA 1AGPA 1KDOA 4JSYA 3VNUA 5C46F 3K0AB 3REGA 1TQ2A 1ZNXA 1UADA 1LB1B 1A2KC 1ZM3A 1CJKC 3GEEA 1OE0A 1UKYA 1XXHE 4OHWA 4B48A 1DG1G 3ADCA 4LYAA 2VIIA 2VLIA 2HLDD 1KI2A 3BD9A 4WOPA 2V55B 3WYFA 1SXJA 2JJ1A 2ZE8A 1GP2A 4B2IA 2VHTA 3OFND 1MRSA 2HYDA 5EE9A 2E1RA 1OFHA 4FIDA 4NPHA 4V02A 3TMKA 4PQYA 621PA 3U4QB 4EJSA 1P5ZB 1R8QA 1SQ5A 1TUIA 1E2LA 3QXHA 5HCNA 3ZYCA 4ERNA 5KNCA 3AM1A 4JLOA 3AF1A 4PSKA 4B32A 2Z43A 1DAMA 4KHZA 3KTAA 3NVAA 4EFNA 2LCFA 3S1AB 4F7WA 1KJZA 4FWTA 4GL2A 3AF4A 3OF5A 2HEIA 1BS1A 3E2IA 1XBTA 2WWXA 5AR1A 1G1MA 3MGCA 3Q85A 1BYUA 1AN0A 4U00A 1CTQA 5H8WA 2QRNA 3QEJA 3TW4A 3DL0A 5TY0A 2XZLA 1UDXA 4JJKA 3NH6A 1HTWA 2YVUA 2CK3D 2W0SA 4F92B 3K09A 3AV0B 2GXQA 5EXSA 4ACBA 1U0LA 221PA 2V6IA 4EIWA 4MH0R 3QSYA 2IS6A 1QHIA 1W1WA 3AF3A 3ZS8A 2OZEA 2F43A 3BH7A 2PCLA 3SI7A 3KKOA 2ZUBA 2FZ4A 3AVOA 4LBYA 4B34A 1Q21A 4NDZA 2IYXA 3NBXX 3TW8B 1SKYB 3HYRA 4FMDB 4PAOA 3R7WB 2ZRNA 4ZDJA 1UKEA 4QGAA 4C2TA 3A6PC 4IKEA 1QZXA 4QNRA 5SZKB 5JEEA 3CLVA 1R8SA 3KTAB 3L0PA 1G3MA 1ZW6A 4E03A 2DR3A 5EP1A 5G3ZA 4D4MA 1NBMA 4B73A 1MOZA 3P1JA 4XTRA 3TK1A 3IPYA 2EFGA 2O8CA 2W83A 4KV9A 4NYIR 4Q4HA 4F93B 1MO5A 2O8BB 2X2FA 3EZ7A 4KJZA 3K0FA 4Q9HA 2GNOA 4LYFA 1OXTA 1JAHA 3QXSA 5KYKA 4W5JA 3Q7PA 1FNMA 1E79A 1Z6GA 1A4RA 1TF5A 1RIFA 1XXHB 1ZM4A 2FJUA 3UMSA 1JQLB 1YR7A 1T0JB 4JZKA 4MGZR 1EFHA 3K0FB 3T61A 2FEMA 1T3HA 2NO6A 3LY5A 3WNCA 4RD3A 4M1TA 1S0UA 4JLPA 1VYUA 1WE2A 5AUNB 4V0MA 1UBCA 1ZNZA 3WBJA 2ZR0A 3W90A 1N6LA 2JJ8A 5FH9A 3A8TA 3OAAA 2B7CA 2EQBA 2IEZA 2P6NA 4CYMA 5EQTA 821PA 1QF9A 2GJAA 3BS4A 3RNLA 3SZRA 3VU9B 2SHKA 4URXR 2UZIR 5K8IA 1OIXA 5HE9A 1N0WA 1I4LD 3CZPA 2FGJA 1ZMXA 3KXLA 4P32A 1SVMA 1YR8A 3X1DA 1OIVA 2QPAA 4AKIA 1OYWA 4EFMA 5JMTA 4LV5B 5EE1A 1E0SA 4HDQB 5GJCA 2I1VB 5CYOA 3U7FB 5JS7A 1G5PA 1G8HA 3HR7A 2ZI5A 1G6HA 1FNNA 2IHBA 4NKRA 1R0WA 5E95A 2GXSA 1XPOA 1OIWA 1IN7A 5P21A 3EW9A 4MKHA 2FN4A 5DIFA 2QBYA 1XMVA 2V8OA 2D4HA 3OZXA 3SQXA 3VFDA 4MA4A 2XOKD 3IBYA 3T1VA 2Q3FA 3FTQA 5F9FA 2WJJA 3EPHA 2CHVA 2QMUA 1IBRA 2XEXA 1S8FA 2ZSBA 4G5RA 5FI0B 2GF0A 1G21E 2VA8A 4RD6A 5FTLA 3PUWA 3P32A 4YONB 2EVWX 1QHNA 1P9WA 2W2XA 5SZHB 3L8YA 4L9WA 4LY6A 2C78A 2PMDA 2B8TA 1U94A 1P2UA 5EZ6B 4D4KA 1TTTA 2JLSA 2Y8EA 3SS8A 4E5UA 1KI7A 3W9YA 1IJFA 4MGYR 2XXAA 4BLTA 3NC0C 2H7VA 3IDQA 4LRWA 1GRNA 1WBDA 4C7OA 4DZZA 1TX4B 3W5JA 4JBXA 3FFAA 1COWD 4DEXA 4Q1AA 3X1XA 1R5BA 1CJTC 1DBSA 4A0FA 1E9EA 3SDZA 1LS6A 1MT0A 4TLBA 3TAHA 4AURA 5CK5A 1YE8A 5J4KA 2KWIA 1KIMA 3UATA 2QPOA 3TLXA 1U0HC 5EP3A 5UKDA 5DE3A 2ZQ5A 2C03A 1KMQA 4DLTA 3AVUA 2RB4A 2GDJA 1M7GA 4DCSA 1Z0DA 1KI1A 4DLYA 2FNAA 3EIQA 2J46A 4GDFA 2DWQA 4GPTA 2DPXA 1AKYA 5AJYA 4DLXA 2H92A 1HT1E 1FMLA 1OXSC 4LV6A 3HJNA 3TVTA 4ZDKA 5LD2B 1NVUQ 4H9GA 4D81A 4PC3A 4TLCA 1XWIA 4PPFA 4MQBA 4US1R 2WMNB 2XTNA 1W0KD 1QHHA 3WRXC 1NI3A 3E70C 2EFDB 1Q22A 1DAHA 2PEYA 3SYLA 3EX7C 4QKQA 2F7SA 1CKEA 1KNQA 1Q1BA 3EIEA 4ARZA 3ICQB 1UFQA 3ZVNA 4MGIR 2BCJQ 4QM7A 2ZITA 3TAUA 1KI9A 2ZRKA 4CEHA 1IY2A 2GZDA 4C0KA 4DVGA 1DAGA 2Z4SA 4DHEA 5GADl 5IK2A 4Q7MB 3CO5A 2QQ0A 4KVGA 4EKDA 2ZJAA 2ZJ8A 3OE7A 4Q1CA 5D3QA 5L3VA 4MDFA 2FFQA 4CGZA 3PQCA 3GFTA 4P33A 3LRPA 4IXMA 4KYUA 3W3ZB 3UMFA 4DT1B 1TEVA 4DSNA 1E2DA 1VG1A 4KODA 1KDPA 4P4SB 3KQHA 4GFDA 4C9BA 2RGXA 421PA 5DNYB 4TWZA 2XZPA 3LD9A 4TQUS 1U8AA 4JKYA 1O87A 4BWYA 4C0LA 1NJFA 2IBMA 4KI0A 1G16A 2OAQ1 1XTKA 1LFDB 4BFTA 3V00A 1M7HA 4K8OA 4RFSA 1F3OA 2DBYA 1KZ7B 2IK8A 2REOA 4KCGA 3VR5A 5BYJA 3CBQA 3ZVRA 1QRAA 4B6EA 3JZAA 2X2EA 2W6JA 3FMFA 1FUUA 1HURA 2WKRA 3ECCA 2GJ8A 3VQTA 3WRYC 3FHTA 1XJCA 4NTZA 4MKGA 2R6GA 1RW4A 5DISB 4BASA 2ORIA 3C4JA 4JSTA 4CT4B 4B75A 3KDSE 3IO5A 5CIWA 4OJKA 3C5CA 2QPTA 2FFBA 1GNPA 2AKAB 4NYJR 2HYIC 3EPKA 1NN5A 5FTJA 2IYLD 1E9RA 4CT5A 5BN3A 1NN3A 2WWGA 1ZP6A 5BYKA 4H1VA 1W44A 2RGBA 1Z6YA 2VH5R 4XVRA 4RSGA 5BN5A 4OHZA 3U3JA 5E7MA 1RYFA 2O8CB 5J4HA 3GP8A 3KKMA 1F48A 3CRW1 3QKSB 1ZUIA 1DOAA 3EC1A 4EUNA 3I5YA 5JBQA 1J2JA 4ACAA 2CLDX 4A0HA 1WBBA 2G3YA 4M21A 5FTKA 1E2EA 2GAAA 2NPIA 3ADKA 4PSVA 1XEFA 2ORWA 3CH4B 4P3YA 3SBEA 2EFHB 3GJ7A 4Q5IA 2W6IA 3WYAA 1A7JA 3HP1A 4H1UA 2BWJA 4MRNA 1E9BA 1CRQA 4QXAA 4RY2A 3QKRA 1P2TA 4Z51A 4ZDIA 3EA5A 4PHGA 2O0KA 1UKVY 3QUSA 4TL6A 1YZGA 3LBNA 4OHVA 2YOFA 3ZIAA 5JS8A 4AK9A 4RZXA 4MDEA 3THXB 1XDBA 4DLVA 4ZPXA 2JLVA 3H2YA 1SULA 1KTVA 1ZIPA 2QTHA 2IUTA 3CRQA 1RKBA 1NJGA 5A0FA 1D2MA 1XB2A 2DWOA 1OFTA 1TU3A 1YR6A 2PLRA 3THYB 1EG7A 2OFXA 4AY2A 2QY9A 4BLRA 1D2EA 1KK3A 2F55A 1E2IA 1JNYA 5EE0A 4A15A 1NIJA 4PPNA 1TF2A 1YZTA 4P4UA 1R10A 1ZC3A 1RE0A 4M9SA 1CS4C 5FI1B 4D0LB 3LLUA 1QDEA 4UNQA 4A6XA 3R9XA 2C95A 2VHQA 5A4JA 4EAQA 3DPUA 2AX4A 4BLPA 4A9AA 5BWMA 5L3SA 2R2AA 3C41J 4DDWA 4PC1A 1J70A 4G3XA 4BLQA 4XOIA 3DKPA 1NRJB 1J8YF 1F2TB 2FSIA 1KKMA 3FFBA 4MKFA 2F6RA 2XNSA 4FMCB 4NBSA 3EARA 3W8RA 3BB1A 4JBYA 5DI3A 3A36A 2ZRDA 3KQNA 3B5JA 3C14C 5JI3E 2IYVA 5EE3A 4JLNA 5ELXA 2J0UB 2CEAA 2ANCA 1W48A 4ARZB 2CE7A 3EWAA 1X1RA 2KB0A 1KAGA 3EC2A 3KKNA 5HKKD 4JVNA 2ODNA 1K6MA 5H1YA 4TQAA 4BLSA 1GIAA 3IBGA 3QEOA 1DG3A 1HEIA 2CHQA 3BBPA 3QKTA 4JBWA 2FSHA 4JL8A 4DLRA 3OEHA 1VCNA 2ZSEA 3HR8A 3CWZA 1QHGA 3GJXC 2CVFA 2P3SA 1E2MA 2ODWA 2QENA 3CNOA 1XTRA 2AWOA 5FPYA 1NIPA 1P9NA 3EG5A 3TUZC 2DFLA 3PFIA 1SGWA 1YHNA 3PEWA 1D5CA 3GJ6A 2ZE5A 4PQFA 3K53A 3U7HB 2X77A 2OCPA 4UXHA 3RS3A 2QRZA 1MO4A 4P4TA 1PLJA 1E69A 3BH6A 1N6PA 3IQWA 3B2EA 1NG9A 3CONA 4DIEA 1JPJA 3AVXA 4GT1A 5H70A 3GLFB 5FUWA 3K8YA 1TMKA 2NQ2C 2DFTA 2ZYTX 4O3MA 2G1JA 4DCUA 3NC1C 4RKFA 2WSSD 5DO9A 2QE7A 4I1OA 2V6JA 1II9A 1P62B 3U4QA 2G77B 4LK2A 1WRBA 4HI0E 2IA5A 2OO7A 5CM8B 3KFVA 2H18A 2ZYWX 4ILEA 2YKGA 3BC1A 4CW7A 4FW9A 3VHLB 4ASUA 3ZDQA 1GDDA 4XIGS 1NMZA 3Q7QA 1S3GA 4C0BA 3PUXA 1YR9A 2P65A 4PC6A 4MYUA 1UPTA 4TQ9A 1E0KA 4A0RA 4EPYA 2MSDB 2VEDA 5B2ZA 4UJ3A 4A82A 3L43A 5FTNA 2ZIAA 4LHWA 1E2FA 1ZUNB 2JDID 1SVIA 2VP2A 1OH7A 1G9XA 1KO8A 1N0UA 4LJ4A 4AG5A 4UNRA 3THWA 2Z6VA 4F4IA 1EESA 1J8MF 1VCMA 1IONA 1G64A 1VPLA 2CK3A 5FOSA 3LV8A 2O0JA 2AD5A 1OLOA 2ZYVX 3X1ZA 2QQEA 4KFTA 3PV0A 5JJLA 2IW3A 1E96A 4TT3A 2ZR7A 2O8FB 4US0R 1NVXQ 2BMFA 1E99A 5KSPA 2R8RA 4MYHA 1IXSB 1Z28A 3PR1A 1M74A 4LC1A 3KJGA 2QAGA 2J0SA 2I3BA 2NIPA 2Q0HA 2WKPA 4A6PA 4NE2A 3DOEA 5FUYA 4B33A 2J7PA 3BRWD 4LHXA 4HLQB 4HUQA 3NWJA 3O47A 4KLNA 2CCJA 4Z8XA 1XZPA 5FBQB 3VX3A 5KOYA 3GLGB 4B74A 2X8AA 1GL7A 4PHFA 3QBVA 5FL3A 1W4RA 4MRVA 5E7IA 4IRUB 3OESA 4ZI3A 2IWRA 3M0EA 4TSFD 3FYHA 1PUJA 5SZJA 5CDFE 4DSOA 4IDHA 1MO3A 4JVLA 2VBCA 2RGNC 4IHQA 5B58C 4Q4JB 1DAFA 3AB3A 1WF3A 2NTYC 5JJKA 4ITRC 3FGNA 2P2LA 2VP5A 4IEEA 4XWKA 1GITA 2Q6TA 1YZKA 3BB4A 4A2PA 4KBGA 4OQXA 2AWNA 5CM9C 3CRRA 1U98A 1Z22A 1KGDA 3IILA 2WM9B 2D3WA 1OF1A 5D3MA 1IY0A 3RVBA 3GJ8A 5KPJA 5JSZB 1R6BX 3THOA 3T1QA 2CL6X 4HAUA 1Z0KA 1XD9A 1HUQA 3X1YA 1P61B 1ZM7A 2ZJBA 3RRMA 2P0EA 3TJZA 1KNXA 4HATA 2BBOA 2B7BA 2QA5A 4F4JA 4Q4AA 5LPNA 1ESNA 4IVPA 3K9LA 4F38A 1CLUA 5EZ5A 2WHXA 2FSFA 3A1VA 2YOHA 4Q9IA 5HZHA 5TXGA 2PMKA 1NLZA 3VKGA 2VP0A 1QHHB 1HV8A 3P4YA 2VYFA 4PHTA 4A8JC 3DDCA 3KXIA 3QXCA 5H68A 3EXAA 1LV7A 1E0AA 3W5IA 3X1WA 2AHOA 3UG7A 3RABA 3K9NA 4EQ6B 1JXOA 1ZU5A 1JEEA 3E1SA 4HSEA 1S9DA 1Y63A 3PJRA 3IIKA 3O8CA 3WMEA 4WIAA 5M04A 5KDLA 3OIYA 4B44A 3OIWA 4HLUC 2D62A 2FFAA 4A4DA 3DZ8A 1T8UA 2N46A 2XX3A 3C5HA 2TMKA 2XAUA 1FX0B 3GLHE 3AUYA 3QF4B 1FP7A 2HXYA 1VG8A 3LDAA 4D0GA 3FOZA 4MKIA 4LJ9A 1UJ2A 4ABYA 3MCAA 4I99A 2HF9A 1PUIA 1P6XA 5B64A 3PEVA 4D4LA 2REBA 1H8HD 2BBSA 1E2PA 1R0XA 5L8VA 4QHSA 2CXXA 1W46A 5EP4A 3LFUA 4O25A 4XVQA 3TIFA 4HLUA 5FOXA 4G0NA 3H1TA 3NBFA 1ETUA 2GJKA 4ZCMA 3P4XA 3TKLA 1P2SA 2O8EB 1M7BA 2JASA 4PPGA 5C18A 3VR6A 2WIAA 3FB4A 3RS4A 3QXXA 1AS2A 1XMIA 1E98A 2IF2A 1W36D 2XB2A 4RZ3A 3U44A 3ZQ6A 1XJ0A 1G8PA 5ANRB 1VECA 2VRWA 4LJ7A 4A2QA 2PT7A 1OHHD 1R5NA 2IL1A 3L2OB 1XEXA 2IYSA 1I4DD 4NCNA 2BJWA 2F1IA 2JAQA 2QMOA 3DOFA 3L0IB 1XMJA 5FOTA 2QORA 2FGKA 4V0NA 1GKYA 3AP2A 4BRUA 3EZ6A 4M2LA 4JIMA 1E1QD 1RYHA 3QI2A 1HYQA 2BDTA 2H57A 2OBMA 4URUR 1UM8A 4CIDA 5BW8A 1IOZA 1TUEA 3CIOA 4M1WA 3SNHA 4LBVA 5AJVB 3PENA 1NLFA 5F98A 3SFZA 3SN6A 4B3DA 2NMVA 3OFNA 2IWHA 1RRCA 2J5XA 2XZOA 1RJ9A 3EZ2A 1KI8A 1U2RA 1CR2A 2F3TA 1F60A 2GK6A 2LKCA 4M0LA 2HT1A 2YZ2A 2GKSA 2ZRJA 2WWWA 4DSTA 1X86B 4IJMA 5FL7A 4JJZA 5EP2A 1MABA 1SXJC 2GETA 4TL7A 3KL4A 4RKEA 1D8TA 1Q3HA 1T5LA 3LXRA 2OSBA 3THYA 2B6HA 2ZRFA 1H8ED 3ETLA 5AJWA 2IC5A 5LBIA 1XEXB 1E9DA 4KFSA 3T34A 3VR4A 5JSZA 2QUZA 4HLCA 4ZDWA 3WBKA 3VNVA 2HJVA 4W9MC 4KBFA 2H17A 4A1FA 2ZRLA 3RS5A 5CLQA 1ZYUA 2V54A 3UWOA 4B2LA 4LBWA 3BOSA 2OESA 1SXJD 4G5OA 4DUGA 3DMDA 4JVSB 3ADDA 4N3NA 2WV9A 1NLYA 3ASZA 1QBKC 2ODEA 3TSWA 4NCHA 1G6OA 1IJEA 3IHLA 1VIAA 4DDVA 1VYVA 3AKDA 1T3LA 4TL9A 1GM5A 1UDWA 1EWRA 2ATXA 1Q1EA 2OG2A 3TRFA 1YJ5A 4FCVA 1X6VA 4M9ZA 1XNJA 1MO6A 4G5QA 4ESHA 2QTFA 3X2SA 3IKJA 3B7GA 2AK3A 2CJWA 1CJVC 3RS7A 2EFCB 4PXAA 4OI1A 3GJ0A 1OJLA 3TSZA 1Z6AA 2PZFA 4Q18A 2K5UA 2RCNA 2UKDA 4M9XA 4YMVA 2GF9A 3QKSA 2CMKA 4YC7A 4R71A 2IYUA 1PLLA 2BEKA 2OCYC 1X8LA 1G7SA 5J5CA 3EPJA 4PO1A 5HE8A 1EFRD 4B6FA 5IT5A 1PVOA 1VHLA 1DS6A 4R2HA 4BPBA 1VYTA 1TPZA 4OL0A 1OXVA 5FPKA 1Z0IA 2BEJA 4DDUA 2DHRA 2GBLA 1GOTA 2W6ID 3NIBA 4NYJQ 3ZD6A 3LH5A 1KSHA 2EFEB 1HT2E 2DWPA 3G82C 1D9ZA 2WZQA 1W36C 2BOVA 2WWIA 3K70C 3LO5A 4JLJA 5DYIA 1DE0A 4CRWB 1SXJB 2ZRAA 3TBKA 3IO3A 1G8GA 1JR3D 2GCOA 4PAQA 4P31A 2WKQA 1S1CA 2IX3A 4GSYA 4JLAA 4Q66C 4TTPA 1W4AA 1LTQA 5AUOB 5JWRA 4IW3B 1Z2AA 2XSZD 4NCKA 1NBMD 1SVSA 1FX0A 2GCNA 2OFWA 1Q20A 4QBHA 4ZO4A 1KK1A 2ZREA 2RHDA 1YZUA 1II8B 4K81B 4MRPA 3T1TA 3MUFA 5LB2A 4HYYA 3G0HA 5J4VA 2LWIA 4XWOA 2ZXUA 4WA7A 3W6NA 3F8TA 1W5SA 2D06A 4HDCA 5CJ2A 4PTLA 2VL7A 3ZZTA 4JLMA 4AIIA 2NO7A 4X8LA 2GEVA 3LX8A 2NZ8A 2Q9AA 3B60A 2EYQA 1KOFA 2FEOA 1T91A 4OBEA 2CNWD 2IXEA 3VTKA 2P5SA 1W47A 1HA3A 1QVAA 3VAAA 2H1LA 4TLDA 1N5LA 2MMGA 2ZSFA 3OEED 4GOXA 1FL9A 2CL0X 3PG5A 5DYGA 4EPXA 1Y3AA 2AXPA 2O8BA 4AYTA 3Q72A 5HCIA 1Q3TA 4UJ5A 1A82A 2PH1A 3NDPA 3QOFA 3PEYA 3SJAA 2A3RA 3PITA 1XCMA 1KI3A 1U9IC 3R9IA 4US2R 1DO0A 3CZQA 4XSHA 2FA9A 3CWQA 1GL9B 2AFHE 1S3SA 2CHGA 4TYNA 2ZUCA 1QHYA 5DN6D 4TLEA 2GWHA 2N1BA 4LZZA 5FR1A 4DRZA 4OI4A 3UPUA 5EE5B 1G4UR 1DAIA 1KZGB 4NYMQ 3U7GA 4LJ6A 3HWSA 1ZD9A 2ZS7A 4DLZA 5HZKA 1G41A 2QGNA 3HYTA 1YVDA 3Q3JB 1MKYA 4JT4A 3B9QA 4M1KA 4N1AA 4DCNA 2JIZA 2OXRA 5DSZA 2H16A 4GMXA 1TEXA 1YQTA 4DB4A 1NP6A 1BKDR 1Q12A 3CF0A 2JIZD 2PX0A 4FMBB 2JJ1D 4N0DA 2HF8A 2HXSA 2NO1A 1RVDA 1OKKA 1W0JD 1F6BA 4JT2A 5CJPA 4M4SA 1W4CA 4BFXA 3IIMA 2IS1A 4G1UC 3PIRA 3KUDA 2A5GA 2GBLC 4XSGA 2IUUA 4Y0AA 1SVWA 3SOPA 3QQ5A 4CVNA 4CEIA 2QI9C 2FOLA 5KSYA 1DTSA 2JEOA 5HTKA 3DKVA 1AM4D 1ANKA 4GMDA 1Z0FA 3GLIB 5L3RA 3VKWA 3HU2A 4WXRA 2QP9X 3SYNA 5JFGA 1FQKA 2HV8A 4PZYA 2GZHA 2RHMA 5FUXA 4W5HA 3B1XA 4TMTA 3OEEA 2DFKB 2YOGA 2I4IA 2ZE7A 4JKIA 2PJRA 2JDIA 1Z08A 2A7QA 3CR7A 3IEUA 4FXPA 4Q19A 4KFRA 5KUTA 1DO2A 3CUEF 4OHYA 4LV8B 1NG1A 4QHYA 5C2JB 1CRPA 5FL7D 3U3KA 4YXWA 2V3CC 3C7KA 3GEIA 1WDTA 3KJIA 4L5BA 3Q9LA 4DT1A 3I62A 1EX7A 2OEPA 5FBWB 1XZQA 3QIAA 2BMDA 2MSEB 2G9NA 1TADA 1OT3A 1CIPA 2GVZC 3JVVA 2A9KA 1HH4A 2XNDD 3NBYC 3NHBA 4C0JA 4UNNA 1VG9B 2KSQA 3LA6A 5FBRB 4E07A 4LGMA 4HUQB 1Z06A 4P0TA 3A1TA 2ZI4A 3OIVA 4HB4A 4GP7A 3H0KA 1G3RA 1W2GA 2CL7X 2F3RA 4QG7A 2XITA 4Q1EA 1AGRA 3TQFA 2WSSA 4E22A 2A78A 3CF6R 1KY2A 2EWVA 5E7JA 3RRNA 1GUAA 1LS1A 1U8ZA 2IT1A 4XJXA 3SJBA 4IVQA 4PX9A 4KSCA 2E9SA 4LJ5A 2WOJA 1XX6A 3NBZC 4W5WA 2F9LA 4Q00A 1SVKA 3KZ1E 3IUYA 4PR0A 4LPSA 1AA9A 4IFEA 1V43A 2YHSA 2DYKA 1Z29A 3EZ9A 1A2BA 1II0A 1NN1A 3N5CA 2PCJA 4I4LA 2FE4A 4PC7A 4WZ6A 4E09A 1EGAA 3ONWA 3GLGE 4Q4AB 3WP0A 4AG6A 3OIUA 2IS2A 5F9HA 3F3YA 1XD2A 3B85A 3EWSA 3TGPA 3K9HA 2PBRA 4XH9B 4Q02A 3L0SA 4FMDF 1FQJA 2Q21A 3S1AA 3H86A 3AQ4A 2JGNA 5FPHA 3GLGA 1FOEB 3EA0A 2RH5A 1KYIA 4QBGB 3D6TB 4C30A 2ZSDA 2ZJ2A 5G3YA 3NG1A 4NP6A 2A5JA 3NEJA 4NCIA 1SHKA 2WSMA 2FPLA 5BXQC 1NVVR 3T12A 4QOSA 1NSTA 2IYYA 3A1UA 2ZRHA 4PHHA 1VKJA 4D4JA 3MJHA 3UXMA 3QG5A 4JS0A 4GI7A 3TNFA 4BQSA 5GJWC 1Z3IX 1E94E 1YZLA 2HJGA 4MYTA 3NHAA 3SEAA 2F1RA 3V4FA 1KO5A 3QVVA 3WYGA 3LVQE 3MLEA 1T6NA 2IYQA 2Z83A 4NYIQ 5FBLB 1WCV1 2HCJB 3AVPA 3I92A 4BFWA 3I5XA 1G5TA 1U9IA 3TUJC 4HLDA 3QY0A 4DEYA 2C98A 1US8B 2KJQA 4IOMA 4A0GA 1DELA 3TH5A 5FOVA 4Q47A 4QGGA 1CR4A 2OCBA 3FHOA 3ZS9A 5AUPB 2ZPTX 5JHHB 1KDTA 1H65A 2BCGY 4LC0A 2BM0A 4Q9KA 2AFIE 3P20A 4MUBA 1AIPA 1ZAKA 3T5DA 4PZLA 2AR7A 1N6HA 3CX7A 3B1ZA 3QPVA 1NVWQ 1E79D 2VP6A 3RYTC 2R6AA 2BHRA 2D2FA 1YU9A 4R9UC 5FUVA 2IYRA 2W0MA 4DLWA 1CR0A 2WIBA 4DJTA 2WBLC 4KYIB 4BUJA 1KMHA 1E4VA 1WMSA 3IQXA 4CF7A 2YWHA 1OPXA 4KLZA 1M34E 1ELOA 4AYXA 1T9HA 2ZROA 2IUSA 2VQSA 1G17A 3KFXA 3SQWA 4D26A 3VKHA 1R4AA 1E2NA 3VR3A 1KO1A 2FF7A 1GFIA 4RD2A 2FPKA 2P5TB 3SC3A 1KSJA 2QP3A 5FFMA 1VIYA 1F2UA 3UIEA 3QXJA 1A5TA 4FMCF 1EXMA 2FDCA 1P7CA 4NHOA 3UANA 4LI0A 4QGHA 2ZJZA 3ZH9B 3HPRA 2FMXA 4LSGA 1G18A 3K0CC 3I32A 2VO1A 2J59A 1NL3A 4A92A 4LHVA 1W0KA 1CEEA 2O52A 1VTKA 4IOKA 2PJZA 3DM9B 4TT3D 4TSFA 3QBTA 1OYYA 1Q57A 1Z6XA 4D82A
chains in the Genus database with same CATH superfamily
1MC5A 2OFFA 4R3NA 3TCKA 2R1ZA 3EXG1 3MG9A 3SZUA 3VTAA 3NOVA 1NI4B 3PNSA 3Q10A 3DS8A 4JJ6A 3O7WA 1D6NA 1N6NA 1LPPA 1PNOA 1OX4B 2OHXA 2ON6A 3CLUC 1JPNA 8LDHA 4MWBA 5EIXA 3P52A 2OCIA 1IM5A 4G1BA 1RRMA 2ZAOA 3FNBA 4ZVLA 3UWPA 4KACA 3UJBA 3I1FA 5E6RA 3OTWA 3NKVA 3AWIA 2ZBVA 2LR0A 1OLXB 3Q7IA 2VS1A 3H84A 3FPEA 3CRNA 4KO1S 1JLSA 4IDQA 2AZDA 4PXYA 4Z8YA 1MH1A 3CCFA 3WV5A 3IUPA 2C42A 4IOJA 4YMSA 1LTKA 3EB9A 3MGBA 2Q4RA 5L4LA 2YWCA 2G6BA 4K9NA 1SO8A 1XQVA 2FU5C 4RD4A 3NHYA 4QQRA 3TZKA 3GJ5A 4MKRA 2EDCA 5MN4A 3LKBA 2YZKA 5I3ZA 2R6JA 2BFMA 3GRZA 1KI6A 4TWRA 5TGDA 1O9BA 2WQZA 5FX2A 2Z6AA 2JLQA 2VVTA 5CFRA 1YVPA 1PL0A 3D4LA 3BZBA 4QTUB 4F8JA 2PRYA 3FPAA 4B0OA 3H4IA 5KAPA 1NNEA 4ND7A 3UJDA 3EXIB 5TDHA 2XF8A 1VG0B 2ZS9A 4WLUA 3C15C 2I5PO 3P26A 1OC2A 4PRZA 4Y0VA 3ER9A 3OTIA 3ONDA 4GH5A 4AJ1A 1LPBB 3TPCA 4M1SA 3QV2A 1CR1A 1MJNA 4HB2A 4ETWA 1XZLA 3EIUA 3NXSA 4OQNA 5B57C 3LFHA 3EZGA 1J99A 4JEHA 5JZBA 2W8BA 2ZB8A 4IHKA 3K9FC 3BDAA 1DAKA 5FPPA 1OH5A 1A1VA 2FG5A 3T6KA 1U2QA 4F8EA 4C0HA 1H42A 3C16C 3AUXA 4TYQA 4M9RA 2XOKA 4OI2A 1DEHA 3Q7EA 3KT8A 3GZNB 4UNSA 4ZOLB 2XGJA 3WHKA 1JIXA 5JVDA 3TB4A 3TZHA 1RNLA 1LC3A 3PRHA 5TGTA 1XYGA 3CUWA 1GCUA 1BW9B 1ZUHA 3CGWA 4MRMB 4JYMA 2HQSA 3B7PA 3Q87B 4O6VA 5EMMA 2PIDA 4YMLA 1SZCA 1GTMA 2ODQA 2FH5B 5I9NA 4JVMA 2AW3A 3PP8A 3R7NA 1X7GA 1F2TA 4LYJA 2DFPA 1P1FA 4KFUA 5L4NA 5T4EA 4QQNA 4IIYA 3UB4A 1ZG3A 1CDZA 5COBA 4I8DA 1U1FA 2CKMA 3DYBA 4R7GA 3VPHA 5KKNB 2JKYA 2V7QD 1UAAA 1CU1A 1JE1A 3HO6A 3EWNA 3WK7A 1J1ZA 1NYTA 2CJYA 5DXFA 2AN9A 1KVSA 1XXHA 2QTAA 3CT6A 2W2LA 3S2ZA 2C61A 4CDMA 4OYLA 2H5LA 3Q98A 2PMWB 1BEEA 2EJTA 5AWFC 1N5KA 4DA6A 2BM1A 2C9MA 3DXFA 3LVRE 3R6WA 3U81A 3U61B 2PKQP 3BFKA 3K9WA 2B1QA 4YCMA 4F04A 3QVGA 4HNTA 1PR4A 1SD2A 4AO7A 4IDBA 2HQBA 2NO0A 2A5YB 4UASA 4YCDA 5DBGA 2YY5A 4YI5A 3ZEIA 4CKZA 3U19A 1K63A 3QOWA 3LNTA 1IFXA 4I9NA 3P9KA 4WJKB 2AZMA 3DONA 1JDNA 2X5KO 1AZSC 1SBHA 4RHTA 1QFJA 2BR4A 5AW4A 3CEMA 3HLYA 2V7GA 4KE6A 3S55A 3VZPA 3WLNA 5AM3A 5DGHA 1B26A 5T3UA 4NBTA 1UJ4A 3K6SB 1EZZA 2NP7A 1DKUA 1EVEA 3GXOA 4C43A 3CLTD 4J1TC 1YTLA 4HAVA 2EERA 5AK0A 4E1AA 5EJEA 2O8FA 3BMCB 4HEA6 2A14A 5DLDA 1Z7BA 4K9DA 4J6EA 3DPSA 2AFRA 3NHPA 4CLRB 4FOTA 4IDCA 1K3FA 1VB5A 4Y9SA 5F23A 1VDZA 3QBJA 2BZ1A 3E3AA 4FZRA 4LHZA 3PLAE 3CFYA 1C1XA 4HGYA 5JO9A 5K3CA 2Z2YA 1P4RA 3PVSA 3LT2A 2MYNA 4PQRA 1ODFA 5GP1A 4FNAA 1SQSA 721PA 2BMJA 1DBVO 4H6XA 1A8QA 3RO7A 3VOTA 3G2IA 3V97A 3H2HA 2CEKA 3CC8A 3EIFA 4LK3A 4UTVA 2IY8A 2WYHA 3BGSA 1XRRA 2J0UA 5E9QA 4YQEA 3UAOA 2F1HA 2DPYA 1XC7A 3GT0A 1SOWA 2Z09A 2XYRA 1KI4A 4ZJZA 5JZOA 1P1IA 4GO1A 5C8YF 4RSRA 2NM0A 4NU5A 1IBKB 3AJEA 2GLXA 4QXMA 3S68A 4PAWA 2QTVB 4PFKA 4ND3A 4N01A 3A4NA 3ZG6A 2HCRA 1Q50A 1CEYA 3DXXA 2GN2A 3HVJA 1CXZA 1L8QA 2YWJA 4GLOA 5ES4B 3OKCA 3QEMB 4K6GA 3IXLA 2WWFA 2IKSA 1TVMA 2V1UA 4IXDA 5IAJA 1LJ8A 4QL3A 4FGUA 4JDPA 2ZU0C 2OT3B 4JBIA 4OQDA 4PZPA 4KJXA 3K0EA 3NETA 4HZUB 1Q83A 1PWZA 4JKOA 4X7RA 4D79A 2AFHA 1YUNA 4BJ1A 1DHRA 1T35A 2UAGA 3NC4A 4BEJA 3KK0A 1DI0A 1KDRA 1E5TA 4OCZA 2B5VA 1WNTA 2C29D 2D3TA 2G71A 3L6DA 4RZ2A 4HDNB 5CAEB 4MAMA 5EVJA 3LT5A 1SOAA 4L8YA 3B1YA 4HUJA 4IIDA 4AFNA 3NPMA 2E87A 3KXDA 3UZUA 5CEEA 4KHPB 2X7HA 1ZCAA 3GK3A 2CLLB 4RQBA 4X1OA 4WXPA 3V8NA 3UPTA 1OB5A 3R0ZA 2VZEA 1T5BA 3RTAA 3TZBA 2P77A 2UYYA 3A6KA 3G1WA 3GPCA 5DI9A 3DWFA 4REQA 1JI0A 3LAWA 4FEYA 2RH8A 4FYYA 3R76A 3U7QA 1KZ1A 4QBKA 2YY6A 1TA0A 1L5WA 1I9GA 2UZ3A 2UYCA 3RHFA 1EK6A 4MMYB 1D2HA 1MX9A 3CPSA 3FWKA 1N7JA 3OPVA 2R9VA 3B89A 1JB1A 4GOND 2IU4A 4BLQA 4KO8A 5DCWA 1N2CE 4UMEA 3IGFA 4IJUA 3ND8A 3IKTA 4LRYA 4WVFA 1H93A 1BQ3A 1GHTA 1EQAA 2UZ4A 1XWFA 3QVOA 4ZCIA 2UUPA 4GLLA 4Y6SA 1SBQA 2OXFA 1AKUA 1H5NA 3H9CA 2QLFA 2WU3A 1M2JA 2VHCA 5D2CA 3MS2A 3SFVA 3OQJA 4Y2JA 1EWTA 1HETA 2OILA 2O2CA 1T1SA 2R62A 3NVDA 4JOQA 1I24A 1JV2B 4KV7A 4CUZA 5LYJF 2OYCA 4AI6A 2P9HA 1TOAA 4R1LA 2YZGA 1RYBA 3M1YA 3X43A 5CG1A 3UYLA 5E9JA 2JFPA 1ZICA 2X4GA 3PL5A 5E4YA 4BMYA 4RK6A 4WZBE 3ZVMA 2QNRA 2C3MA 4EUKA 1G3UA 1R7RA 2GGSA 3K1YA 2XA9A 4YBRA 4LXIA 1AO3A 3LUDA 5CT6A 4YHBA 1WTCA 4K40A 1GZ5A 4EQ6A 2D1QA 2GJ4A 3JQAA 2JKZA 1GQQA 5EJ6A 2O6LA 4S0XA 2EU8A 3LW8A 1NMYA 4CR6A 1ZNYA 3X2EA 1OGJA 1M2OB 3OFKA 2DHEA 4GYWA 4N5MA 1Y7HA 2FPGA 5EWLB 2EGUA 5BSEA 4CEJA 1L7MA 1JDTA 1SU4A 2UZ1A 1JKFA 3LHIA 1I6LA 2B9VA 4TGLA 4WLEA 2YV4A 3GWZA 2GVDC 3U3XA 4PVCA 4EFKA 3KQKA 1I4OA 3RK1A 5DNUA 1KO4A 2KQUA 3WL6A 1PEKE 3RWMB 3BA6A 3HV2A 2VDWB 1WLYA 4Q21A 4ESOA 3BMQB 1NQTA 2X8BA 4K7JA 4I4IA 4B3JA 4X92A 2NU6A 3H7IA 2GM4A 3N7TA 3E9MA 3B3FA 4RH0A 2A5FA 1N78A 5H3LA 4B0PA 5KX5B 3MWLA 3ZDXB 2DTEA 2POCA 4Y2RA 3K9QO 2EBFX 4Q1VA 1N2BA 1CUWA 3QFCA 3G5AA 4YXFA 1WDWB 2D8MA 1EM8B 1XELA 3ITEA 2HMSA 4RL6A 5JU6A 4OMFG 5LYJA 4KRGA 3DKIA 1T4BA 4FD2A 4DC9A 1M0EA 4JR2A 4N6OA 2RE8A 1BKSB 5IEBA 5KO2A 3AUFA 3BWBA 3HB4X 3LCVB 5K0TA 3KYCB 1ZAYA 2OBLA 2O7RA 1BC5A 1DC4A 1JQJC 2J7PD 3BRWA 4U2BA 1BMFA 1W85B 2N47A 3SDSA 4UBLA 3UJAA 1GDTA 1JSLA 3J7TA 4C6TB 4ZREA 3KEGA 3HP4A 4B7UA 3P0JA 1JFLA 4HK4A 1E7RA 4MI9A 5EEGA 3NWBA 5JD3A 4TVKA 1RRPA 1CJMA 2HPVA 3PEFA 2WVHA 4OQMA 2F3PA 2ZJ7A 1WQ1R 5SY9A 3RBVA 4D96A 1XQ6A 4N8EA 2DOKA 5FHQA 3CKYA 3OURA 3WLSA 5LZ8A 1C50A 2IY9A 5EPOA 2H9IA 5ERGB 1YC2A 5BSGA 5E6UB 4Q4LA 1BMQA 5EIWA 3ZXYA 1NP3A 2ATVA 2BGKA 2NADA 2YINC 1YCFA 3LNCA 6GPBA 3EQ7A 4BKRA 5JLJA 3TMAA 3TF5A 3ROGA 1DIGA 1GLVA 2BFNA 2XNDA 3LHSA 3GRUA 1JTFA 1C4WA 4PBRA 3UJCA 1A9XA 5DHAA 1PBNA 5BSWA 3EDMA 5I4KA 2H06A 2JC3A 3LQ1A 2HLDA 3MHPA 4H2DA 1B43A 1QHXA 1WKVA 2GZAA 2Q1YA 3ENWA 2P35A 4A2CA 1SD1A 4G01B 3LZDA 4YAJA 2P2YA 2V4MA 4E2FA 4C7OB 2C9ZA 2ZI3A 4A10A 4JT8A 2COEA 2B83A 3C5EA 2G88A 4B35A 4NL4H 3IDFA 4PYIA 3EGXB 2IXTA 4Z4QA 1N5MA 2W2VA 5EUCA 1Q3KA 3GA7A 2HWUA 2PXXA 1UUFA 3OT1B 1PFQA 1NURA 2PUWA 4HAXA 3RU3A 1GAJA 4D7AA 3U7QB 4ETMA 4LF4B 2NQTA 5CLGA 5JDCC 1RJWA 3DTNA 9GPBA 4COOA 5I7SA 1W49A 4FE3A 4KNYA 2VXCA 3GVXA 4P3KA 4L5CA 3QKWA 4IJVA 3VNBA 3FUTA 1GG9A 3B6EA 1RMQA 4W6QA 4MGHA 2NU9B 4QT4A 3I76A 1HRKA 4Q7JB 2J5QA 2Q4TA 4QUEA 4YP0A 2FOIA 2IVZA 1FP1D 4PN3A 1EUDB 1N5IA 4RBNA 4HAYA 1AU9A 1IN8A 4TX1A 3BWDD 3UK7A 4N48A 1CIJA 2JJQA 1LLCA 2W6PA 1Y48E 1HFJA 2JZNA 3B1FA 3PXUA 4KXFB 2X19A 3UGTA 2QBYB 1CVRA 1DBQA 3OJLA 3N1UA 4W7SA 2XB9A 5DBHX 4QUBA 3W6PA 4BTLA 4LX8A 3VR1A 2JJMA 2JGAA 3ITKA 4GYJA 4U02A 1N2GA 2GSDA 2CBZA 1EIWA 3A31A 2IGBA 1ZRMA 4LX0A 2NXNA 3B1KA 4QYIB 2WWYA 4XEUA 4J75A 1E3WB 3DMNA 2X8JA 3RIYA 4YO8A 5G40A 4D80A 4D41A 1DKMA 1C9DB 4ZVKA 1B2LA 4FLMA 4YACA 2QM8A 1E9SA 1YO6A 3OECA 5TS2A 1EFDN 4YT5A 5EUQB 1V3QE 4BC1A 4DWWA 2Q9BA 4KNWA 4LEIA 5FOUA 5HG0A 3JD1A 2B5WA 2A92A 4PLYA 4CKBA 3HUDA 4R7TA 3MTGA 4J2OA 4F2GA 2XCRB 1GL6A 2PO7A 5CA0F 1HQCA 1SG6A 3IP8A 1D1QA 1QIEA 4D8VA 4B47A 2P4QA 3MA0A 5CH3A 4P0QB 5E3HA 3AK4A 3PC7A 2DVMA 1FJXA 3FSEA 1ZW1A 121PA 2R6FA 3H11A 3H97A 3QA9A 1XGKA 2IYPA 5F1KA 5BMOA 3M9LA 1DPFA 3CH5A 3O3NB 4EG8A 3VYTB 1QGZA 5C32A 4YCLA 5IVPA 3VU3A 3FVVA 3RUCA 4IDFA 1B6GA 2HCTA 2IYOA 3AF2A 3VC1A 4IKOA 1QIJA 4P22A 1ZC4A 3MWYW 5KNBA 1P7ZA 4DVJA 1PEYA 1B7GO 3MZ0A 4ND2A 1EH5A 1ONSA 4I5EA 1PZMA 3OPYI 4R54A 2C04A 3QY9A 3A6LA 3TB6A 4ZVPA 1Y6FA 4ZYYA 3JQ6A 4R9NA 2WYOA 4F4CA 4YJFA 2ZJOA 3ME5A 3GJ3A 3BEOA 3W2GA 1M34B 2WU4A 4LYGA 1W30A 3FTDA 4OFZA 3CF4A 1F51E 5JTUA 4JK3A 2CF6A 1YTUA 1W4ZA 1LWOA 5J4LA 1XALA 4UU0A 4GYKA 4L74A 1P29A 4ER3A 3HYLA 1C7EA 2EG9A 5BVGA 3QE3A 3PT5A 4GEGA 1JDSA 4L0CA 5NULA 3UT5B 4EECA 5K0GA 3FPBA 3EXHA 1USUA 3UOWA 2C4VA 1G60A 1Z8DA 3FRHA 4FYMA 4K3VA 3WRXA 2BMEA 1GGJA 1L7VC 3BERA 2IPLA 5HX7A 4PO9A 3V3KA 4H7DA 1L8OA 2IV7A 3D4NA 3FDJA 3LLCA 3RBXA 7REQB 3DV0B 2JBAA 2GRJA 3P9CA 1YJQA 2R5WA 2FR8A 1KU6A 5DHPA 4RQTA 1JKJA 4C1NA 2O2IA 3GRYA 3WIOA 1KETA 2GJ9A 3UB3A 4CM6A 3U44B 2M6LA 2LZ0A 3EVCA 5IXJA 1VSBA 3TTYA 5TQVA 2ZWAA 5CU7A 3F6SA 3NKLA 1H9AA 3U1VA 4UAJA 4BFSA 4LXHA 1CUBA 4E94A 1P1HA 1NGSA 1W8IA 2V03A 2V45A 2FLWA 3OSUA 4W9RA 3I4CA 5JCOA 1ZVVA 2GEKA 3RSQA 4KQ6A 1U90A 3G5LA 5BV0A 3PNQA 4UQPA 3TQCA 2O14A 5EMJA 1SAYA 4IH9A 5FA8A 2DH5A 3GLFA 1JHPA 3AUKA 2YUTA 4JC8A 3RWBA 3G85A 3BTUA 3O4JA 5SZIA 4QVKA 2RGCA 2BGNA 2GEDA 4TS9A 1AZLA 1E3DA 1P0QA 3DBLA 3O1JC 1DJOA 1UBTS 3B8EA 4JIGA 4L4UA 1T2UA 3LT0A 1AQYA 4HWOA 4LOLA 3NVKI 4NDAA 2VTKA 2YXBA 1FMTA 4CEIB 1K9SA 1NPDA 5BOSB 4WTOA 2YX1A 2HT6A 4Y2XA 1DOZA 3OY7A 2JFYA 4XOUA 2PS1A 5EIHA 3PD7A 4C4ZA 4F5ZA 4CEJB 3GEHA 1SUIA 1M72A 1N0HA 4I1UA 4BKPA 3KOUA 2DZDA 2V6FA 2QM7A 2RGDA 5JH7F 4CQNA 2GAJA 3QFFA 1TIBA 2KI5A 3ELBA 1QMGA 3SS9X 3FZQA 3I0NA 4HNSA 3TQQA 1I2DA 4DCTA 1Z4MA 3AHHA 2DP4E 2PVSA 4G9EA 2BGJA 3A6EA 2R8XA 1RKQA 1E3JA 3BB3A 1FQOA 5IXYA 1WCYA 4U5XA 1VLJA 2LE0A 4HRXA 1KK0A 1ESCA 3OZVA 4RGBA 3A9TA 4Q3NA 1WNFA 5FOWA 1YASA 4CCWA 2Q50A 1M9NA 2PTHA 4AKTA 4R2WA 5LYJB 4MS3A 1V25A 2QG6A 3ZI4A 3DFZA 1OYOA 1YD7A 4RVOA 4C7MA 5AI9A 1PR9A 3E9CA 2H1HA 4JT9A 4EHNA 4RD1A 2QD5A 3FAZA 4I4CA 3WB2A 1EVYA 3AO0B 5TB5A 1Q1AA 3QELB 3WLEA 3FOFC 5KAMA 5THKA 1EFKA 1F1BA 2FWMX 5C4GB 3DZGA 3MHTA 5BUZA 4B6OA 1TYEB 1G291 2A9FA 4EHAA 3QVUA 3PCRB 3T3GA 2O5CA 2ZIFA 5CPFA 3VVLA 5JAUA 4JXXA 1KMHB 1OSNA 3RF6A 4AN4A 4YRAA 3KAKA 3TXYA 3H1GA 4KIGA 2F62A 4O1IA 4YJGB 3RSLA 4EA8A 1U0TA 4X45A 1IATA 3O9MA 4NU0A 1V8DA 3FG9A 3KDAA 5E38A 3BFVA 2IU0A 2WFZA 1GKIA 1EJ6A 4RD0A 4BVLA 4EQZA 4B3MB 1E9CA 2BE9A 4RKQA 3HE3A 2G9RA 3U5TA 3I01A 2HL6A 2LVBA 5BN1A 3CSDA 3QWIA 5A05A 5FADA 4YLYA 4ZXPA 3VDMA 4NK5A 3HKBB 3CRMA 3PPVA 4RDXA 1HDXA 2WHPB 1CERA 3N2KA 4KL8S 4TN1A 4AF7A 5AVYA 1OVGA 4BY9E 3QH4A 1L2TA 1E3SA 2ZUDA 1M1ZA 3MELA 1MPXA 3OWXA 1POWA 3TE6A 2CXPA 3ON5A 3QPUA 3OE7D 4OM7A 4Y1FA 4F3KA 1YQDA 3SHFA 1PKXA 5MGBA 3EG9A 2WYVA 3OQ6A 3PJFA 3KOMA 4MITA 1Q1GA 1RI5A 1TVKA 4OFBA 4E2WA 4KQ2A 1KQNA 2X0FA 3HU3A 3TXAA 4A7PA 2QL6A 4YT8A 3SR0A 5IS2A 3MF4A 2VT3A 4YGXB 1EVQA 1B1CA 3O0TA 5F5NA 2W4MA 1RZUA 3D4IA 2BP7B 3OP1A 2G82A 1Z73A 2ZS8A 1U65A 3GVPA 3NT4A 2G83A 3I39X 2QN8A 1EGHA 1OPRA 2O5VA 4GR5A 4JL6A 4PZAA 3R4VA 4RZQA 5I45A 3KAPA 3HCBA 1U5BA 4V0OA 1IN4A 4MRRA 3BSSA 4FN5A 1WBJB 2QAGC 1ZIOA 3AU9A 1FYXA 4K9OA 2PNJA 4OX9Y 3GYGA 4GLJA 1LY1A 4UHKA 4DCPA 1N8TA 1W0CA 4O02B 4EWLA 1O9HA 2JBAB 3FKSD 3MFQA 4DM7A 1GG2A 4BMDA 3MOIA 2ZBPA 5I9MA 3HKEB 4Q48A 3JAKA 4ZGWA 3NIFB 4L6IA 5KTKA 2Z5FA 1STOA 5JSKA 4LMAA 2BCEA 4XD7A 1Z07A 2W98A 4L4SA 1QRRA 4ZCSA 1ACJA 2DE0X 2V1XA 1ZH4A 2UVQA 5TPWB 5TMBA 4BPRA 4DB2A 4KSYA 2A5LA 1W59A 2ONKA 1RQNA 3EQ9A 3LTEA 3EODA 4BZXA 1EQ2A 3UMMA 3OBBA 1KDZA 4JNKA 4ITUA 2XKKA 1L5SA 4J9VA 3EHDA 4KTTE 2XCIA 1LLQA 1HFWA 3I8XA 4JCOA 2BJVA 3JARA 5ALRA 5IWAB 4EY6A 1FP6A 2GPTA 2XDWA 4CLEA 3LVFO 1VLVA 1FYFA 4F97A 1COWA 4FOOA 4OKNA 4URZR 3TLZA 4IH4A 2NAFA 3FHCB 5CR9A 3WK9A 1FSZA 2EWMA 2PZEA 3H9GA 3ZUPA 4Q1FA 4ZMSA 4M1OA 1IC6A 4LNUA 5LXTB 3I72A 1SOMA 1D0VA 1BHSA 3L1HA 4J7CA 3RFXA 4DYHA 4EF4A 1SUAA 1Q1QA 4MYRA 5J47A 1DT3A 2H9YA 4LXXA 3ESZA 3QYPA 4YN3A 4IHJA 1EBBA 2VAVA 1J21A 1T1EA 5ULLA 3RRXA 1J7JA 4AC9A 4B31A 3N58A 1HDZA 1R9GA 1NNSA 2CVPA 2JIMA 4F1KA 5A4MS 3LRTA 1UMDB 1I33A 1QKIA 2WD8A 4FP9A 4BBPA 3V48A 4EDHA 5M7EA 4M53A 4PYRA 5DN6A 4EVIA 1JQBA 1ITZA 2QUAA 1SVLA 2L69A 3BZUA 3ZCTA 3FA2A 4NATA 2ZSKA 5IPFA 1F2UB 2YJGA 4DV5B 3RK0A 3S2FA 1P6QA 2H8KA 1CRWG 1RM3A 2RK6A 2ZRBA 3TLEA 2ASEA 4YP7A 3GHHA 4CHTA 4PLWA 3JW8A 1HM5A 3UAZA 3DLCA 3DZIA 3H8JA 4BN5A 5DX8A 3QMMA 2QAGB 1PZEA 1L7PA 2AJDA 2J6HA 2WLSA 4X8OA 2O20A 2VZ9A 1IL0A 1G2OA 4GLFA 4MINA 4EARA 4CZ2A 1RRVA 1U0RA 2H29A 2JHAA 5CW2A 621PA 3FNFA 3R77A 5KNDA 3R6GA 2C7OA 2R1VB 4MZDA 1P2FA 2Y1CA 2OP1A 3AM5A 5CX1A 4ZQGA 6PFKA 4LJKA 3WLQA 1W9HA 1BH2A 3NTUA 2AYXA 1SIUA 3KWJA 1VXOA 1WL8A 2XDQA 2BISA 3KAQA 5IAOA 1QE0A 5GWXA 1Z4KA 1IN1A 3PTZA 4HQ0A 5CVVA 5JCOC 5J2UF 1DRWA 1T2VA 2F1KA 1SZPA 3A4VA 3LQYA 3GBPA 4GM4A 5FKJA 4E5MA 2VG8A 1S02A 2E48A 3V4OA 3ETNA 5JJIA 3PWZA 2IXFA 1MB4A 4NV1A 4XDHA 2P2NA 3CINA 3OHPA 3Q5DA 4PANA 1CPYA 4KKXB 4LBZA 4PFSA 1AXGA 2CNDA 2NO9A 1ONOA 3DE1X 1KKLA 4M55A 4E51A 1ISJA 3IMFA 4BQFA 1I10A 3NJ8A 4MQFA 1ZCJA 5I4IA 1QP0A 1UBGA 3OCCA 4B76A 5HGXA 3VMMA 3V32A 1FTNA 3MJRA 3R8CA 4TZ6A 3HI6A 1XMOB 1GY8A 5IT4A 2C2HA 2F8TA 2AEEA 4M0FA 3C6YA 2B2XA 2MYPA 3K0CA 3T3NA 4TV8B 4QU5A 5J5VA 3R7AA 1FRZA 1KR5A 2RBEA 4QLAA 4C0SA 4E12A 2NX2A 4CLDA 3BILA 3HGQA 3AEKB 5CXSA 4MAFA 3DL7A 3HO8A 4RTSA 1R6UA 3I9LA 3IUNA 2QRVA 2X15A 2YWRA 4M89A 3W4JA 5A02A 4TMXA 1W1IA 4N6NA 2VF8A 1N34B 1HQDA 1V2GA 4O1HA 4V03A 3EDQA 1SBIA 1ONBA 1PT8A 2X1VA 3MWJA 1TL7C 2DKNA 2IHYA 1C0KA 3EXIA 1KBOA 2F9FA 1P81A 1K8XB 3I4LA 3O94A 4LRUA 1TIKA 3AQIA 3WX0A 4BEBA 3B12A 1X7DA 1F3LA 3JD0A 1GILA 3A9RA 1RFGE 2NNWB 8AT1A 3NAQA 1P1BA 3PFFA 4U3JA 1PAUA 5F2OA 4IQ0A 2FLVA 2X5XA 1N75A 3IT3A 5FIUA 3V7NA 4KGVA 4CR7A 5E2IA 5KX5A 3ROMA 1NZFA 3WA7A 4W5TA 2HD4A 3P8ZA 2EXXA 2PH5A 1OXUA 4RCZA 3F49S 2Z30A 3FXAA 4A0RA 1D2NA 1W52X 2P9EA 4HJRA 3VGJA 4GE3A 2I3GA 1MX1A 1L7XA 2QX8A 3ILXA 5G1OA 4YDQA 1BJTA 4RA9B 5KSOA 4QC2A 3NUZA 2B4QA 1JAIA 2ZI9A 2JG3A 1F9AA 4MVYA 4WA8A 6REQB 1TK2A 1ZRNA 2MIIA 4JQYA 4IFTA 1Q44A 2YYZA 2ECKA 2PMCA 1B1AA 1S4QA 1UFVA 2IF0A 2XYQA 4OI0A 3CVUA 1QFXA 4M6WB 3ZOZA 4DEVA 1R2QA 2JFOA 5HTOA 2J45A 1EFUA 2GRUA 4TYWA 3QYJA 2DLNA 2OQ2A 3T3MB 4AXBA 1QHSA 1ECJA 3Q8LA 2WHRA 5KJ6A 1JHZA 2FE1A 1WCIA 2IOHA 3MD0A 3ZBQA 1Z75A 1C1YA 1RZ3A 2XUGA 3FD8A 4J0JA 5T41A 4DBLC 1BO6A 4S0ZA 2XA1A 1RXIA 2UXCB 1GU0A 4Z4HA 1WY5A 4BFZA 4KMOA 4X1KB 2WMOB 3B5EA 3VU9A 3LUKA 7YASA 4GOMD 1DT5A 3CRVA 5DPMA 3HZRA 3T06B 5JZ9A 5AJZA 3JQ9A 3VPCA 5A1TA 4NQZA 3TLJA 1X38A 3IVXA 3A6FA 4JMPA 1J0CA 5CA1A 3D4OA 3R0IA 3LK7A 4NR0A 2R0QC 2A3NA 3CX4A 4KOAA 4K6FA 1V8ZA 2C2YA 4D25A 1WCXA 2Q3HA 1J7KA 1T6XA 1D2RA 1A4XA 3BN3A 1VJ1A 4CQMB 1TQ2A 4FYJA 1UADA 3GEEA 4KR2A 2PK3A 3VISA 3NBAA 5JRDS 3ADCA 4NBLA 2LGJA 2VIIA 3GARA 4WOPA 2Y1OA 1FXSA 1SXJA 2C3YA 3WYFA 5KMGA 1DXQA 2HSGA 3DL4A 4L3OA 1GP2A 3DE5X 2J5KA 3NTXA 3U7EB 3OFND 3VKUA 1N1GA 4B2IA 1N7HA 2G9QA 2G09A 3EVBA 4X5OA 4E4RA 3T4XA 4FIDA 3AR9A 3BRQA 1W94A 1M2HA 4DILA 3G49A 4EJSA 4P4NA 1CB0A 3WBFA 1SQ5A 3S27A 5G0VA 3ZYCA 3R7FA 3AM1A 4G0ZA 1EFLA 1OAKA 4JLOA 1SPXA 2V6BA 2VHEA 2VOJA 2Z43A 4TZKA 3U13A 4G9BA 4H4DA 4B32A 1D5WA 1DAMA 4KHZA 3DFKA 4GL2A 5TSDA 2ZDQA 1E1LA 4OHPA 3ENNA 3L4EA 1RYZA 3NM4A 2JVKA 2Y3IA 4KAFA 4YTEA 4JC5A 4R9SA 4FXOA 2Q28A 3MYRA 1S8OA 5TY0A 3O8QB 5B2FA 3KP1A 5LP1A 1HTWA 1S2LA 2BD0A 2YVUA 4OUDB 4Y67A 4DPLA 2Q8PA 5JNUA 3EY9A 3K09A 3AV0B 4F92B 3E0QA 1ZQ1A 5EXSA 5KC8A 1E8NA 4CLHA 2NUPB 1DLJA 4LYDA 1CD5A 2VYND 5C7IO 4MLZA 3BH7A 3NASA 4NXMB 2WABA 3SC6A 2G1AA 1BKYA 1NXTA 4MW4A 3TMYA 1QIKA 1UMCB 2WMDA 3WGNA 1UMBA 4P80A 4JI4B 1DC3A 1P7WA 2M2IA 4S1NA 2BM8A 2PU5A 3M3PA 3E27A 5ELMA 3VSAA 4FMDB 2VFAA 4IIFA 5F9HA 4ZDJA 2ZRNA 3OPNA 1Q14A 3TZ6A 2XODA 4OV6B 5JFOA 4IKEA 1QZXA 1RI1A 1JJBA 3HCDA 1LBEA 5SZKB 4Z4EA 5JEEA 2CXRA 3L0PA 5FV7A 1UODA 1ZW6A 4E03A 4QFDA 4R2KA 4UEKA 3GCWA 4MV7A 3KELA 4WQMA 1SN7A 2W83A 4X6UA 2O8CA 3EZXA 3IXMA 4PR3A 3AEQA 5FQOA 1O03A 1MO5A 5G1PA 2X2FA 4TM8A 5EQJB 2YXNA 5SV2A 1GPKA 1L4KA 4LYFA 5IHXA 1BDIA 4H18A 3V1TC 3QPCA 4N7MA 4BVBA 1FNMA 4LC9A 1Z6GA 1AKNA 3M4JA 1Q2XA 1A4RA 3QOXA 4X1YB 3IDSA 4HQ6A 1KYXA 1HDOA 1ZM4A 5A3QA 4B6SA 2FJUA 3EEOA 1T0JB 1UWCA 4HFNA 1FY2A 4JZKA 1ADJA 4KH1A 2HM7A 4WBXC 1EFHA 3K0FB 4IDGA 2AW5A 3T61A 2NO6A 4PNEA 3OZ7A 3NU1A 1G8SA 1C14A 2O2ZA 5EMHA 4AUMA 4IO1A 3A04A 4IDEA 1RU3A 4PU0A 2NU7B 3FUCA 4O2AB 4V0MA 1CFJA 2J3MA 4JJAA 2CLKB 4O0LA 2D6FA 3MW8A 2EKPA 1FCJA 2YY7A 1Q7GA 3OAAA 2G06A 2IEZA 2NACA 3NEAA 1KP9A 1JN0A 3WJ2A 3ZHCA 2XQGA 3WIVA 1F7UA 4DNOA 3RVKA 2DULA 3QMVA 2JGRA 5ITWA 3EOBI 3VU9B 1RD4A 4LVUA 5K8IA 5H59A 4IIJA 1OIXA 1AA6A 2YL2A 1IY8A 4PAGA 3CZPA 2F4VB 4WACA 4IM7A 1JIJA 3TQTA 3CQ9A 1JMYA 1YR8A 4MW6A 1AGYA 3OKPA 2QPAA 4RMNA 1OYWA 3PA6A 1ZPDA 1CR6A 3EMKA 4HDQB 5GJCA 5CFZA 2ZWMA 4FHZA 4EHBA 2VKQA 1BG6A 4R68A 1QQ5A 1XZFA 3EGCA 3ZWMA 1AHNA 5EWMA 5CHYA 1G8HA 3HCNA 1QLWA 1VL2A 5JAZA 1E20A 1UT8A 2NV6A 1SCDA 5DTIA 4DBLE 1R0WA 1QIMA 1R4MB 3G2OA 2GXSA 1NX9A 1OIWA 3OZFA 4MKHA 1HEYA 4I3HA 2D0IA 2V8OA 2D4HA 2WG2A 1IOVA 3N87A 1TGYA 4XPIB 3SQXA 1CW2B 2VJPA 1S6YA 2P7IA 4X3PA 4FD3A 3STHA 2Q3FA 3KZVA 2YVAA 3RVJA 3EPHA 1S8FA 2ZSBA 4QO8A 1U3DA 3FUXA 2WIGA 3Q5GA 4JB8A 5LIPA 5K2OA 2H5JA 2XUIA 2IYAA 2Z2JA 3HYSA 4GNRA 1P9WA 1WW2A 3KFLA 3L8YA 3U7RA 4L9WA 3WLTA 1EGVB 1TO2E 2PMDA 3NOXA 4EUFA 2B8TA 4U3JB 4J6FA 1U94A 4FVTA 3A0UA 4TUYB 4ZQBA 1L6IA 2NV2B 2ETVA 2OO3A 1A76A 1TVEA 4Y8VA 5KU7A 2I80A 1NV8A 2Y8EA 3SS8A 1N2OA 3CE6A 3I6MA 3IE0A 4E5UA 1KI7A 4ENPA 5DW0A 1GZDA 4BLTA 1TLFA 5DGIA 5KTOA 2XXAA 1Z12A 2JI9A 4IIJF 4ALKA 5JTTA 4LRWA 1WBDA 1SQGA 4KXLA 3VH2A 1UK9A 3WIBA 4M1EA 2G70A 3ENKA 4F12A 2ODPA 4TXLA 3RM3A 3K5PA 5SYNA 5JAIA 2JA2A 1COWD 1VE9A 2YV1A 3GF4A 4ZRNA 3PGA1 3A1CA 3RUIA 2QZJA 4G41A 5HDQA 5EJ2A 4GVPA 5HIKA 4P81A 1T2FA 4R8VA 1QAOA 1ZCFA 4ZOLA 5FLEX 1WDLA 5AI8A 4G09A 1JU3A 1DG9A 1Y8QA 3C5VA 2RFLA 3HBMA 3RIEA 3IDOA 2QPOA 3TLXA 4TYMA 5EP3A 4XUCA 5UKDA 1Q0ZA 3CW8X 1V3UA 2XE6A 1M2EA 4MMXB 3B48A 3A05A 3JRNA 5FI5A 4IKPA 3H99A 4V3BA 3ZWBA 3CEPB 3PT9A 4DLYA 1IEQA 1V6AA 4G0MA 3EIQA 2J46A 1WZ2A 5AJYA 1ULUA 2DPXA 1AKYA 2QJTA 3B9BA 1CQWA 1LKZA 1CQZA 1T6YA 3H1PA 3NBUA 3KTOA 4LV6A 3TVTA 2X42A 1A88A 1NVUQ 1T36A 1ADBA 2Q2QA 4M88A 4RHUA 1CETA 2RHHA 5HK8A 4PC3A 5HQ3A 1XWIA 4COKA 2CXHA 4CTMA 2XTNA 3KSRA 1BNCA 1SR8A 1JAYA 1Z25A 1NI3A 3AY0A 3E70C 4LSMA 4Z7OB 2DPGA 1X1AA 1JYSA 4PRYA 4UFOA 5JJCA 1U2GC 2G7MC 4QKQA 1VRVA 1LJLA 2ZAIA 1CKEA 2EKZA 2PWYA 3AMVA 3MGKA 2J6CA 3R5XA 4J0FA 4MQEA 3UW3A 2PTGA 2C8KA 1UFQA 3E9RA 1TCBA 3ZVNA 2ZITA 3V33A 3LP8A 4CEHA 1IY2A 1KY4A 1WPQA 3NHFA 4DHEA 2NU7A 2G80A 1RXUA 4HDSB 3ANYB 4KVGA 2QQ0A 4EKDA 1SQ0A 2ZJAA 1ZUWA 2JVJA 4MDFA 2WFLB 3R5JA 4HV4A 4O08A 4CU5A 4P33A 1XRMA 1U0NA 4KYUA 3W3ZB 1SG0A 3R5TA 2H2IA 4CKEB 4ZCPA 5ER9A 3C8DA 1YI8A 3U37A 4DSNA 4BZWA 4QSHA 5LU9A 1MHTA 3V4PB 3QWBA 1Y7TA 4TQUS 2NU8B 1U8AA 3MBKA 1O87A 4JKYA 2AE1A 1URPA 2VATA 5TX7A 1L5LA 4KI0A 5AHRA 4KWEA 2IU6A 1P7YA 2OAQ1 4NY1A 3SE7A 4R6XA 4BJ6A 2O54A 2H7YA 3JATA 3VKVA 1K6IA 5EMKA 4DGQA 1WXHA 4C1BA 5LN1A 2IIPA 1ZJYA 2C4HA 3PTLA 3A6GA 1H2AS 1NTOA 3FAKA