4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
5FFFA 1ZMOA 1GUYA 3MJEA 4QFCA 4JIGA 3PWKA 2AQIA 2GN4A 1E3SA 4BV8A 5JAMA 4FPXA 3EHEA 4BNHA 4YXFA 3HN2A 2OZPA 3JQAD 2W2KB 4J6FA 4RF5A 4TRNA 2VHZA 5AXAA 5I9MA 3EY4A 4BNFA 2JJYA 4AJ2A 1SOWA 1R0LA 3W8DA 3FR7A 3PRJA 4E30A 5L4NA 3WJAA 3VVCA 4DQUA 2FPIA 2EKQA 3IUSA 1ZK4A 3UICA 2G82A 1QKIA 5G4KA 5TNXA 5B4TA 4RQTA 2DQ4A 2EP7A 3WB9A 2JHFA 5CPBA 3U4DA 4YJHB 4ND4A 3ADOA 3SJUA 3ONDA 3PDUA 1YE3A 3QQPA 1DDOA 1AHHA 1UZMA 2HDHA 2YQ5A 1E7RA 2NVBA 2FR0A 3AUTA 3NTRA 4M55A 2JAHA 3D7LA 1DSSG 1DFGA 2YQ4A 3NAQA 4BNKA 4MVJE 1QLHA 2Y1FA 4EITA 4A0SA 4NH4A 4DXHA 5L4SA 1AE1A 3N58A 5JO9A 5IN4A 1KERA 3M2TA 2Z1MA 2B5WA 5DDIP 4ESOA 2E37A 3JQEA 4YT8A 1LLCA 1PJ2A 3HZZA 2DAPA 2NTNA 4DPLA 5KJ1A 4GMFA 3ZHYA 4RO0A 1K6JA 3O03A 2PH5A 1HYEA 2HU2A 1YB1A 2YUTA 4B3IA 1HETA 1H93A 4UVIA 5AVOA 1HDCA 3P2YA 3K6JA 5DOVA 3UAGA 1SZJG 2B35A 3RJ9A 3BHIA 4H7PA 5A06A 1VJTA 3EK2A 5EESA 5A9SA 2NADA 4XYMA 3HDHA 2ZCUA 1BRMA 5G2OA 4CODB 3JQ6A 2Q49A 2NACA 1YXMA 1KVUA 3I3OA 3RIHA 4NR0A 3LZ6A 3NYWA 4QEDA 1NTOA 3AWDA 2H63A 3OECA 4ZRNA 1CQIA 4D42A 1SO8A 3K96A 1X0XA 4DLLA 3JD2A 1DRVA 1D7OA 4YAGA 1E3WB 5G4LA 3SC6A 3A28A 2IXAA 4BNNA 1U3TA 2IZ0A 2PTGA 4NIMA 4QXMA 1NQ5A 1PL8A 1CF2O 2D3TA 3QVTA 4PZCA 1ID1A 1DIAA 5C37A 2CF6A 3RKRA 1U3VA 4RDIA 1W0CA 4RVDA 4WCDA 1NP3A 4RGBA 1NQOA 4NK4A 2O3SA 3I4CA 3WNQA 4CMIB 1T2DA 4FN4A 4PRLA 1HSZA 4UREA 3UVEA 3WBFA 3GPIA 2HK9A 2EIHA 1YRLA 4OXNA 3L77A 4IXTA 5KJ6A 3SX2A 4FJ0A 1YQDA 2YV1A 4R69A 1P1FA 1ZJYA 2D5AA 3PXXA 3WJ7A 3FI9A 3WIEA 1NFQA 1OC2A 1VL6A 4XIJA 3SEFA 1C1XB 1PZEA 2IRWA 4I5EA 4NJMB 4ROSA 1E5LA 1WDLA 2XXJA 3GUCA 3UH1A 1TA4A 1ADFA 3WQSB 1P1IA 3R3JA 3DBRA 4KUHA 1X1EA 3WGQA 2B37A 1CJCA 2PGJA 1J0XO 4MVJF 4ZA2A 3QVOA 1PGNA 2HK7A 1AGNA 3NUGA 2J5RA 3H9UA 1QLJA 4LN1A 1BMDA 3TZQA 4B7UA 5K9ZA 4CM5A 3QSGA 3TF5A 3DMYA 4K6CA 5JYEA 3IUPA 3QWIA 1LNQA 1XG5A 2RBEA 4IUYA 3O26A 5FF9A 2CDCA 3OIGA 1VL8A 1HDXA 4R3NA 4IMRA 2NWQA 2GPTA 5TX7A 3WBBA 1ZNQO 3E9MA 2Q3EA 4GH5A 9LDTA 4BNZA 4Y98A 3PHIA 3OJEA 4NPCA 1N8KA 4PLHA 3UW3A 4YJFA 2Y93A 3K31A 3WYEA 2NUAA 4HFMA 4B7XA 2E82A 4BNWA 3MJSA 3GZ4A 3I6QA 3KLPX 3SC4A 1GV1A 2OL4A 3RROA 4FJ2A 3FHLA 1TT5A 3DBVO 4ITUA 5ITWA 2UDPA 2V6BA 4YT4A 3JYQA 1G1AA 2I9PA 2YHUA 2PKQO 1QRRA 3NEPX 5L4LA 1I33A 1R16A 1DJNA 2C2XA 4X54A 3E18A 3QW2A 1LX6A 4FGSA 4CM3A 1K6XA 2PKQP 4QUKA 2Q2VA 4PLWA 4CPDA 4AJKA 2NQTA 1GAEO 1LUAA 2X0NA 1OI7A 2W2KA 3MEQA 5K6AC 4QECA 1XCBA 1YOVB 5KJFA 3H5AA 1RM4A 2F00A 3DTYA 4CLRB 1N2SA 3FPCA 3K8ZA 4W82A 1ZSYA 4BNJA 1DIHA 5KCZA 2DBRA 2OMEA 1GCOA 3RUDA 4ZJUA 5DNAA 3S2IA 3ZV5A 4CM1A 3QWHA 4NDNE 2WTBA 3KHUA 4HY3A 1E5QA 1GZ4A 4WPGA 1E7MA 2P4HX 2E4AA 1TVEA 4J4BA 3RFXA 4FOSA 4J43A 2POQX 4J16A 4N7RA 2JD0A 4CLOA 3RVDA 2QW8A 2CVZA 3INRA 1TI7A 1B8UA 4CMBA 3H9EO 1EVJA 1P44A 2P9CA 2CNBA 3MTJA 4E31A 1DIBA 2P4QA 2YV2A 1NBOA 4ZQGA 3OH8A 2VWHA 4UVHA 2A35A 3S2GA 3ZWYA 4H3VA 4N5NA 3CZRA 1T4BA 3ST7A 4IGEA 4M54A 1KY5A 5THQA 2GO1A 1KY4A 5G0WA 2V6MA 1PJQA 1XSEA 1IB6A 1Z74A 4D0RA 3IIEA 4N54A 2IDZA 4BKUA 5ILOA 3JQAA 4ZICA 4R41A 4C7JA 4PRKA 3V8BA 2BGMA 3O38A 3DMTA 3FBGA 1D8AA 2P5YA 3C24A 3D3WA 3QRWA 5I9LA 3OIFA 4MVJA 3PP8A 2NU6A 1NXQA 2AW5A 1F17A 2I5PO 1QV7A 4J90A 2BFPA 3GVCA 2IEBA 3IKVA 4YRAA 3AM4A 2HMVA 1SMKA 4MVJH 1R6DA 3I9OA 4Y67A 3AI2A 5IZCA 1C3VA 1GCUA 5CEEA 1BDMA 3BAZA 4OO3A 4M86A 1UR5A 5THKA 2GZ1A 4NMHA 2GLXA 1YWGO 3I9MA 3VVBA 1XEAA 1PS0A 5J23A 2YHIA 4G2NA 5ER6A 1T2EA 2Y05A 1ZZEA 3DR3A 5JDCC 2H1SA 4R1TA 1HLPA 4BNIA 2AQ8A 3MJ4A 4CQLB 1MXHA 3IMFA 4K6FA 4IQGA 5F3RA 3HWRA 1BXGA 1B15A 2V6GA 3HB5X 3M1AA 2D4AA 2W4QA 1KC1A 4HFJA 3GRPA 3DBLA 3A06A 1UXKA 4PZEA 2QX7A 5CG2A 3ZHXA 4Q3DA 3QIVA 2UUOA 4B4OA 2HMSA 4PN3A 1GDHA 1IOLA 1MG5A 2PZKA 3Q0EA 4INAA 4XGKA 1HZJA 4XQCA 3UUWA 1YBAA 4Q3NA 1R4MB 4D0SA 2ZJ1A 1LTHR 1K5HA 2O3QA 3L07A 2X8LA 2XF8A 4CV1A 3ZNPA 2AEFA 3FR8A 2PD6A 4CV2A 3JQGA 4JNKA 4KDEA 1CETA 1M2WA 1HDZA 5LDGA 1ZK3A 5FWNA 5KWEA 1DC4A 1NWHA 4OL9A 3IQDB 3LT2A 4L73A 1DAOA 3G1UA 5JDIA 4CQLA 1VKNA 3LC7O 2Y1EA 3Q2KA 5BQFA 3ZH2A 4BO2A 3I23A 4JROA 3G3EA 5T67A 3H9JA 2QYTA 1BG6A 1U3UA 5HS4A 5KIAA 1MGOA 3C1AA 2VYNA 1MC5A 3ASVA 3JD0A 1WDMA 3GRKA 4R1NA 3GC6A 2WYUA 3DTTA 3MJTA 4TMFA 1ZEMA 3CTMA 4WUVA 4KQXA 4IDGA 1V3VA 1ZJZA 1KEVA 3GGPA 3F4BA 2Q46A 4LRSB 3EVNA 4JK3A 4C4OA 4EJ0A 3C7DB 4OKIA 3TZKA 5AXBA 1R15A 4DTIA 4FC7A 3GR6A 3EVTA 4XB1A 4ZU3A 3VKUA 3HB4X 5LDHA 1VRWA 4JJFA 3VZQA 1RPNA 2B4RO 3OSUA 4B3JA 3RWBA 2QZ9A 1ZK0A 4W4TA 1MP0A 2FR1A 2DBZA 1HSOA 1SEPA 4DMMA 1W73A 2JFHA 4E13A 3TFOA 3DC2A 4BNTA 2OBYA 1E3IA 4DIFA 1TXGA 4G81A 1YGYA 4PG5A 2Z95A 1X7HA 3U5TA 2EJVA 4Y6SA 1M6WA 5C3MA 2O2YA 1G0NA 1BDBA 4E4YA 5IDQA 2CVQA 5KKAA 4UVEA 4LISA 1OZAA 1UP6A 3FBTA 3JSAA 3UFXA 4PLFA 2OP1A 3WYCA 2Y1OA 1LDEA 1A7KA 3UCEA 4PG4A 4NNJA 4BO9A 1XU7A 4CL8A 4JJIA 2Q2QA 3PQFA 2ZQZA 4FCCA 3RUCA 1E3JA 5JSFA 2EGGA 2C59A 1CIVA 1CYDA 1XGKA 3HFSA 3LYLA 4U6QA 3W8EA 2QHXA 3HN7A 3C1TA 4J91A 1P33A 4TVBA 4WGGA 3ROMA 5A9TA 4WCFC 2HQ1A 3UCFA 1K3TA 3I83A 4GKVA 5DT9A 2G5CA 3DBHB 4CMEC 3DWFA 3ZWMA 1N7HA 3AUSA 1LDGA 1LLDA 3DO5A 4BKRA 5G0TA 1R12A 4E32A 4Q3CA 1Q2XA 1I2CA 4BNYA 5CFZA 3H3FA 4HNHA 4HX5A 1KEPA 1YOVA 3L9WA 3QVWA 1L7EA 3WWYA 3R3SA 3RI3A 3GG9A 2ZJ0A 4XQ9A 4XR4A 5A5FA 3RUHA 2RIRA 5GZ1A 5F1KA 3RUIA 3ZNOA 3UHAA 3U09A 5IFLA 4IZIA 4WKGA 2FP4A 2ZB7A 3OJOA 4GAEA 4EBFA 2ZTLA 1DIRA 4QSMA 5BR7A 3WMWA 1Z82A 5COQA 4CUKA 3D5TA 2C20A 3O4RA 5JE8A 4ALIA 3F3SA 3H2SA 4FOOA 4YA6A 3E03A 3PHLA 7ADHA 4B7CA 1GQ2A 3DEYX 1ISGA 4XDZA 5ICMA 4FB5A 1U28A 2EW8A 4E5PA 5GZ3A 4OOEA 4JP2A 4D45A 4N5LA 1Q0LA 4WECA 4BO8A 2A92A 2VHWA 4JGBA 1AXEA 2ZTVA 4I9NA 4WLVA 5B4UA 4H16A 2G1UA 1Q0QA 4Z0HO 2EGHA 2X6TA 4MIEA 3F4LA 5H81A 4YQYA 3BIOA 3OQ1A 1ADGA 3WIDA 4WEQA 3RU9A 4BO0A 4PG7A 3JQCA 1ULUA 1ZMTA 2AQHA 2CD9A 2OXIA 3KBOA 1B2LA 3KEQA 3WFJA 3ZWOA 1YVEI 4DL9A 1DOHA 3L0DA 4OYRA 4P4LA 4NQZA 1QV6A 4L75A 2YZ7A 2VTDA 5I7VA 3PLNA 2DC1A 3DQPA 4QQRA 4KTVE 3KXDA 4YCAA 1WZEA 3C85A 2O3TA 3MWDB 3ZWAA 4HKTA 3BMNB 5CG1A 4A2CA 3P5SA 4UUPA 4CM4A 2ZYDA 4OQZA 2JCYA 3LU1A 5HBRA 2NVUB 4MP8A 1QXSA 3CIFA 1L1FA 2PZLA 1GUFA 2VUUA 3AUUA 4JX8A 1YBVA 3MOGA 5TF4A 5L7WA 4AL4A 3U0BA 4R01A 5KKCA 1U8XX 1VKOA 4BHTA 4JBGA 4XRRA 3B1JA 3RBZA 5A5EA 1B16A 5EQFA 1T2FA 2X4GA 2X7HA 2O7QA 3HDJA 4OXYA 3K2BA 1E7YA 4BUCA 5I8ZA 3K30A 3L4SO 1KVTA 4IJUA 5L3ZA 4CMHA 4DA9A 1R4MA 1OAAA 4Q39A 3KUXA 4IBOA 3BMQB 3E5MA 4P22A 4Z3KA 2B83A 3EYWA 3SLGA 4A5OA 3SJ7A 4AJNA 1KVRA 1GQYA 3PFWO 3O8QA 4IQ0A 4WASA 1N1EA 2HLPA 5T8KC 3V1YA 4E5NA 3RSHA 4R9RA 3LC2O 3WGIA 4K1LA 4Y9DA 1DAPA 5U4QA 2AE1A 1ZSNA 4BMNA 1B8PA 1I24A 3A1NA 3I1JA 4BMSA 4I5GA 3JYNA 2I65A 1QYXA 3QWAA 4YAJA 4RZIA 3QVSA 4WJZA 3H3JA 2RAFA 3GAFA 1ZK2A 4EJMA 2LDBA 4HBGA 5U1PA 1OC4A 2C82A 3AI1A 3GFGA 4HUJA 2J5QA 4L0QA 4YJGA 6ADHA 1JU9A 1CQJA 2IYOA 3DL2A 4OGWA 1J5PA 1PTJA 3BMCA 3U4IA 1FDUA 4CQMB 4B8WA 4YTEA 5JCJA 4GMGA 4R1UA 1J4AA 3T4EA 1YQXA 4YT5A 4HV4A 1KIFA 1QR6A 1HL3A 3GGOA 3GY0A 1ISHA 1C0PA 2I6TA 1VI2A 1EZ4A 2WMDA 3OJ0A 5TGDA 1PJBA 1ISMA 1NAIA 2BD0A 4BNVA 1H6AA 1SCUA 4E5YA 1PZHA 4BKOA 3ZWVA 2BGKA 4XX0A 1GL3A 3PQDA 4RLSA 5L40A 2DVMA 3RUAA 1WZIA 2DTDA 1NWCA 3U4CA 1I2ZA 5IXYA 3AFNA 3IP3A 4I8XA 3EUWA 4IPTA 3TSCA 3G1TA 2GGSA 1YBMA 2I3AA 1NFFA 4QO8A 3AY7A 3GUYA 2I3GA 3S2FA 4GQAA 1QYDA 4I5FA 2VYND 2EWMA 3LT0A 4HADA 1ZEJA 1MFZA 2C54A 4R9SA 5JNLA 3LF2A 3BZUA 1V0JA 4XIYA 4CM9A 3W4IA 3E8XA 3WGHA 2VOJA 4TKMA 4GGOA 1ZKMA 3G17A 3RD5A 1F12A 3DDNA 3NT2A 5IG2A 4J2HA 4GVLA 3U3XA 2P5UA 5KJEA 2NU7A 4NFHA 1QORA 4FFPA 4M87A 3DOJA 1P1RA 5KVVA 3TL3A 3TOXA 4YPOA 2HMWA 4FQ8A 4WLEA 1HLDA 1Z6ZA 5B1YA 4MVJM 5K0ZA 1LDMA 1TLTA 1E3WA 1WW8A 3VC7A 3DMTC 3ABIA 3WX0A 1D1SA 1DPGA 5JC8A 5TJ9A 3JQAB 3PYXA 4XA8A 2GN9A 3L9XA 3BMOA 3TPCA 2R2GA 1RJWA 4MJLA 5I7SA 5IJZA 3FNFA 3ZGYA 3WDSA 4U6SA 2FOIA 1NHGA 3BTUA 3FN4A 3ZHZA 1VSUA 1GZ6A 1T2AA 3DZFA 4DREA 4E0BA 1DC5A 1O8CA 4GSKA 1N92A 1X1TA 2YDYA 3ROKA 3QJ5A 4NBRA 4ALJA 4RF3A 5IAAA 5JY1A 2DM6A 1RKXA 3PJGA 3HDQA 4BGEA 1SB9A 3I5MA 4YRBA 3M2PA 4RVHA 4U8GA 3VPHA 5A02A 3WTBA 3ZNNA 4Z9YA 4AVYA 1YO6A 2IYPA 3UF0A 4AJLA 4TVOA 4IJKA 4P4NA 5TT0A 2C7VA 4IQ8A 3GK3A 3ULKA 3LLVA 4AJPA 3PI7A 4KDFA 5DBIA 3H4VA 3CKYA 8ADHA 4PG8A 3MOIA 2ZB4A 3WG9A 1NR1A 4P4GA 4QTZA 1NVMB 3GHHA 5K6AA 1T1RA 4JCOA 1RYEA 2PR2A 2QIOA 1IUKA 4FS3A 3BA1A 3OICA 1TB4A 3I4FA 2X23A 2O3JA 2QQ5A 2DTXA 1LDNA 4KWHA 3QVXA 4OHUA 3WNVA 1U5AA 3MCVA 5JMPA 2GR9A 4HFRA 4RZHA 2B5VA 4U5QA 5JW6A 4WNIA 2FHSA 3BYZA 2RHRA 4Q9NA 4IIUA 5H82A 5CHEA 5EL0A 1ISJA 1ZH8A 5EIOA 4BKQA 5ENDA 1BXZA 3PHJA 4I9HA 4R51A 1ULSA 2DUWA 4KMSA 3ANLA 1GFSA 1SOVA 4KZPA 3ONFA 3IJRA 3EZLA 5COBA 4B4VA 1WXDA 2G0TA 1VLLA 4W9NC 3GNSA 1A5ZA 2FR8A 4K26A 2BRUA 3OQBA 3GAZA 4WLUA 1MG0A 1Y8QB 4Y6PA 3FNHA 3RCBA 1H6BA 5C7OO 4B79A 4MPDA 1O89A 2GUGA 3A4VA 2AQKA 3ANNA 3M1LA 1R0SA 4GVXA 2WM3A 3QWFA 3W6ZA 1FF9A 1EQ2A 4DYVA 4IDFA 3RQSA 1GZ3A 2IE0A 4J4HA 2AG8A 3L4BC 2CDBA 1MV8A 1SAYA 4A03A 1H9BA 3GDOA 4A73A 1KYQA 3Q9NA 4IIVA 3RKUA 1BWSA 3AUAA 4D44A 3TNLA 4TZTA 3FTPA 2E6UX 4ALMA 4IDBA 3JD3A 3H7AA 4XZ3A 2V65A 1B7GO 5ADHA 1H5QA 1JAYA 7MDHA 4CLRA 3L4BA 1SB8A 3D1LA 4IXWA 3W4KA 3ASUA 2PD4A 1E6EA 2JFFA 3V5NA 4UUOA 5A3VA 4NU5A 3ZU4A 4CM6A 3NJ8A 3AOEA 3GNQA 1EVZA 3EGOA 1DXYA 3NDJA 5HM8A 2YYYA 2DTEA 3CXRA 5DCYA 1QP8A 5EPOA 3OHSX 4DLAA 1O5IA 2P91A 4FDAA 1I3LA 4ZQFA 1V8BA 1D4FA 1HDOA 3JQDA 3HJAA 4QO7A 1DRUA 1OBFO 2W98A 4LRTB 1XQ1A 3CMMA 4GI2A 1NVTA 3ETEA 2HRZA 2XOXA 1I2BA 3VPSA 3JQ8B 2JCVA 2EKLA 3T7CA 5MGBA 1SC6A 3AOEC 2PZJA 1VJ1A 3HQ4O 5CDYA 4OOFA 2AMFA 4LMPA 5JC1A 1DFHA 4UEJA 4NFYA 2ZB3A 2WYVA 4XJTA 1T25A 1Z7EA 3FWNA 1O0SA 3LF1A 1AUPA 1UXJA 1Y5RA 3JD4A 3B1FA 5G0VA 1BGVA 2P9EA 3ZWNA 3CE6A 2XPCA 5TRTA 1PQWA 4GGPA 5CDTA 4XRGA 1JW9B 3GNTA 3AY3A 5A04A 4YQZA 2GZ2A 4XCVA 4BNGA 3JD1A 4UVDA 1TEHA 4DPKA 3KYBA 2J3IA 2YFQA 4NJOA 4RVUA 1V35A 5IZ4A 2EXXA 1VC2A 1P45A 2FY8A 3FNEA 3QLJA 5BSGA 1R4NA 3K5PA 1UZLA 4JXKA 5B12A 3W1VA 3RFVA 4KQWA 1D1TA 3GOHA 1V9LA 3R1IA 3RBXA 1Y9EA 4AJEA 4XEHA 1XKQA 2I67A 3DBLB 4IDCA 1N9GB 4II2A 1J6UA 2NU8A 5C7LO 1YJQA 2NM0A 1HYHA 1P74A 1BXGB 1XDWA 2WE7A 2JL1A 3NKLA 4OIMA 4J3FA 1J49A 1E0DA 2C5EA 1MXFA 3LK7A 5L95A 1JWAB 1H6CA 1NPDA 1XELA 3TOZA 4BKPA 3BMNA 3JQ9A 4IDEA 3AY6A 1ZSVA 2H9IA 4UULA 3PPIA 3VPFA 3V2GA 4MKRA 2WSBA 3PIDA 3SXPA 4CV3A 4U7WA 5EMHA 4BS9A 2B36A 3E1KA 4S3MA 2C07A 1LSSA 2FRDA 3VPGA 3WICA 1UXHA 3GQVA 5ENVA 1Q0HA 4JLWA 3TQHA 5JAZA 2VQ3A 5MDHA 1ZBQA 3K73O 3DZGA 1YB5A 4WCFB 2Q1TA 5CEJA 3AJRA 3PTZA 2QYSA 5JAQA 1XIVA 1IZ9A 2W90A 1R0KA 3Q11A 3VZPA 5JCXA 3GT0A 2R00A 3WGZA 1RYDA 1YB4A 3ETGA 4AJ4A 3TDKA 1MFPA 5FI5A 5KVSA 3D0OA 1Q7BA 3C1OA 8LDHA 1LRJA 2HMUA 2Y99A 2FPGA 3I9KA 2YV3A 3S1LA 5T8KA 1AHIA 1PGQA 3AW9A 4OQYA 3GHYA 4D43A 2FZEA 4D46A 5A05A 1Q7GA 4AJ1A 2H5LA 4R1SA 2PGDA 3JQBA 5U9CA 2WDZA 1BW9B 2EW2A 2YDXA 3GH3A 4OH1A 3KZVA 4U0JA 5FYDA 2CFCA 1IZ0A 4RPJA 3W6UA 1NYTA 3DFZA 4TZKA 1VJ0A 3VOSA 1P1JA 3C7CB 4TQGA 2X0JA 3DAPA 3G49A 3NV9A 4EI2A 1GEEA 1DLIA 2J8ZA 4Z0PA 1DC3A 1IE3A 4CM9D 3ENNA 3E5RA 2O50A 1TT5B 4IMPA 3WXBA 1HT0A 4YJGB 4C7KA 1PQUA 4WNCA 2I66A 2GCGA 4ZQBA 1HE5A 3I6IA 4I1IA 4CM8A 2HSDA 4FFRA 2DU8A 1KS9A 2WEKA 4O59O 1LLUA 3KYDB 3MJCA 4BGIA 2DPHA 4ZQHA 4Z9FA 2Y1DA 3PYLA 4MP3A 1EVYA 3KOUA 2EERA 3F46A 1HTBA 2BELA 3TZHA 3BTVA 1XR3A 3IP1A 3PLRA 4YDRA 2Y0DA 1YS4A 4IJVA 3WR5A 2F1KA 1DC6A 1YH3A 3UN1A 2VHYA 2FZWA 2OORA 4BIIA 2PK3A 2HRBA 3OMLA 3WS7A 4F46A 1DO8A 2AHRA 5EN4A 3F6YA 2NV6A 3MJVA 2BHLA 2VRCD 4CR6A 1YQGA 2EKPA 4W7HA 3AI3A 2PGLA 1O94A 4FBGA 5EQDA 3BHJA 3OA0A 4IM7A 5F1OA 4QX6A 4YT2A 3D4OA 1A4UA 3N74A 1NFRA 4D41A 2X9GA 4E5KA 1A9YA 2GN6A 1DRWA 3KYDA 1XYGA 1T1SA 2BMAA 4ZGWA 1PR3A 3P2OA 3TZCA 4W9NA 1H2BA 3K9QO 2BKAA 2PWZA 3HNPA 4RPGA 5BNFA 5A1TA 1KVSA 3V1TC 4DRYA 2ZATA 4OMUA 1M76A 1HDGO 1M66A 3L6OO 3LT4A 1WDKA 2VUSA 3D3WB 4RCVA 1ARZA 1EUCA 1LQUA 3NTOA 1X15A 5ER9A 1I30A 4QFDA 2GZ3A 5T6BA 4O5OA 2VYVD 4WK6A 4EW6A 1U9JA 2DFDA 1IL0A 4ZVVA 1EUZA 2WWRA 3VTFA 3VZRA 2JCXA 2PA3A 4PLCA 1DEHA 1PWZA 1GYPA 1P1HA 1NNUA 4NU6A 3V2HA 1PR9A 3C8MA 3GEMA 1LDYA 1QMGA 3LSYA 4TRMA 4NBUA 2BFAA 3ANMA 4WLNA 5TQVA 1UZNA 4E5MA 1NQTA 1PGOA 2RCYA 4XKJA 5DZSA 3H9GA 2ET6A 4LW8A 5KTKA 4AJOA 2Y1CA 4J1NA 3T4XA 2ZQYA 2P68A 4CLEA 1C1XA 3E82A 4NBVA 3DAFA 5LC1A 2Q2WA 1L7DA 2QRJA 3V2UA 5HTOA 1PJTA 2CZCA 1SBYA 4PLGA 1MB4A 4JQCA 1JA9A 3WTCA 2O2SA 3RASA 3RUFA 4M89A 2QG4A 4FFNA 1JQBA 2SCUA 4J7CA 3BXXA 5F5LA 2Y0CA 3OFSA 2AE2A 4ZQEA 4BGUA 1EFLA 3D4NA 4R4JA 5AOVA 3SLKA 2RHCA 2FN7A 2PLAA 1FDWA 1C0IA 2C7GA 2J6IA 3L6DA 1WMBA 1Y81A 4TWRA 4UEOA 1MC4A 1WPQA 4F3YA 4BB6A 4FC6A 4JN6B 4ALLA 1K89A 4F6LA 5TT1A 5JPIA 4B4WA 1H94A 1LJ8A 3QA9A 3OQ6A 2D8AA 2IZ1A 3ROQA 5EERA 2AA3A 1E1KA 1ML3A 1H0KA 2WD8A 1UDCA 1EK5A 1Z7BA 3O8QB 1EQUA 4FGWA 3OEWA 4KUGA 1V3TA 1Y8RB 2VUTA 1O6ZA 2E49A 4LVUA 3PHGA 1U7HA 1P9LA 5L9AA 5BSFA 2HUNA 2B4TO 1W4ZA 2HO5A 5A9RA 5G4KB 3AM5A 4MOWA 4CLDA 2PKRA 5JBIA 1DB3A 1FDSA 1JLLA 1U4SA 1UUFA 3NX4A 1BHSA 3INGA 3DOOA 4F6CA 4YJHA 4RL6A 1QSGA 1I10A 1E77A 1NHWA 2EJWA 2EHDA 3FSRA 3FPLA 2PY6A 3AFMA 3GVXA 1IPFA 4DUPA 4CQMA 1GADO 4PGFA 3NDIA 3IOYA 4EEZA 3PFFA 3NJ4A 4RPKA 3Q1LA 1H9AA 1I3NA 4O0LA 3PJEA 3I9JA 1U1IA 1MX3A 1B3RA 1Q1NA 4D7AA 1IHXA 2VNAA 1HF3A 5DCUA 2GNAA 4PLVA 4E2XA 4DQXA 5DCWA 1BW9A 3GMSA 4J1TA 5G0UA 1VL0A 1LSUA 1PQPA 1YKFA 1S7CA 3U49A 3LC1O 4D3DA 4XDYA 2WD7B 1YL5A 4QT0A 3PJFA 4XYEA 3TRIA 5KNLA 1B14A 2OP0A 4R68A 4ZN6A 1SEVA 3KTDA 1ZXLA 3ITKA 4J9UE 1N7GA 1XQ6A 2X22A 5DBFA 2WJPA 4MKZA 4J2OA 4WOKA 5ES3A 1UP7A 1XHLA 3GF4A 1EUDA 4J1QA 1GYQA 3IL2A 2VHXA 3GZNB 4M8SA 4GWKA 1HEUA 2Q4BA 1BXKA 3NGXA 5CPFA 4L8VA 4AFNA 2Y67A 1X14A 5HA5A 4LSMA 4E21A 4D3SA 1UP4A 3F47A 1JVSA 2CSUA 2VRBA 2PH3A 3OJFA 3VHRA 2C5AA 1PL7A 4R3WA 4PG6A 4XGIA 4LSWA 4W7IA 4DVJA 3EC7A 5JS6A 1YL6A 1ZCJA 1FDVA 1C14A 3E9QA 1LRKA 3A14A 5TC4A 4R54A 4S1VA 3H5NA 2W2LD 4LCEA 4XYBA 3PK0A 4KWIA 1IHYA 1E7SA 3GN2A 1U3WA 3PDJA 2OFPA 2X5KO 3LDHA 4AJIA 2YW9A 3JQFA 4RVGA 4P8RA 3MWEB 2GYYA 1RM3A 3CH6A 2OO5A 3VDRA 3JQ8A 3C3XA 3GEDA 3S2EA 5CEFA 4D3FA 3H2ZA 4XGNA 4KTTE 3ORFA 4ND1A 2Y66A 4NI5A 3KEOA 5EINA 4PCVA 2Q1SA 4DBZA 3IKTA 5GMOA 2BGLA 1WLYA 1OMOA 2IZZA 1XU9A 3F1LA 2YHIB 2CY0A 1WMAA 3H9QA 2FSVA 1FMCA 1F0YA 1TT7A 4WLFA 4GX2A 4DYDA 2QRLA 1GR0A 2ZYGA 3WQRA 1PL6A 2ZB8A 4CM7A 5ICSA 3WLFA 3M6IA 4MVJD 1H2HA 4J1SA 3CSDA 3BMOB 1E1MA 4CMCA 5JXWA 1IY8A 2IODA 4IZHA 4J4TA 2Q45A 3L6EA 1LDBA 3AK4A 3LT1A 3KO8A 5KOIA 1CWUA 2NTVA 3MZ0A 4NJMA 4DBVO 4DWVA 2O4UX 2D5CA 2O48X 5HRUA 3OETA 3RC9A 5JDIC 1RM0A 1MUUA 3DZHA 3FF4A 5JAIA 1BVUA 4K28A 1R4NB 2R6JA 3LLSA 3VZSA 2VWPA 5ITVA 3AU8A 1UDAA 4B4UA 4NG5A 2O7SA 2D0IA 4KUEA 3DZKA 2C2YA 5H83A 2X5OA 2GDZA 1Y7TA 4BGVA 1ZFNA 5HS6A 3AM3A 3E6AA 2HMTA 5DP2A 2B0JA 2C0CA 2O4CA 1PS9A 4RLHA 4DMLA 4J9VA 3ZWXA 1U7TA 5B37A 1R37A 4GX5A 3R6DA 2FPPA 4CMGA 5TLSA 4J49A 3OM9A 2PNFA 3OA2A 5DP1A 2UYYA 5LCXA 1MLDA 2EV9A 1GPDG 1HE4A 2UVDA 4IINA 2VT3A 5DF1A 3FNGA 1HKUA 5AXCA 2ZYAA 4ZD6A 4XB2A 1I01A 1LU9A 3P7MA 4A7PA 3HDYA 2O3RA 2VYVA 4Q3BA 2Z5LA 4MVJI 4Z3DA 5I7EA 2JD2A 2Q99A 1LSJA 3HE3A 3S55A 4CMJA 4I08A 4EYEA 1F06A 1PGPA 1B8VA 1C1DB 4FSHA 5GZ6A 3ZU5A 4OSPA 4BO4A 1N5DA 3IAHA 1BTOA 3EMKA 5ILGA 2DLDA 3KSDO 4E2YA 4FIZA 1PEDA 3TJRA 2UAGA 2GRAA 4UEKA 1KBZA 1M67A 3DXFA 3LVFO 3PQEA 4ZRMA 3VPXA 5JDCA 3KETA 1EEHA 4PLPA 1RWBA 3D4PA 3NDRA 4G5HA 2JKVA 3ZZNA 1Y8QA 2X0IA 1YJ8A 4L4XA 1HE2A 1LXCA 1Y8RA 2B4QA 2VZ9A 4NFSA 3G0OA 4UAGA 5L51A 1Z73A 5BNIA 3GPDG 3PVZA 4WEOA 5JLAA 4FW8A 4ND3A 4GBJA 1E1LA 3E48A 4PVDA 3U62A 4RDHA 4MDHA 2OOSA 1T24A 2A94A 1EMDA 1T4DA 4CLOB 2C29D 5CP8A 4O1MA 4UUNA 1SNYA 1PWXA 2AG5A 5FI3A 3MTGA 1U5CA 4CM8B 5IDYA 4F45A 2NQ8A 3TL2A 2CVOA 3CEAA 4GSLA 4XJSA 4DGSA 4J0EA 1GEGA 1EVIA 1KEUA 1KETA 1PX0A 5A9SB 1X13A 4KP7A 3KSZO 2B69A 3ZV3A 2E48A 3KVOA 4XYGA 4O63O 4YEDA 3GLQA 1E7WA 1XWFA 3KLMX 3WGOA 3ZW8A 1M75A 1A27A 1V3UA 2Q4EA 2BI8A 1E6UA 3ZWCA 4RORA 1F14A 1Y9AA 3O9ZA 3VH2A 4CLHA 1JKFA 4U0KA 5I7FA 1HDRA 3HFGA 2H6EA 3DZIA 3D5QA 3ZU3A 3IDSA 3Q2IA 4O6VA 5C5IA 1JAXA 3JCZA 1GQQA 1KC3A 4BO6A 4XWYA 1K0UA 2EP5A 4H15A 3DOCA 3VTZA 3BTSA 4E6PA 3R0IA 4DIBA 4HXYA 4MP6A 1HZZA 1ZIDA 3K92A 1LSOA 4HNGA 4MO2A 3GG2A 2NTJA 3PJDA 1NAHA 1RM5A 4MVJG 3A9WA 1AN9A 2O3UA 3SVTA 1PS8A 1DJQA 4PFJA 3H6KA 4K9DA 1X7DA 4J7UA 1UAYA 4ONEA 4DC1A 1F8GA 4UUMA 3P19A 4IGFA 1B3BA 1XLTA 1A9ZA 1XA0A 4BOYA 3ENKA 9LDBA 4CMAA 1ONPA 1ZXBA 1S6YA 4YACA 2X9NA 3RBVA 1YL7A 4CL3A 3Q9UA 4BQPA 1LC3A 3ZHBA 2X86A 2GERA 3KV3O 4MVJP 4GPD1 5GY7A 2HK8A 3GEGA 1HYGA 3FRJA 4JP3A 4WOJA 1ONNA 2D59A 3DHYA 3F1KA 2GD1O 3NRCA 2EG9A 1KOLA 1VPDA 3ICPA 3QWBA 3WWZA 1X7GA 1I8TA 3JQ9C 4NZ9A 1EBFA 4OXKA 1LA2A 3AU9A 4BO7A 2ZTUA 4I5DA 3KRTA 3ON5A 5JMWA 3JQ7B 4XQGA 1DBVO 4EJ6A 3H65A 5A4DA 1ZK1A 2CDAA 4JJGA 2V6FA 3B1KA 2HJSA 1A72A 4XD2A 3I9LA 3CMCO 3EW7A 1NPYA 4LK3A 2A9FA 3GFBA 4GWGA 3X2EA 4BNXA 3ZDFA 2ZTMA 4J0FA 1B26A 1EE9A 3GA0A 4NHEA 2NU9A 4YYZA 5FEUA 5BSEA 1EDZA 4ND5A 4BVAA 3W4JA 1CERA 3SBOA 5JCJD 4OM8A 2Y68A 3IC5A 2VZ8A 3DAGA 3PZBA 4I9UA 2VN8A 4Y8VA 4ZHSA 1LEHA 3GGGA 4YJFB 5JO0A 1U4OA 5JY6A 4P38A 3I9NA 1E92A 4UVGA 4MIYA 1PZFA 1E3LA 3KYCB 2A4KA 2OHXA 1DIGA 2TMGA 4DPMA 2AEJA 2CF5A 1NASA 2XXBA 1GU7A 1ENOA 3UXYA 4AJHA 3JQ7A 1UH5A 3KSUA 2Z1NA 2HAEA 1WNTA 4Q3EA 5T5QA 3OIDA 1Z45A 4JBHA 1LQTA 3UCXA 4FFMA 4PZDA 1BSVA 1VM6A 3TFQA 3BMCB 5F5NA 2BF7A 1UXIA 4FFLA 4R16A 3ROPA 1QYWA 3JQFC 4NK5A 1PGJA 1IULA 4ID9A 4G65A 4B8ZA 1AXGA 3KM0A 5L53A 2TMDA 4BO1A 3T7EA 4II3A 3V1UA 1PZGA 2D1YA 1ADCA 4RVFA 3BHMA 2W2LA 1ISFA 4GL4A 2G17A 1P0CA 3DB2A 2FMUA 3JQBC 4OSOA 1GYRA 1O95A 2J3KA 4YJDA 3PGJA 1ADBA 4FD3A 4WLOA 3OEYA 3GDGA 3WFIA 4BV9A 4BO3A 4L74A 1JKIA 2X0RA 1BVRA 1X0VA 1P77A 2PD3A 4PIVA 4DIOA 4NBWA 3WYBA 5TSDA 4BNLA 3ZN2A 4BNMA 4BNUA 1QYVA 4CUJA 4DC0A 1W6UA 1FK8A 2BLLA 5EJ2A 1DFIA 3HG7A 5TIIA 4W99A 1HDYA 2BFOA 4CMEA 1GV0A 4PLZA 3QY9A 4E33A 4ND2A 2ZCVA 5AQ1A 5KJCA 1PU2A 2RH4A 3GVHA 5BSHA 3DHEA 3E9NA 5TJHA 1PJSA 3U9LA 3OBBA 3IJPA 1B0AA 4NBTA 3FTNA 3JYPA 3EAGA 1JTVA 2G76A 2ZK7A 3X2FA 2WE8A 1WP4A 4PLYA 4IS3A 3F5SA 2X1HA 1I3KA 3Q6IA 5B4VA 3H8VA 4FR5A 4TSKA 1ENYA 2PFGA 4HWKA 1EK6A 2GSDA 4TKLA 1Q7CA 1JVBA 2Q1WA 3OF2A 1UDBA 2DFVA 3FCOA 2J3JA 3B6ZA 3ZCXA 1G0OA 2JAPA 4L4RA 3G79A 3QHAA 4KOAA 2OBNA 2UV8A 4E2WA 1ZUD1 1P1KA 5JFOA 3U4HA 1NM5A 3VAZA 3HADA 1U2GA 4CQMD 1ORRA 4W6ZA 1V6AA 2DPGA 4YVFA 3WOHA 1ONOA 4RV9A 5L45A 3VDQA 4CR7A 2AEMA 3ITDA 3GVIA 4LGVA 1QYCA 4L76A 3Q3CA 1CEQA 1FXSA 2YFHA 4RVSA 2VOEA 3B20A 3EDMA 3KB6A 3FD8A 3IS3A 3ZWWA 4DQVA 3DBRB 4GKBA 3UOGA 4EGFA 3BTOA 4CM4B 4AJJA 5TS3A 5CDSA 1CRWG 5I9NA 3WMXA 4Z6KA 4CMKA 3PWZA 3WSVA 4LCJA 1I3MA 4M49A 1LI4A 1Y5MA 2CUKA 3PWSA 4EEXA 1I36A 3DZJA 5L7YA 4Z0TA 1VSVA 1A7AA 2NVWA 5AYVA 1EDOA 2AXQA 2VCYA 5DBGA 2YY7A 3WLEA 3LQFA 2VWQA 4IDDA 3UKOA 4R5HA 3DZBA 4BMVA 2OUIA 1N1GA 1HE3A 3I52A 1YDEA 4RJTA 5A3JA 2JD1A 2J3HA 3BMQA 3ETDA 4CR8A 2RH8A 1P0FA 4OKNA 1M6HA 4D79A 4RF2A 3RAJA 4PVCA 1R66A 5IXSA 3RU7A 4IY1A 5COAA 3VKVA 1K2WA 3GDFA 1G6KA 4CLXA 2XAAA 5KVCA 1ZW1A 2BI7A 3H5RA 3GN1A 1U2DA 4EUHA 4YRDA 1GUZA 4RQUA 1JDJA 3RC7A 4XR9A 4L9RA 4EZBA 3OJLA 3D64A 5IDWA 2QZZA 3VH1A 5I8WA 2YJZA 1DLJA 1GD1O 1PJ3A 4YWJA 3OP4A 1P31A 3S8MA 4R5MA 4YBZA 3EZYA 3RC2A 4Q3AA 3F5QA 1JWBB 1OFGA 4N18A 2PV7A 1IPEA 2NLOA 2HCTA 3PZRA 1HRDA 4CUZA 1EE2A 4RPHA 2VZ0A 4HFNA 2DT5A 1NX6A 1E7QA 4RF4A 2VHVA 3PEFA 3DHNA 3JYLA 4A10A 1ISIA 2UUPA 4IS2A 4N5MA 1C1DA 1A4IA 3UGKA 1I0ZA 1NVGA 1A71A 1LBEA 2CMDA 3ADPA 3DBHA 5IN5A 3PIIA 1ENPA 1E6WA 2BFMA 3KYCA 1K6IA 5F1PA 4ALNA 1HWYA 2HKIA 3WGTA 2FWMX 4GX1A 4BL5A 4AG3A 3QV1A 1YDWA 5DULA 3TN7A 1Z75A 1CDOA 3RUEA 4LMRA 2GN8A 5A03A 1SPXA 2X58A 3N7UA 2WD7A 4FJ1A 4ILKA 4L4SA 2R00C 2Q50A 1I5RA 4YR9A 6LDHA 4B3HA 3NGLA 5DN9A 1DHTA 3ONEA 3ZWBA 2DKNA 3ZWPA 4LVCA 1PJ4A 3CINA 4YB8A 5BT9A 3NTQA 3HHPA 5F21A 2Y0EA 5JYDA 1ENZA 3K2EA 1UJMA 2BH9A 3QP9A 3GZNA 1PJLA 2EEZA 5T57A 2VT2A 4A27A 5AXDA 2ILTA 1W8DA 3NT5A 3VH3A 3PHHA 4A26A 2Q1UA 2QRKA 4TROA 4GX0A 4FFOA 4MINA 5BNTA 2VTEA 4MKXA 3B70A 1GPJA 4RPLA 4CMIA 1WWKA 3JV7A 4MIOA 1FDTA 3DONA 4XQEA 2DBQA 3INTA 3HSKA 3TZ6A 1YONA 3GVPA 4Y6RA 3W8FA 1UAGA 3PGXA 3ZI0A 3WGYA 2GASA 3TWOA 4BQRA 2P2SA 1NR7A 2JFGA 1WVGA 4URFA 4TRRA 5CDGA 3F9IA 1OOEA 2D2IA 2IXBA 4Z9XA 5DOZA 1T2CA 4EUFA 2J5KA 1D3AA 4J7XA 5IDXA 2LDXA 2GF2A 3D3EA 4E12A 2FSSA 4XYLA 1EBUA 2W8ZA 4TRJA 4E3ZA 1FJHA 4EDFA 2HJRA 3AOGA 1O9BA 2Y1GA 5KVQA 3CPSA 1MA0A 1T26A 3NT4A 3RC1A 3WSWA 1PIWA 3FWZA 4PLTA 2PZMA 1C0KA 3HUDA 1Y6JA 3ZV4A 5C7IO 1NPTO 2I99A 2NVUA 3CUKA 4JBIA 2VWGA 3GMDA 1U8FO 4GLLA 1KVQA 1E3EA 1NQAO 2EF1A 5CDUA 1Y1PA 2VNSA 1EFKA 3JTMA 1ZVMA 1GTMA 1PJCA 2OGUA 3JQGB 3DFUA 4OJNA 1WAMA 1ZO8A 3ICCA 3ZV6A 4CV0A 2WYWA 5HWSA 4E2ZA 3ZU2A 4DLBA 1N9GA 1E1NA 4HP8A 2DBVO 1C0LA 4M1QA 2I76A 3STHA 1LC0A 1IYZA 3QE3A 3VH4A 2P9GA 4BB5A 2IEDA 1DHRA 1I32A 3RJ5A 1GY8A 5CAEA 2O23A 2VRCA 1F8FA 2NNLD 1LRLA 3JYOA 5L7TA 3C7AA 3ZW9A 5IZCC 4CJXA 3ZNQA 4ALKA 1VE9A 1H6DA 4WE3A 5IF3A 1P3DA 4OAQA 3RFTA 4YAIA 4IJWA 4WCFA 3CZMA 2X9VA 1PSDA 1KEWA 5G0SA 1HXHA 4EUEA 2JHGA 3WGGA 4AICA 1JKJA 1UXGA 2ZIZA 2X5JO 1JN0A 2DUUA 3PYMA 1LLQA 1QG6A 2NSDA 3COSA 4IDAA 4YAEA 3WQQA 4GLOA 4BO5A 4YAKA 2V7PA 5T64A 2ZKLA
chains in the Genus database with same CATH superfamily
1GUYA 2RGNC 3M6FA 1ZU5A 2OY0A 4JIGA 4QFCA 1EDBA 5E7QA 2G6TA 1SKAA 2IF0A 4K9RA 5MN6A 3QKWA 4Q4AB 4BV8A 3MTBA 3NOXA 3EHEA 1ZN7A 2C2KA 1E2UA 4HDKA 5JXHA 3VHXA 3RYCA 4R40A 1NJ6A 1IK6A 4RF5A 5AXAA 4BNFA 1E2HA 2NZWA 9MHTA 2WB2A 2JJYA 4PPGA 1OV6A 1J09A 1MIOB 2C42A 2QNBA 4WT7A 3OIWA 4YDSA 3WJAA 4L08A 5C8YF 1VPVA 2FPIA 1IXZA 4KVGA 5ERYA 1I5EA 4UU8A 1QHHA 3BIJA 5CYFA 1KZGB 5G4KA 2JANA 1N5JA 1TMGE 2DQ4A 3ES9A 3WB9A 4MLDA 2XKBA 4ND4A 3ADOA 3OT4A 5IBPA 1W87A 4HWGA 1KHHA 1Y4AE 3PDUA 3C5EA 3GFTA 1DDOA 3NTXA 1AHHA 2HDHA 1E7RA 2NVBA 2AN4A 3Q7IA 3TKYA 2BFFB 3AUTA 4C0BA 4ER3A 1UBGA 2V1XA 5A3SA 4BLPA 5HZHA 1DSSG 3HU3A 3MGCA 2GAAA 3OPVA 1VHQA 2QY6A 2YQ4A 3AQ4A 4Q1FA 4M37A 3EXIA 4EITA 1RBMA 1ATIA 1TJYA 1XVUA 4B8YA 1W48A 1CQIB 2ANCA 3N58A 3O4GA 4I1VA 2IS1A 1R0WA 1U4NA 1T9DA 3HJRA 1SHTX 3JARB 4HNUA 4DABA 1IDOA 5DDIP 3UXHA 4ESOA 5BN5B 3PVSA 2JI9A 2V98A 1ZN2A 3OMXA 1V39A 1JU4A 2YBEA 3FGZA 4HEHA 1JWLA 3HZZA 4C0SA 5IKMA 2AOWA 3CEHA 4KMMA 3VHLB 4GMFA 5EJAA 1X7WB 4AQYB 3O03A 4EI8A 3RHTA 2JGMA 3HKBB 1YB1A 5AVOA 1NC1A 2X7JA 1HDCA 4XPIA 2CLFB 2Z30A 4GO1A 4R83A 1ES9A 1DX9A 3DF7A 2PL1A 2EQAA 2B98A 1DO2A 4XYMA 3W7AA 1HFEL 1BRMA 2R6FA 4I6JA 2XR1A 1J0BA 3QTBA 5H8WA 3W5HA 1UJNA 4MRVA 4ENQA 5K03A 1K8YB 3I3OA 3QU2A 1OX5A 1C7JA 1MOQA 3EXHC 4IIJB 4PFQA 1ZR4A 1SRQA 1W0JD 2OC9A 1NTOA 2AJTA 4FILA 1H2AS 5F12A 2H7YA 3ZHVA 3K96A 4NV1A 3LCMA 5ITZA 2FK7A 1DRVA 4MS4B 3EIXA 5B6PA 3UIEA 1YMQA 3VYSB 5CBPB 1P9OA 4JLOA 5HF5A 3NTVA 2PWAA 2A33A 5G4LA 5LB2A 4YV2A 4GKKB 1ZYUA 2IXAA 1Z6GA 4JU9A 4XIFA 3TLBA 4QHTA 1FQKA 2ZR7A 2IZ0A 3A4TA 4QXMA 3T4XA 3TW8B 5HQ3A 3R3HA 5GWXA 2R6CA 4Q3OA 1QU3A 3EWAA 2M1XA 2BR4A 5JMTA 3SP1A 4HMOA 1U3VA 3SYNA 4UUQA 2GF0A 3TW0A 1H3EA 3USZA 2Q3CA 3N07A 2ZSBA 1J5XA 1EFCA 1CIJA 3C6QA 3M9WA 5ETJA 4RD3A 3P45A 1NQOA 1K8RA 2C84A 4A8JB 2ZR0A 4NK4A 1R4ZA 1SVIA 3DEIA 1K27A 4YAWA 3UGTA 3WNQA 4CMIB 1T2DA 3QW4B 5H3CA 2V58A 4RHYA 4ZYLA 4PRLA 2X0KA 1X7XA 4D9HA 2HU5A 1GKKA 5AVXA 3FPKA 2HYDA 2VJQA 1RP1A 2ZPUA 3QH4A 5ESXA 3RTDA 1UWLA 3ENZA 2ALJA 4H59A 1YRLA 5C7LO 3G6WA 1XVIA 2NO1A 5G3ZA 3SX2A 2WTNA 3UMFA 2BZGA 1KU6A 2R11A 3OZUA 2VG8A 4MQFA 2YV1A 3SM3A 5E0KB 3VZCA 3PXXA 2HTEA 2UUCB 1Y34E 4WFIA 4V39A 4HDSB 1V1RA 4JYPA 2YWHA 3WIEA 1OC2A 3LXMA 2X3FA 3PPWA 3BB1A 1O4VA 1M7BA 4KMRA 1O57A 4NJMB 4D9BA 4ROSA 2ZTSA 4GMDA 1WDLA 2W2PA 3IAFA 3WNBA 1UAAA 5H59A 2YXEA 1PV1A 2OHJA 3UH1A 4B6OA 1IMJA 4Y6QA 3EVZA 1ADFA 4OFBA 1KDTA 3WQSB 2NX2A 3V8MA 4FKMA 5AW8A 2PIAA 5A62A 3KZCA 4MYHA 5DW0A 2B37A 1BCSA 1N5OX 3UEOA 2HIMA 3O21A 2OTCA 3BD7A 5GOZA 1TM1E 4QVKA 4MVJF 3DUWA 2QAIA 3O93A 3I9V1 4JFRA 3UMMA 1RKUA 4L16A 2HK7A 3I73A 4GKAA 5EWJB 1AHNA 2J5RA 2W8BB 3H9UA 4HSGA 3TZQA 2HD4A 3L7NA 2BEVA 4JGIA 4XJXA 3T3EA 4CQNA 4L7VA 5I7OA 2G1JA 5AJUA 3H1PA 1PFWA 4K6CA 2RBEA 4U7TB 4LXIA 2WJ3A 3KUCA 4WESB 4CG3A 1XDZA 5FF9A 1V2HE 3IP6A 3ZKAA 2CEKA 3OHPA 2ZIUB 2CDCA 3D2CA 3SJZA 1U6JA 1CUCA 4HGQA 1W36C 4R3NA 1F5NA 2EFEB 2H48A 1HR0B 2V5AA 2EG5A 3HYTA 3KQOA 4MAAA 5DWVA 1ZNQO 4BE4A 2A57A 1U2EA 4HAVA 2TECE 1KORA 1GL9B 4UARA 1KYXA 3VGJA 1KI1A 3DLAA 3B1VA 4CKEB 3GLFA 4DR7B 1N8KA 3HN6A 4PN7A 5T4BA 3BSFA 7AT1A 5HFAA 4TWIA 3D8BA 4OHMA 5DBHX 5DLYA 3RF7A 3RLFA 1M6YA 5IMSA 2OCDA 2EZTA 4HFMA 3K6RA 4EMSA 3FMFA 3BXEA 3KLPX 2AR9A 1WSBA 2A1TR 2BV3A 2V3WA 4PO3X 3MJRA 1N7JA 1YK0A 2HSJA 5BW4A 4MULA 5BURA 1TT5A 4ITUA 1Q19A 2Z43A 2V6BA 1KMMA 2CNWA 1Y8CA 5DNVA 1CTQA 1G1AA 2YHUA 4IHAA 1CLEA 4P92A 2PKQO 1Q20A 1ZM7A 1RI3A 2I8AA 2C2XA 2KBEA 2P2LA 3ZK8A 3O73A 1E2FA 2H4WA 4CM3A 5C8XA 1BEUB 2NQTA 2X0NA 3QLEA 2ODEA 4QECA 3LGAA 4Q9HA 4EB3A 3PR2B 1A1SA 4WXHA 3BUSA 4DA7A 2J5XA 1RM4A 2F00A 5D1HA 3K8ZA 1FX1A 1YNSA 2P75A 3O8DA 4NY1A 1NBAA 2BKVA 1CV2A 2J59A 2DBRA 3WRYA 2OMEA 1GCOA 4V0RA 1SELA 4LPKA 1UPCA 4Y2UA 5DNAA 1LF0A 1FTGA 4CM1A 2QX9A 3KHUA 4EG6A 1ORWA 1UEJA 4JKIA 1P5JA 3B48A 1CEYA 3G0IA 1S2LA 4ASUD 3EZ6A 1B6RA 1SU4A 4YRZA 5E2BA 4P4UA 2ONCA 1U0GA 4D8WA 4J43A 3ICQB 4J0QA 1V2GA 2I3BA 1PSZA 8GPBA 2H1FA 2VNKA 2HUPA 2EARA 2FG6C 4X6LA 4HNTA 2XVAA 2YIMA 4IQFA 4FSDA 5B5SA 2FEMA 2P4QA 1EFUA 3RC3A 1NBOA 3GFOA 2WFAA 2VWHA 4NEQA 2A35A 4FX2A 1WIWA 2QJFA 3LCVB 1LK7A 1PJAA 3CZRA 3PE6A 4H3VA 3PEUA 3Q3HA 1Z28A 4MV9A 5FHQA 1KY4A 2V6MA 3N8NA 2X41A 2ZDHA 1KWKA 1WF6A 3THYB 5DI3A 4M0MA 4Z4GA 1IB6A 4I7EA 1Z74A 1D4OA 2J33A 4IVRA 4OB6A 4P7KA 4H1HA 4UHDA 2IDZA 2NAFA 4CTNA 4ZICA 4U6NA 4CKBA 3L84A 4D25A 4WKOA 5JAHA 5H02A 2BGMA 4C7MA 5LKRA 4TXJA 3FBGA 3C24A 3D3WA 3Q6MA 1DELA 4XB6B 4D3YA 3OIFA 4PAMA 4KWCA 4IMIB 4V0LA 1H1LB 2BFPA 1XXHB 2FYTA 3MWEA 1KDPA 2IEBA 4RCYA 2F55A 5JZMA 4YRAA 2CFTA 4MVJH 3T9DA 5ICGA 1I7QB 3K09A 3ABSB 3T1YB 2GLTA 1GCUA 4MMZB 4CKXA 1BDMA 2ZSUA 3G8DA 5REQB 4QEZA 2Z2JA 4Q9DA 1RXEA 2FN3A 3KVRA 4BLSA 2C8LA 3ABOB 5CFMA 3IE0A 3N3AC 1AZWA 1B73A 1C41A 1OBVA 1JEOA 4IIJA 3RAPR 3WK5A 1KO4A 5ICFA 3K0FA 4KX3A 1VHJA 1CBUA 3BPSA 2OCKA 2CDRA 4G2NA 2D2FA 4G8JA 5ER6A 2Y05A 3SK0A 2OCGA 1NVKA 4OI2A 2H1SA 2I33A 4BNIA 3RVBA 3AT1A 1Z37A 2A88A 4JYZA 4AZ3A 3I2IA 5I9IA 1KZ9A 1P1BA 1WUIS 4K6FA 4KZKA 3W0LB 3EVGA 2BMVA 4IQGA 4LCBA 4N0QA 3WHLA 1BXGA 4CKWB 1ZAKA 5HQ3B 2BGGA 2IV2X 1Q50A 3L0YA 3M1AA 4FE4A 3MQ4A 2D4AA 4F06A 1KF0A 4B34A 3IQEA 5HF9A 2NU6B 3DBLA 1CUAA 4L5BA 3MTDA 4N7BA 2PBZA 5CG2A 4P4TA 1Q5PA 1Z29A 3QIVA 2PPVA 2ZSKA 5EKTA 2J4FA 5FL7D 3VVLA 4ER6A 3TX6A 1TPYA 4O4JB 4A8TA 4TWBA 3HJHA 4XGKA 3UUWA 4EVRA 4FE3A 1YBAA 3TQRA 3DEZA 2BH2A 1EWTA 1LTHR 3GA7A 1T43A 2B1RA 4RZQA 2ZVPX 2W2TA 4A9AA 2G25A 1K5HA 2A5GA 1XWWA 2XF8A 4CV1A 1A9OA 3ZNPA 4Q66C 1FUUA 4DADA 1W49A 2E3JA 5HTKA 4B43A 1VJ5A 3JQGA 5DNYB 5JCOA 3T3GA 4OP2A 4YREA 1M2WA 4DZTA 3R09A 4KAAA 5JH7F 1DBSA 1ZK3A 3NHPA 5LDGA 3R4VA 5KWEA 2VSOA 5JSKA 2IPMA 4K9NA 1DAOA 3G1UA 4FZVA 3L1IA 4KYUA 4CQLA 1JJAA 1Z63A 4UBKA 2Y92A 2AXEA 4FNMA 1W52X 1XBTA 2IPLA 2QG9A 1R4AA 3FETA 3I76A 2YOHA 5F5XA 5D5HA 1U6IA 4JUFA 3U80A 2X9LA 4JROA 4E94A 2VL7A 3H9JA 3IV6A 2OA0A 1OXTA 1U3UA 5CAEB 4AN4A 4HN4B 1TQDA 4K9KA 4CQJA 4F96A 2FMKA 2ZSHA 3ASVA 3JD0A 4KPGA 1WDMA 3E3OA 5G1OA 3T5GA 3PL5A 2WYUA 5D5QA 1COWD 4KIGA 1WG8A 3G9QA 4TMFA 2ZJ8A 4I1OA 3FHCB 3GGPA 1AN0A 3IIKA 3NBMA 4OQPA 3NHLA 1GWNA 3GPLA 1SXQA 1BIFA 3TZKA 3TX2A 1WE2A 4KX5A 3OZFA 2NO7A 1EFAA 1Z8HA 3ZE8A 3IUQA 4ZU3A 3AUXA 5CX1A 4ARZA 1ETUA 3VZQA 1RPNA 2BSAA 4RM2A 4DILA 4ISBA 2WWYA 3RWBA 5JD5A 2PEYA 2Z2IA 3PEYA 4WK4B 2DBZA 2K87A 2GSWA 2ORVA 2M2IA 4JELA 4DMMA 4TTJA 4F71A 2JFHA 4YCCA 4NCAA 4HH4A 1ZVQA 4L51A 3W04A 5JSQA 4E5VA 4DIFA 4HK4A 2Q5OA 1SCDA 3CF0A 3HYCA 4GM0A 3OCZA 4S0XA 1HG0A 4ZC1A 3V42A 5JQWA 4LF7B 1L6IA 4RH0A 1GNRA 2F48A 3TQQA 1U0NA 2P79A 1US8B 2Z95A 1RWXA 4KFUA 4CFSA 1G0NA 5JALA 1BDBA 1MIOA 4RSHA 3EVEA 2CVQA 1GZVA 3IQFA 3NHRA 4YROA 4KXUA 5KKAA 4ZT4A 5KHAA 3G9UA 1UBCA 3BQMB 4LSZA 3T7DA 3TVYA 3MF4A 3HJCA 3RM3A 3R3WA 1G5QA 3PUZA 4Y2JA 3SQMA 4AXXA 3C3AA 3OOWA 1XU7A 5C35A 3ILHA 2GFHA 3VR5A 1Y5IA 2OGSA 2Q2QA 3AGQA 2NT3A 2VBFA 3PIRA 4Q18A 2ADMA 5D2CA 3ZHUA 1JSZA 1URPA 2R66A 4GLFA 4HAOA 1ZH6A 2C59A 1YR1A 3LYLA 1CYDA 1GHTA 2AZDA 5FUQA 4L5CA 2QHXA 2YCLA 4J03A 4J91A 2QTTA 4RA9B 5JD3A 3WLOA 5A9TA 1QM5A 1LKZA 1Y37A 3QE0A 1K3TA 2BOVA 4WCFC 5BMVB 5CFNA 3DBHB 5CB0A 4CMEC 1WZNA 3ZWMA 3LPNA 3G8YA 1PR4A 2PU7A 1LDGA 3RIEA 1FNSA 4JC4A 2QTZA 4JXXA 1BQ3A 4HZIA 3N3BC 4BKRA 4YRGA 2GPJA 5G0TA 1L5ZA 1Y98A 1Q2XA 4Q3CA 4BNYA 1JZQA 1SKYB 2CZQA 2PSFA 3X1YA 3D43A 5FQNA 4HX5A 2IVFA 1PEYA 1G7SA 2HA3A 4FYKA 3DB1A 4MWZA 1L7EA 1RXIA 4FCVA 1W59A 1CUJA 2A30A 3GG9A 3L8EA 3LFUA 4MA0A 1BMQA 4XR4A 5C5DA 1QTQA 2GCOB 2RIRA 1E0AA 3FTQA 2BJWA 3UHAA 4BAZA 2P4UA 3NNNA 2OFFA 5IFLA 1C9MA 4FLMA 4JS0A 2ZJOA 2FETA 5F33A 4N5DA 1BEEA 4BXOA 3M6AA 4GAEA 1IXKA 3N6XA 4A3SA 4EBFA 3PVCA 1L8LA 2FEOA 2JJ1A 1Z82A 5KAPA 1SD5A 2C20A 1ZW6A 2JGAA 3EGEA 3OQHA 3UJBA 1GFWA 3H2SA 3VV3A 3AY0A 1KZ6A 2PKCA 2PS9A 1IBLB 3CB2A 2JIPA 3ILVA 2B20A 4Z53A 1QMPA 5T4EA 1EHYA 1G17A 4ZO4A 5EZ5A 1NW8A 3PXDA 1FTSA 4ESEA 2B1IA 2H1WA 1M2VA 1QIFA 3F96A 3KXPA 2I7DA 2ZYUX 5EWMB 3TJMA 1GIAA 1TU0A 4N5LA 4R6XA 3CLSC 2OYCA 5J2UA 1IRXA 2RKOA 3GI1A 2A92A 2MSKA 1WF3A 1F2TA 2VHWA 5ITZB 1RR6A 4EG5A 1ZI9A 4WLVA 1D5WA 5B4UA 3HVIA 1XYYA 4OHKA 3BERA 1C8LA 5HDBB 3QVMA 3SPXA 4JVMA 2FEAA 1GGHA 4MJ7A 4UCFA 4CT0A 4EVIA 3KT6A 2QA5A 3CGWA 1G5PA 1GVNB 5AKGA 1IXYA 5DNEA 5CLQA 3R3UA 4WEQA 2Q7XA 2P1RA 4PG7A 4BO0A 4ZZIA 1ULUA 1ZMTA 2OXIA 2J9ZB 5CX4A 2HMAA 3FH0A 2VHEA 4C2UA 4WD3A 5DASA 2PS3A 4HDMA 2H7XA 3FYHA 3NFRA 2WUVA 5FBLB 1SOUA 3RIYA 3FRHA 3BS4A 4L75A 1CY2A 2VTDA 1K8XB 2YZ7A 5JANA 1YS1X 2GETA 3ETCA 3TR5A 3U7FB 2W58A 3FVTA 1WXXA 1H42A 1Y6QA 3QPVA 3VDXA 3WMFA 3D6HA 4YCAA 2CHGA 4ZHQA 1V9CA 2DQKA 4B32A 3M81A 4PYKA 5IYZB 2CCJA 2YZNA 3P5SA 4TV8A 4GZ3A 1Q1EA 1H2WA 1QNFA 4UUPA 5DGDA 2R5FA 1GGKA 2XADA 4OQZA 2QDXA 1LPNA 1ZMBA 1AZLA 1VXRA 2C3PA 2JBHA 1XTKA 1NN5A 1OY1A 2QUIA 4Q03A 4R71A 4MQFB 6GPBA 3CIFA 3L46A 3ZZUA 1HEYA 4FZJA 5I51A 1M7GA 2PZLA 5LR6A 2QVYX 4CIYA 2X0EA 4FDUA 2AJDA 3MOGA 1Q16A 3CUSA 5L7WA 4BASA 3T5CA 3LRPA 3IPLA 1TO6A 1A5TA 2AZMA 2DERA 1V7ZA 2CLOB 4JLDA 5F7OA 4WK0B 4XRRA 2KI5A 3H04A 1N9KA 1UODA 1B16A 2CNWD 2WIAA 3G8BA 3ICVA 1T2FA 5FWYB 2IU3A 5A5EA 3HDJA 2X7HA 5FD8A 2QORA 4OXYA 3K2BA 4BUCA 5I8ZA 4P3YA 1KVTA 4IJUA 5L3ZA 2H7CA 4B87A 2IE8A 3NGMA 1V4BA 1U2QA 4ABYA 1KP2A 2FMIA 3CNOA 4C4ZA 3L0PA 3E5MA 4Z3KA 1J8YF 1DT5A 4IKEA 2OGZA 3SLGA 4A5OA 4KR6A 1KVRA 1M2GA 3QMVA 3PFWO 4TMKA 4IQ0A 4WASA 5T8KC 3H42B 4RQAA 4AO7A 4MKHA 4R9RA 4N48A 1JLLB 2RHWA 3K5HA 3E22A 1ZN9A 4K1LA 3DDCA 4MGYR 1GDDA 2AFRA 3QFCA 1DAPA 2HH9A 4ERNA 5U4QA 1JILA 4GW3A 3T3IA 1B8PA 1R5BA 3PRHA 1RP7A 4IHKA 4C6RA 4AY4A 1XTTA 4MQEB 5JROA 1T5SA 2WFZA 4HQ0A 4OHPA 4DEYA 5KVAA 4YAJA 3CNLA 3THXB 4K81B 4Z7QB 1VYUA 3GAFA 3I39X 3SJBA 3ZGVA 2IP4A 3WDMA 4MGIR 1E5XA 4JBLA 5ALXA 4KAFA 2ATCA 5U1PA 3OU7A 3KD3A 3AI1A 4HGRA 5EQTA 1JU9A 2WT8A 2ZJZA 3OU6A 1R10A 3L3BA 5CT4A 1FDUA 5HHTA 3VXKA 1S3FA 5AVZA 1KZ1A 5JCJA 2CD7A 2GTIA 5BVHA 4AUNA 4GR5A 4M7PA 2YJGA 4HV4A 1KI3A 4RK5A 1Z5NA 5FL7A 1HL3A 2GHRA 5SYAA 1XVVA 2H07A 2DSNA 3GNLA 4BN0A 4OX9B 5BOVA 1NRWA 2VP9A 4ENVA 1C0PA 1R2QA 2O1SA 2DJIA 2I6TA 1VI2A 1ZNXA 4FYYA 3VDMA 5JT1A 3TUZC 2Y77A 2ZBPA 1ZCZA 5J2TA 3T3NA 4NOJA 3WIOA 3EIOA 5NLLA 1NAIA 2C5BA 2GCPA 2LVBA 4BKOA 4NENB 4DWJA 4IIJF 2BGKA 2YASA 3W5BA 2DR3A 3FJOA 2JBAB 5EMJA 1P9WA 1D4AA 5TF0A 2PX8A 3R6TA 1WZIA 4E70A 4P7FA 4ZAZA 3T94A 421PA 3R44A 5KTTA 5IBCA 4I8XA 3A2KA 1TKAA 4IPTA 2GEBA 4MGEA 1PWYE 1Y8AA 3G1TA 3K0AA 1M5RA 3AVXA 1NFFA 1VECA 3AEKB 4REQA 4EMUA 621PA 1NW5A 3DWGA 1XKTA 1HK7A 3EFHA 2VYND 4RFSB 3ZQUA 3PCRB 5TR9A 4HADA 3NAZA 2C54A 1MFZA 4JLNA 4BV3A 3KBBA 3VR1A 3D7KA 1H8ED 4XIYA 5C52B 3QG1A 1GT6A 1J2UA 1T9GR 3E8XA 2VOJA 2QDKA 4EGSA 2PKYX 2QU8A 1Y82A 1U0OC 1GGFA 3H75A 1XKXA 1VJCA 2QGNA 4Q7EA 5LMZA 1JB9A 4D97A 5A6SA 1JNXX 5JBNA 4XDHA 4DANA 4O3FA 3U3XA 2P5UA 3HO6A 5KJEA 2NQ2C 2HPHA 5A0VA 3BXGA 4JWKA 4LOLA 3LDUA 3Q3VA 4UEWA 1KOGA 1ZICA 2JHAA 4BN5A 2GKGA 2LBPA 3DOJA 3L8ZA 2AI2A 5CFRA 2BMFA 3CTPA 1KPIA 4YPOA 5LP6F 1Q0SA 2EBFX 2Q29A 1HLDA 3B5IA 1L7PA 1OI2A 2ERYA 2HBYA 3I62A 2B8NA 3C0KA 3H5WA 4L7QA 1NSFA 1RU3A 2YWEA 3C87A 3LO5A 4IICA 3QPAA 1KAOA 3WX0A 1D1SA 3WZ2A 5JC8A 1PNRA 3JQAB 4WDRA 5EXSA 3A31A 2GN9A 4M0EA 4V1CB 1O96A 2GLUA 1NE2A 3LUGA 3TPCA 4MWSA 3SN6A 2I1QA 2R2GA 2ECKA 4YPFA 2J4CA 2WYIA 2V9PA 4BC0A 5CA1A 2WU8A 4FYXA 2X2OA 3U16A 4U6SA 3W9BA 2WIFA 2Y2UA 3BTUA 3FN4A 3PNBA 1T2AA 3HJUA 4ETNA 5DPMA 5K4GA 4DB2A 1P2SA 4MCJA 1N92A 4D26A 5A7GA 3KQHA 2ZFUA 1B4DA 2YDYA 3EEOA 4FU0A 2VP4A 3LX5A 4NBRA 4F9GA 4WN9A 4L8GA 5IAAA 5JZVA 2ZJBA 4LWPA 2YYZA 4PFSA 4DM7A 1ZRSA 3HDQA 3E2PA 3AEUB 4URWR 2KB0A 4DUGA 3H2HA 1X7ZB 4U8GA 3G59A 2EFDB 4P31A 4N41A 4HXGA 5KTYA 1II9A 2WJ6A 3RS5A 2YY6A 5IK2D 1KYWA 2WNSA 3LCCA 3SSNA 3ZNNA 4Z9YA 4DG9A 1YO6A 2AB0A 3UF0A 4E1VA 2HCJB 1QP0A 2PZEA 1RJ9A 2QXTA 2WM2A 3FPGA 4IJKA 2QN6A 4P4NA 4IQ8A 4EKEA 1E2IA 3U19A 1OLUB 4AJPA 3GCWA 1XYVA 1P2TA 4Y6LA 2LZ0A 4F4DA 2W4IA 1LGYA 2CWWA 5F2OA 5KC8A 4D9EA 4JI0B 3MOIA 2CJPA 2H1RA 3GHHA 5JI2E 1T1RA 5ENZA 2BEUA 1TKCA 3FNRA 5GP1A 3RYHB 3TSAA 2HRDA 2NTYC 4C0QC 4BQEA 2XYVA 3ZJ4A 2BBTA 1Y3FE 2OV6A 4FS3A 3BA1A 3T7RA 3IE2A 3GW8A 3VU9A 2A9RA 2QQ5A 1YTLA 3DULA 2IIQA 1E3QA 5FRDA 3QLTA 5SV2A 1CJSA 4DNPA 4O29A 3ILXA 3QOWA 5HX7A 3U4AA 4FFDA 2BEVB 1RXVA 4LKRA 3HVRA 1FLDA 2FHSA 2WPDA 2P9HA 1XPJA 2Q07A 3B3QA 3C3DA 3OZSA 1J99A 2RHRA 4H2DA 5DHTA 2B9EA 1ICEA 3U4GA 4IUDS 3PFIA 4QOFA 5EL0A 5PNTA 1ESEA 1ZH8A 4G0QA 4LRUA 3PICA 3K20A 3WFZA 1BXZA 3PHJA 5JYCA 4LZOA 1ZR2A 3JR3A 4R51A 3OY2A 4S2UA 3I5XA 1ULSA 3P4YA 4TOIA 1I80A 1ZINA 5JOQA 1AKVA 1SOVA 3Q0IA 2Q5FA 4KZPA 1T91A 3AF5A 3IJRA 3REQB 5AUPB 2FUG6 2R6R1 3U1BA 5CCBA 3WLRA 1VLLA 4Q4DA 4K26A 3OQBA 2PCJA 3PXGA 4AWXA 3JWGA 3SZGA 1F4VA 1Y8QB 4Y6PA 3RCBA 2ZDQA 3UMBA 3VTAA 4B79A 4B0PA 1ZGAA 3C7TA 5CLGA 3T0FA 3B6MA 2AQKA 3IP5A 4DQDA 3FCUB 1L4HA 4QGGA 4MUYA 4BEVA 3L05A 1MO3A 1BS1A 1EQ2A 4DYVA 4P0TA 3E05A 4RYLA 5CK4A 4QPNA 1A95A 4QJ4A 3LMKA 2WJGA 5B2ZA 1GZ3A 1AKEA 4ZDJA 1NZFA 2AG8A 3DW3X 5I4IA 2FPUA 1EK0A 1ZCFA 2VSXA 3T95A 4LOHA 1JEJA 3C43A 3K0HA 2P5SA 2GJ8A 1KYQA 3RKUA 4IIVA 2X7XA 3WMGA 2PQ0A 1OGIA 2XQKA 3QX7A 4C76A 4R2LA 4IXMA 1XPOA 2CBGA 5JASA 4M38A 4ALMA 1QOZA 3REQA 5J4VA 4BTEA 1X19A 1B7GO 5DWDA 5ALFA 5B57C 1LVHA 4RD6A 5GGYA 1U7XA 2UZ4A 3RYIB 1CZUA 3K1AA 4EFLA 2VTBB 1OWPA 4D6PA 2FKAA 1KIMA 3ASUA 3EIHA 3L8HA 3V5NA 4UUOA 5A3VA 5HKKD 3MWLA 1RZUA 5K0JA 1Q7EA 2RFLA 2A3NA 2QAGA 3ZU4A 2HV9A 5BYJA 3QEAZ 2RB4A 3IE1A 1E5VA 3AOEA 2P3SA 3X44A 1DXYA 4ZEOA 3L7DA 4FNOA 3SKVA 2YYYA 2DTEA 3CXRA 3EQ8A 3I05A 2C4NA 1X7WA 3HDVA 1WABA 3MJDA 2OHOA 3UKJA 1HH4A 3GUHA 4YV0A 3GLVA 3JQDA 1PT6A 3HJAA 4ZDWA 4AYWA 1OBFO 4GP9A 4W5OA 1JDSA 4LRTB 1WVMA 4GBED 3CMMA 4GI2A 5EMLA 3HYRA 1I2BA 3UUGA 3JQ8B 4TLCA 3IT0A 2QPTA 3G2LA 2VYFA 3LUKA 2ZQ5A 3UXMA 1XROA 3G88A 3ELUA 5GVRA 3ET5A 5CDYA 1DKUA 2Y3IA 3BXOA 2I29A 1OXXK 3O5AA 1DFHA 2WJJA 4UEJA 5INTA 4REQB 2XZTA 3HWSA 1G1MA 2B7LA 3VNBA 3F97A 2RGGA 3LF1A 3N2LA 3TI9A 4DLVA 3KPJA 1ECJA 1YI0A 1E3DA 1BN6A 2P9EA 1VKHA 4REMA 4O8ZA 5J4KA 1PG5A 1UT5A 1GGMA 5KQMA 1ZQ1A 3CE6A 1EWQA 4N76A 5TRTA 1PQWA 3CUEF 2I4LA 3H8JA 3A4YA 4X8OA 3AY3A 5EAIA 3QX8A 3A9UA 2ZT5A 3CISA 3JD1A 3NC1C 4JUIA 4DPKA 4LMBA 2GVNA 1EX1A 1IONA 3KYBA 3V34A 3SIPA 1RWVA 2KLBA 2VF7A 3GLFE 2C9ZA 2Y4OA 1PV2A 4EUNA 5AW6A 4AKIA 5DLEA 2P6OA 4EY6A 4HJRA 3OZAA 1Z12A 4XGQA 2EXXA 2GBLC 1NI4A 3GUZA 3ZDDA 4U2BA 2GEUA 4PR3A 4XOIA 4Z4HA 1SXJE 4YRQA 2D13A 4NARA 2WQ7A 4MUKA 4OUDB 1E8NA 3LDFA 1QRAA 4ZCTA 2VPWA 3R5KA 5C51B 3GUVA 1NUUA 2H2FA 2GTHA 2RK6A 4W1PA 3RBXA 3G2JA 5K2OA 5ELXA 1MJHA 2BFCB 2LIPA 4O4JF 2G3YA 3H4MA 4U4AA 2KW5A 3BK2A 3VSAA 4X93A 1Q84A 2I67A 3L0SA 2A5LA 3QI7A 4ZTBA 4DR6B 4H1TA 3ZGNA 2WKWA 3EG5A 3W5DA 1QQ6A 4BLWA 4F7WA 4YX9A 5FI1B 1J6UA 3EEYA 4YMVA 1O97D 2W2MA 1XDWA 5CVTA 3BRWD 3NKLA 4OIMA 1YAHA 4BWGA 1K06A 1OGYA 4FS8A 4ZAXA 2XVYA 5L95A 3BGVA 3B6JA 3H16A 5DFAA 1E4EB 1QG2A 1UJBA 3BMNA 4CIDA 5LQJA 1OLSB 1IZYA 4IEFB 3TR6A 3HYSA 3SX4A 4F92B 3RRJA 5ICCA 3VNUA 1LBTA 5F52A 3D6VA 2XZPA 3IBFA 3T0IA 3O8NA 4HNQA 3VO8A 5AUNB 1BHJA 2FMXA 5FFMA 1SCJA 1N5LA 2FRDA 5TMBA 3VPGA 3WICA 3E9RA 3GQVA 1UANA 3VNRA 3QF7A 5FNVF 5KNCD 5BOSB 3BWCA 1A5SB 3K9LA 1ZBQA 3H5LA 3DZGA 1YB5A 3N2KA 3L7AA 4BWVA 5CEJA 5EWJA 1T4GA 4K3UA 1XIVA 4RA6A 5FADA 3EPKA 4GIBA 2W90A 3RWOA 3Q11A 3ORSA 1KQFA 3WGZA 2QX8A 3BH7A 2C2HA 3TDKA 3D0OA 1LVUA 3RYHA 5KMGB 8LDHA 2FPGA 2UVQA 5E9WA 3VJLA 5I45A 1JXMA 4ZDKA 5HJ2A 5K01A 2QTNA 4FT4A 3PNQA 1AHIA 1PGQA 3DPSA 4JJ4A 1KR2A 4X1OA 3GHYA 4X5OA 5FOQA 3DUFA 4C89A 4D46A 1Q1ZA 1Q7GA 2W37A 4O2LA 4URYR 1H23A 3EGIA 4R1SA 4G1BA 2WDZA 5AH0A 3GH3A 2YDXA 3UWDA 1XTZA 3KOYA 3DGFC 3OEED 1K1EA 4RPJA 5FYDA 4C07A 1NYTA 1P3Y1 1ZI6A 4IIBA 4TZKA 2W71A 5IVHA 5BR8B 4OAOA 4X7PA 4MW5A 4LJRA 4U02A 2J07A 2XSZA 3NV9A 4OJTA 1GEEA 3HXMA 3WYFA 3IEVA 2O8NA 4MTLA 4ZV7A 1KK2A 1NF8A 3WI7A 1VYVA 1KJ8A 3Q41A 5CVVA 4FHGA 4ZVUA 4DR1B 3EGXB 1WD5A 4YJGB 1XALA 5ALKA 4C7KA 2B99A 3R8CA 4QLBA 4PM4A 1TTQB 3U7GA 2FWRA 3TK1A 1C3OB 3G5TA 3LRTA 2OECA 2RGRA 1I4EB 1R0BA 2DU8A 2QTMA 2ZJYA 4FFRA 3BE5A 2ZIEA 2J87A 3KAJA 3JARA 4CBVA 1KI7A 5IVPA 2DPHA 3TAXA 3GB9A 1SCQA 3EAFA 3PYLA 4MP3A 2WIGA 3THSA 2PA0A 5KI6A 1LY1A 5GVSA 2OOKA 5B7GA 2VP2A 1Z8NA 3PLRA 4YDRA 2Y0DA 4IJVA 5SZKB 1KU0A 4KREA 1N36B 5DW3A 5TV2A 3O4VA 2OORA 1XLTC 3UAOA 2ZU6A 2C03A 1J9ZA 1THTA 5M29A 2GK7A 1Y1KE 3OOYA 1CS0A 1RW4A 4NU0A 2VBCA 3TSYA 3HLYA 1ZD4A 3GL9A 4FOPA 5EN4A 3NHSA 3HKBA 2R96A 2E6KA 1Z7WA 3M6MD 2BHLA 1D04A 4S1NA 2EL7A 2VRCD 4X8MA 3T1VA 2EKPA 1LWOA 1J21A 4DUZB 3S2UA 2IYNA 1RAGA 1SXIA 2BZSA 4FBGA 3BHJA 4HS4A 4EPVA 1XN4A 3LWZA 1JR3D 3D4OA 1A4UA 2V54A 1NFRA 2O05A 4Q12A 3KQLA 5KQRA 1A9YA 1YCHA 5F77A 2Z98A 1P7YA 2FQXA 2GN6A 3NOQA 3TB6A 3G2QA 1DRWA 4GC5A 3KHKA 1P75A 3KYDA 3W6PA 3U3OA 1T1SA 1PR3A 1KJQA 4W9NA 4DCJA 2MSLA 5DX8A 2MIIA 5BNFA 1B74A 3HNPA 4JKYA 4FMDB 4HQLA 4C4SA 5A1TA 1PNQA 2Q6IA 4HRYA 2BIFA 4BP1A 1BO6A 3AIOA 1NDUA 1Y1TA 2ZBEA 1H4SA 4AI6A 1V5IA 2VAVA 4BJ3A 3CNHA 5HPYB 1Q95A 4YJ2F 3RW9A 1WDKA 2VUSA 4RCVA 3IGFA 2JGDB 4MW6A 1N5KA 1VE3A 4B6RA 3M5WA 1EUCA 2ZULA 4JJ7A 4UTRA 4B3GA 4W1SA 1EWKA 4JL5A 5BWOA 2YICA 1DADA 4TS1A 1XMVA 4QFDA 5ER9A 2C97A 5LXTF 3U44B 5EHQA 3VISA 4I4NA 4O5OA 1OH6A 1IEWA 3EZXA 3L7MA 2DFDA 2GKOA 2V59A 4FHFA 4QXPA 1OYOA 4LHZA 3PFBA 1KDOA 4OB8A 4S1PA 4M1SA 1MO4A 2PA3A 5FP0A 5F4ZA 4MLZA 4JVSB 3HVJA 4UTNA 4TTSA 1PR9A 5ECYA 4KFCA 3EEQA 4D4JA 2R6DA 2XT6A 5K3SA 4X0EA 2AK3A 2A9JA 1OTYA 3H18A 1RIFA 1Y9JA 4PANA 1OX6A 1RRPA 2BFAA 2R4QA 4WLNA 2VDJA 1V26A 1X39A 2ACEA 3TB4A 1KQNA 5FDFA 1NQTA 1E69A 2GCNA 5DZSA 3H2BA 5KTKA 3IULA 4BDTA 1ZP6A 1A69A 4UCXA 2P68A 2A1UA 2BFNA 3BBPA 3ELWA 3FE2A 3HB7A 5EPEA 2X5XA 2PVSA 3E82A 5AFSA 1D0VA 1RQRA 2R5WA 4TV8B 5SICE 2QRJA 2YCBA 1C3LA 4HAWA 1PJTA 1M0EA 1DTWB 1NXTA 3LUHA 1F0PA 1FSSA 4JQCA 4NYJR 4QTTB 4EVSA 4YDQA 3R74A 2JPDA 3RUFA 4M89A 4ZKEA 1B0ZA 3A25A 1MAHA 4UTPA 3JAKA 4QOIA 4QRDA 3L6RA 5KAMA 1JQBA 2XGGA 4J7CA 4BP9A 3BXXA 1XMPA 2AEEA 4DCCA 3ESXA 2XITA 1PEAA 4CFYA 3A0RB 3P97A 4UE3S 1EFLA 3A7DA 5EEGA 3D4NA 3Q40A 3SSOA 5AW2A 3IDOA 4LS3A 5F9HA 2RHCA 2PLAA 5BW8A 2WJVA 1C0IA 1GAWA 1HFJA 1D2AA 5HK8A 2C7GA 2AMYA 2Y2VA 2J6IA 1WMBA 5AHKA 3WLNA 4LGCA 1ABFA 2WKPA 3RYCB 2X3UA 4F3YA 3UJ9A 1GNSA 1NA5A 4FC6A 5JTUA 1K89A 2ZWMA 3IFSA 3AF0A 2WVAA 3DKIA 1IWBB 2ZSIA 3UANA 3UFBA 1GQRA 2R1VA 3OQ6A 4EA9A 1N2EA 5AI6A 3O8QB 3EPRA 5LUBA 4NCIA 3ROGA 3ZE1B 2FXIA 2JEYA 2RI0A 4XD7A 1AKTA 2YV5A 3HCFA 2AFHA 1O6FA 4W5JA 1NUQA 1XF1A 4LWOA 1O6ZA 2E49A 5AK3A 5IT4A 3PHGA 1ADYA 1PT8A 1MJ5A 1P9LA 1U8ZA 2FUCA 1VXOA 2RG1A 4B73A 1N6IA 4EF5A 5BSFA 2OV1A 5I01A 3LUBA 1IN6A 3PXEA 3R0VA 4AQ7A 2AC4A 1H85A 1JR2A 1XCLA 1U4SA 1UUFA 2PKRA 3LZDA 4FKZA 4U9UA 2QD1A 5LD2B 3DOOA 1XP5A 2XE7A 4F6CA 4MS1A 1KE2A 5CNIA 3GQBB 4RL6A 4RTJA 4BZXA 2N3ZA 1NHWA 1WXIA 1ZMRA 2EHDA 1WS6A 2JAOA 1J8VA 3X1MA 2UYCA 4B9EA 1ZU4A 2XNDD 1OI3A 3ICWA 4TUYF 1O4WA 4TXLA 2H4YA 4MIKA 2V4MA 3NDIA 3PFFA 3B2NA 3CF2A 3N05A 4RPKA 3V32A 3RG8A 5FO0A 1P7PA 1H65A 2XB9A 3I9JA 2FF5A 4URVR 4G4SO 5DCUA 4PLVA 2XI4A 3U49A 1PQPA 2WD7B 2VTKA 3LX8A 3RTBA 1U7PA 1P5RA 3ANSA 2FW6A 4D92A 4CXMA 4QPCA 4BBJA 1SEVA 4IDOA 5CJPA 3Q8MA 1PVOA 2P9TA 3OZRA 3R9XA 5EIBD 5KSWB 4F5YA 3VSEA 4FBMA 2QUJA 1N7GA 2X22A 5DBFA 4ZKDA 4IOLA 4O5AA 4LG1A 3WZLA 3EE6A 4O2BA 3NU1A 5KQSA 2P7HA 2YJ6A 3OEHA 4YMIA 1NU8A 2CV2A 2PUGA 3ROTA 2YQZA 4J2OA 2XUKA 1UP7A 2J3MA 2O14A 3GF4A 4G8DA 4KPYA 4NENA 1EUDA 4J1QA 1GYQA 4FDTA 4ENWA 3IL2A 1JHQA 1GL6A 3L0IB 4PWYA 2ETVA 2P2CA 2WIDA 4P7GA 2G5PA 2X76A 1K4MA 2WILA 4HLNA 5EIXA 1HQDA 2NZJA 3GFPA 4LSMA 1PK9A 5EUBA 3RE1A