4EJSA

Structure of yeast elongator subcomplex elp456
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
301
structure length
223
Chain Sequence
GLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRIRNGDTHVIVLSLNQMFAKELPGIYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPMTEFLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongator complex protein 4
publication title Crystal structure of elongator subcomplex Elp4-6
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 62
structure length 223
sequence length 301
ec nomenclature
pdb deposition date 2012-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ejsA00
3VR4A 3ZDQA 2PMDA 4D6PA 2JATA 4QC2A 5KPDA 1FUUA 5AUQA 821PA 4B32A 2YOHA 1RRFA 2GXUA 2I1QA 1S4QA 3TIFA 3I5XA 3SDZA 2A5DA 1Z6AA 1A4RA 2J0VA 5DLQC 1XEWY 2REOA 4X8LA 1S9DA 2JLUA 3L43A 4IDHA 4US2R 4QJ3A 5HE8A 3KKPA 3AKCA 4E5UA 4MKGA 4Y0VA 2PT5A 4F7WA 1G16A 5JS7A 3AKYA 3E1SA 2CE7A 4FMDF 2CCKA 3CBQA 1KIMA 2O0HA 1T9HA 3IILA 4FMDB 2YC2C 5FR2A 3V9PA 2OXRA 2OZEA 3C7KA 1G17A 1UJ2A 4PQYA 4ARZA 1WMSA 4HLUC 1Z0FA 1RJ9B 1JR6A 2YZ2A 1FQJA 1HV8A 1IN5A 4A8JB 3CNNA 2AKAB 5AJVB 3WYAA 4NYJR 2ZUCA 1A1VA 1M7BA 4P31A 2WSSA 1E9BA 1AK2A 3EC2A 2AFHE 2G6BA 4OQFA 3GFTA 4WBSA 3H86A 4ASUA 3T35A 2ZXUA 1E1RA 1QBKC 3P1JA 2BBSA 2GNOA 5DI9A 3TMKA 2J87A 3AKDA 4W9MC 3DKVA 3SFZA 2H18A 2QM8A 1LY1A 3CPHA 3F3YA 4OK6A 4ZKEA 2Z4RA 3OZXA 1F60A 1AS2A 2WHXA 2H7VA 1IY2A 3VAAA 3CO5A 3FTQA 4B73A 2JDIA 2O8FB 1KY3A 1ZCBA 5EUQB 2ANCA 1JNYA 2J7PD 3CUEF 2QE7D 2VHQA 3ZVRA 2IS4A 2PZEA 2EU8A 2ZE5A 3IHWA 3LQRA 3L0IB 2WICA 4B3GA 1ZMXA 3THWA 2H16A 2ZRGA 3QF7A 1NJGA 1E96A 2OV2A 2ZROA 4KFTA 4M0LA 4ZDIA 3BRWD 2DWQA 2CL7X 4Q1AA 4OYHA 4GDFA 3CH4B 4Q00A 1C9KA 1LW7A 3AF1A 2FH5B 2QQEA 3GEIA 2WWHA 1CRPA 1GVNB 3C8UA 3GCGA 1G8HA 4K46A 3RYTC 3VX4A 2OXCA 3EPKA 3C5HA 3W5JA 4CF7A 1GKIA 3EAQA 4Q1BA 1Z83A 2DFLA 4M53A 5E3HA 1CULC 4Y0AA 4DCSA 3K70B 2GXSA 3ONWA 1E2EA 2NOAA 4EPVA 2XAUA 3BWDD 2C77A 4EPWA 2CXXA 4D0GA 4HYYA 3T5GA 1GSIA 1NKSA 121PA 2J45A 1Q21A 2QPAA 4D25A 1FX0A 4MYUA 3BH7A 3QSYA 2AN9A 4MDEA 1NBMD 1YR6A 1E69A 3O8BA 3EZ6A 5G3YA 4C0SA 5CITA 4QFMA 1VDZA 3ZS9A 1YR7A 3EZ2A 3FMPB 3DO6A 2GF9A 3KJIA 3L0PA 2FN4A 2OFOA 2ZS8A 4A0GA 3LX8A 1VG9B 1ZAKA 2QAJA 4MGZR 3TBKA 5GADl 2Q6TA 1V5WA 2F6RA 2IT1A 4Q66C 4UXIA 4EKDA 4JSYA 2PLFA 4CGZA 2I1VB 1IOZA 3IBGA 1UFQA 3WP0A 4FMCF 1JXMA 2GZHA 4XD7D 421PA 1ZM3A 4MKFA 1AN0A 1IXSB 3TW8B 1E98A 1GKUB 2HXSA 2A2ZA 3I8XA 5F3WB 3U4QA 1X1SA 3B85A 3DKPA 3F8TA 4LYAA 3PQCA 1M7GA 2ZJ8A 5JFGA 2ZR0A 1IY0A 1KI3A 1QHXA 4TT3A 1Q22A 4C2UA 2RB4A 3LBIA 3B6EA 1NY5A 2QGNA 5DI3A 3RS0A 4DRZA 1PZNA 5AR1A 3B1ZA 4KVGA 1RRCA 4PTLA 1KO4A 4V0OA 3TSOA 4YQFA 1JEDA 2ZRNA 1E99A 4OHXA 1ZM2A 3CIOA 3T5DA 5EE1A 2ZRJA 3QJYA 1KI1A 2G83A 5BWMA 3R8CA 2A30A 4M8NE 4LC1A 2ODNA 2FGJA 2GHIA 1DO2A 3Q7QA 3Q5DA 2PMKA 3I72A 5FI0B 2GILA 1HA3A 3AV0B 3OESA 1ZIOA 2ZUBA 5TY0A 5A4JA 2GWHA 1LS1A 4NYIR 3AKEA 4QGFA 4TLEA 2XB2A 4KFSA 2MSEB 4Q19A 1R2QA 3KX2A 2OFWA 4JZKA 2ZJYA 4OQXA 5KDDA 2I3BA 4QHTA 5LD2B 2CK3A 5KSYA 1I2DA 1G291 3IIMA 1FP7A 3V4RA 2XTZA 2HLDD 1R8QA 2F7SA 3SU8A 3L2OB 1YR8A 4BZQA 3ZIAD 1KO8A 2PEZA 1TPZA 3ZS8A 4ZV4A 2VEDA 3KFXA 2CLSA 2X77A 1IBRA 3CW2A 4HI0E 2ZE8A 3ZVNA 1GITA 3EXAA 2IW3A 2Z0MA 2BV3A 1RJ9A 4R7ZA 2PEYA 1M34E 4F4IA 2RGGA 2ZJBA 1T8TA 3GJ8A 8OHMA 4GP6A 3U6BA 3F5FA 3QE0A 4P3YA 3RRNA 5FTJA 4BUJA 3DM5A 1GIAA 1COWD 2AKYA 1NMZA 5K8LA 2VP6A 3P4XA 3WYGA 5KNBA 4Z51A 5JEDA 1CBUA 3HU2A 1CRQA 1R0WA 4NH0A 1FPMA 1TL7C 1SHKA 2REBA 4L9WA 4LJ5A 5E7MA 3TK1A 3GFOA 4Z54A 1VKJA 2BIFA 3VKGA 1I4TD 1RFLA 3FMIA 3NH6A 1JECA 2FFBA 1G8FA 1XX6A 2ZR7A 4XWOA 1D8TA 5EP4A 3FGNA 2WWXA 2F43B 5A5GA 2B8WA 4LRWA 2EFDB 2WWIA 5AJXA 1HE1C 1NVXQ 3TQFA 2IS2A 1OXXK 1P60A 5KPJA 5CYOA 3R7WA 3SJBA 3W6NA 2D74A 3NC1C 3O8DA 1XD8A 1W44A 1VG8A 1XF9A 2NGRA 4I99A 4PHTA 5BN3A 4II7A 2C95A 3KQHA 5EP3A 4KLNA 4IDPA 4XOIA 3SJAA 2RGBA 3GFPA 2QMEA 3HYRA 5HTKA 4HUQA 4BLRA 4NTZA 3T15A 4HDQB 4C7OB 3EPJA 1WB9A 1E2IA 3ADCA 4AYXA 1A2KC 4TL6A 2Q0HA 3KKMA 1NN0A 2NZ8A 3QG5A 5TMPA 1VYTA 4DVGA 1QHYA 1BS1A 4LJ8A 1UEIA 2JCSA 2PX3A 3WNCA 4L5BA 2GEUA 2V8OA 3K0SA 1US8B 2IYYA 1YZGA 4QL3A 4MYCA 2JLSA 1G5RA 1JPNA 3A1WA 1S3GA 2ZAMA 3GLHB 3AP2A 3BH6A 1GL6A 1BMFD 3GJ7A 4PO1A 3C5CA 1E1RD 1MV5A 3DHWC 3R9IA 4EJSA 1CLUA 2C9CA 1OXTA 2ZSBA 4HB2A 2OBMA 1TUEA 5G41A 4D4LA 1Q1EA 5M04A 1N6NA 4PPGA 1P62B 4NCJA 4CEHA 4E09A 1EWQA 2QPTA 3T61A 4P4SB 4URZR 5DN6D 3ZH9B 1KYIA 4LJ9A 1E9EA 3SC3A 2KI5A 2GJ9A 3G5UA 5DGXA 1G1MA 4C0LA 3OIYA 5LB4A 1YE8A 1NN5A 3AUYA 3B82A 2XNSA 1C1YA 2QY9A 4KYIB 2FF7A 4PO9A 1IN4A 4FCWA 4KHZA 4ESHA 1G7SA 4FMCB 1QHSA 1E4VA 1E6CA 2JGNA 3VNUA 2EFEB 4QKQA 3WHLA 4RD3A 3B9QA 3HPQA 3AM1A 3QVUA 1W4BA 3CR7A 2OLKA 3THXB 2WJYA 4AI6A 1UEJA 4Q02A 5JCPA 3U7FB 1KO5A 2OAQ1 1N5IA 1DADA 4FD2A 1ETUA 2NO6A 1HEIA 4LYFA 4URYR 5B57C 2EYQA 2ZSDA 4MUBA 4PHFA 1VCNA 1E9AA 3VMFA 2V6JA 4EQ6A 1ZC4A 4XWAA 5B58C 2P2LA 2W0MA 2ZU6A 1L8QA 2DWPA 4MRPA 4Q9IA 5LB2A 2PZGA 3FHOA 5KU1A 1LV7A 1R7RA 1L7VC 2X19A 3W8NA 3AVOA 5K8TA 3ZD6A 5DHFA 4Z1MD 1J70A 2ZRCA 3IPYA 1EFHA 1FX0B 1NVVR 4DSNA 4TWZA 1HTWA 2BKUA 4JLVA 4D4MA 2GJ8A 3B1YA 5CIWA 4XVRA 3RRYA 4EFMA 2GA8A 2IX3A 4LUCA 4G5SA 4XIGS 3K70D 1EESA 4D0NA 4JJKA 2IYRA 2C9YA 1CP2A 4DSOA 5JSZB 1D5CA 5F9HA 2JDID 1E2DA 3NXSA 1II9A 1KI2A 3Q3JB 2CHGA 1EFRA 3CF6R 4A6XA 4IDOA 2OFXA 3RS5A 1ZIPA 4DCVA 5IRCD 3J81k 4C0BA 1YU9A 1DS6A 2RKOA 4URXR 1ZNXA 1JPJA 1K5DA 3AVQA 4NE2A 4W7SA 1U8ZA 1RKBA 2R6CA 2WSMA 1Y3AA 1SULA 4O25A 3AEZA 2HCJB 3AVPA 3C4JA 4RZUA 4B34A 4YXWD 3FOZA 1BKDR 5EE5B 4XJXA 1UM8A 2FE4A 1OYWA 6Q21A 1NP6A 4LJ7A 2BBTA 1RRPA 2OE2A 4P4SA 4P32A 4YMVA 2B6HA 1Y63A 2B7BA 3QKRB 3RSOA 3T12A 3PUYA 2JA1A 1JEEA 1R10A 4A0FA 3AVUA 4CDGA 3B1WA 1EFUA 4KO8A 2AL7A 2OLJA 3WMEA 1XXHE 2JLZA 4AKGA 2ZITA 4TN1A 2IYWA 2QM7A 3IO5A 1HURA 3ZZ0A 2XGJA 2ZRDA 4A0HA 1VMAA 3B1VA 3AGPA 3Q8XB 4DLYA 3ECCA 1CJMA 2JLRA 1PLLA 1HT1E 4FCVA 2AD1A 4LWZA 2OCBA 4JLNA 4B6FA 1DAHA 2GJKA 2OAP1 1AM4D 2FZLA 4PSAA 5FUXA 3PXGA 1D2MA 2DHRA 5JHHB 1KO7A 2YWEA 2OUKA 2QTVB 4YDHB 4DB4A 1V43A 1UDWA 4U00A 3A6PC 4HAXA 5AUOB 4BZXA 1A5TA 3B5JA 1RPZA 3W9YA 1M2OB 1SZPA 1VHLA 2RGDA 4PPQA 1N5LA 2PT7A 1Z0DA 1B23P 5AJWA 2V1XA 3DPUA 2QRZA 2IWRA 4OHZA 2NO1A 2Z83A 4ILEA 3IEVA 5H68A 3RC8A 4U5XA 1T5LA 5FBQB 1COWA 4WZAE 2QE7A 2QORA 4G5RA 1GFIA 1E2HA 4M9SA 4C0HA 1N6PA 3BB4A 1Q3TA 2HUPA 4NZYA 3IO3A 1KAGA 4RFVA 1E1QD 5CDFE 4IVPA 1AS0A 3KXKA 2RGCA 3LLUA 2VHTA 1G3MA 4EIWA 1Z63A 3TSWA 2Q3MA 1XD9A 2Q9CA 4L15A 4EPRA 1PV4A 4I1OA 2Q3HA 2UVQA 1TUIA 2ZVQX 4C0JA 1CS4C 2O8DA 4W5JA 4DXAA 1QHNA 4M4SA 4D81A 4LGMA 3MWLA 2AWNA 1OHHD 4JL6A 4PAMA 3CLVA 4TMKA 2C5LA 1E2NA 1K5GA 2WJIA 3LQQA 4WAUA 5JMTA 2F1RA 1G3IA 2QENA 4JLKA 4A8JC 1F2UB 1R8SA 2EWVA 3RNLA 1TMKA 1U0JA 4JL8A 1EFRD 3CRW1 2Q9BA 3QKRA 3VTKA 4FI3C 1XNJA 3TVDA 4DCTA 2YWFA 3GJ3A 1H8HA 4L9SA 1ZRHA 4TMZA 4ERNA 4LBWA 4ACAA 3O8RA 3VKHA 3GLHE 4IW3B 1AZTA 1ZU4A 1X1RA 2VIIA 2JJ2D 3EIEA 4BLTA 4MKHA 3MSXA 5L3RA 1T8UA 5FUVA 4EFLA 2BJWA 3A1TA 2FJUA 1DPFA 3REGA 4DT1A 5AWFC 4ESVA 1U0LA 4JLBA 4DB2A 2AFIE 3U61B 1M74A 5FPSA 2W2VA 1N6HA 2ZI9A 4IRUB 2DYKA 4JIMA 4F4JA 2ZUDA 3QOFA 2HV8A 2ZS9A 4TT3D 1G21E 2XJ9A 4R71A 2NTYC 1XD2A 5JHGB 4A92A 3KXLA 1BH2A 5C2JB 2ZI3A 3VX3A 3U3RA 3U3MA 2GXQA 3JZMA 4Q03A 4V0MA 1OFTA 1P3JA 2RH5A 1SXJB 2BBOA 2YYZA 2P5SA 2RHDA 4XVUA 1SVKA 2QP9X 1UDXA 3N5CA 1W4RA 2BKEA 4R9UC 2WMNB 2BDTA 2IYSA 3OEEA 5KYKA 1VIAA 1HUQA 1KJYA 1NLFA 3KB1A 4B71A 1W4AA 5GJWC 4AIIA 2FA9A 2QZ4A 4R2IA 5DO9A 4CEJB 2FFHA 2HYDA 3U60B 5J5CA 2W83A 4FXPA 2J1LA 3W8RA 1X8JA 2F1IA 3K53A 2FSIA 1FTSA 1T0HB 3CF2A 5EZ6B 4BASA 1SKYE 4HLDA 2Z4SA 1TNDA 1OLOA 4IOKA 4Q4HB 4FCTA 4PPFA 4WXRA 2DWOA 1Z6TA 4G5QA 1MO4A 3Q85A 4TL9A 2ZYWX 4TSFD 1OV4A 4WXPA 4ZCMA 4PC1A 1E2PA 1YKSA 3BFKA 4N3NA 4TYQA 4OHYA 2VSFA 4DLZA 2ATXA 3LNCA 3JZAA 2VL7A 4URVR 1XPUA 5EE9A 2PLRA 4TYNA 5CM8B 3MJRA 4JS0A 3FYHA 1IXZA 1OIWA 1P73A 4PC7A 4N0DA 4Z8XA 2BOVA 4C0AC 1TF5A 2EW1A 2IYQA 4PSVA 1VTKA 5AUNB 2ZSAA 1XMIA 1IQPA 2QAGB 1AQYA 2JIZD 4TTPA 1T5IA 3JVVA 2CEAA 2W2TA 1G18A 1SXJD 4A2PA 4A0RA 1KJWA 1YVDA 2X2EA 2WJVA 2RGAA 4LPSA 1KGDA 4ZDWA 4QXAA 4GL2A 5EZ5A 1E2MA 1U98A 4HATA 1M6NA 2GETA 4IOJA 2VYFA 4C3ZA 1G5TA 1NLZA 2CJWA 3T1QA 1KKLA 2QROA 3DL0A 1Z08A 4I1SA 5KSPA 2ZJOA 4RD2A 3OFND 1KI7A 1N2CE 2FV8A 2EFCB 3FKSD 2KBFA 4IOMA 3EIQA 2ZRFA 3NBXX 3TNFA 3OE7A 2FU5C 2ZI5A 3EPLA 1MO6A 1R0XA 1UBGA 4AYTA 1W2GA 4XTCS 4DDVA 2YOFA 1KSHA 1RVDA 3IQXA 3K0CA 1HH4A 2PJZA 2ZSEA 4Q48A 4A2QA 2CBZA 2JIZA 2QA5A 3FMFA 4Q5IA 2ZU0C 3THWB 2IYZA 3CONA 4CIDA 2F43A 4PQRA 2HT1A 4BRWA 2Q9AA 1JI0A 4CEIB 2JLVA 1Z28A 3K0FB 2O52A 2OCAA 4NYMR 5EXSA 2OCYC 5JRZA 4HAUA 2AXNA 5BXQC 2V7QA 2J7KA 5DISB 3DZ8A 4FMBB 4Q9LA 2QQ0A 1KNXA 2WMOB 1ZD1A 2F3RA 2GZDA 1CJTC 1F2TB 3GLIB 3O8CA 2GVDC 2CJWB 1MRNA 1Z29A 1U9IC 2PH1A 2DCUA 1FNNA 5LD2C 4DLRA 3SYLA 3UWOA 3BAFA 1W49A 3RS2A 5J47A 1UADA 3AVWA 3T34A 5C18A 2FX3A 5FBRB 3OEHA 3WNDA 2ZI7A 3B8HA 2HEIA 4M1KA 4HLQB 2FPKA 5KUTA 2J0QA 5BW8A 3G0HA 3B1XA 1XEXB 4ZCIA 2AX4A 4TZ0A 1HQCA 2ZRHA 2VQSA 4NONA 3BFVA 3GJ5A 3TRFA 1OXVA 1OH7A 4IVQA 2YOGA 3DMDA 2AD5A 2R8RA 1O87A 5EXXA 2GCOB 4MYTA 4JYBA 2V55B 4YMWA 2IBMA 1U8YA 1XTSA 2N46A 3VNVA 3NIBA 4MGKR 4GZMA 2OEPA 2RGXA 1CXZA 3NG1A 3QEOA 4IEEA 5J4KA 1G41A 3NEYA 3KUDA 3I4LA 4URWR 5H70A 3AVVA 1U81A 2GXAA 2F1HA 3BS4A 2NO7A 1OXSC 1RYHA 3W3ZB 3NHAA 4B3XA 2BEKA 1M8PA 2CDNA 3FWYA 4C30A 1E2JA 1KKMA 5FPKA 2BMEA 5JWRA 3MMPA 3K9NA 1EX6A 2R6GA 2VP0A 3JVUA 1ZD8A 3IKJA 3CNLA 4HB0A 2HF8A 5D3QA 5EE3A 4M1SA 3VR5A 1G7RA 1WP9A 1R6BX 3SYKA 1HY3A 3RWOA 1IJEA 1JB1A 3QKTA 1GKYA 4Q1DA 4AG5A 3R8FA 3M4YA 2FEMA 3BD9A 4GP7A 1NMXA 3NH9A 4A4DA 4CEHB 1FL9A 2CCJA 2V54A 2YKGA 3BH0A 1UBCA 1CR2A 1VYVA 4EAQA 2R62A 2UKDA 1XTQA 2B92A 4LPKA 4TTRA 3MWYW 4L16A 4C2TA 2KWIA 2ERYA 2ORIA 3RS7A 4HDCA 2KB0A 2ZI6A 2AWOA 3S1AA 1DAFA 4JKIA 1OHHA 221PA 3SNHA 4BFWA 1TQ2A 2XJ4A 4IXMA 4DLWA 4BFSA 3EW9A 2ATVA 4NDZA 5BQ5A 5LDDC 3CPJB 3GLGB 1TEVA 4RD6A 4Q4HA 1NN3A 2TMKA 1T4GA 3TW4A 4AKEA 2AR7A 5P21A 3OHMA 3RABA 4MDFA 2O8EB 2O5VA 4IDQA 2QN6A 1KMHB 1SKYB 1XZQA 3P32A 2QP4A 3K09A 1OFUX 2VP4A 5IK2D 5SZJA 2WKRA 2GEVA 1NIJA 4ZDKA 4S35A 3WRYC 1OH6A 3IIKA 2NMVA 3CZQA 3AF0A 1GUAA 1ZYUA 1P5ZB 3TE6A 4BZPA 4DKXA 4QM7A 1OB2A 2W6JD 4QGHA 5FR1A 2WJHA 2J5XA 3ZQJA 3DVLA 3H2YA 3KKNA 5HZHA 3PVSA 4AWXA 5DE3A 4KBGA 5G3ZA 3FB4A 1S2MA 4A8JA 3X1XA 4E07A 3K09C 4BFVA 1RZ3A 1XD2B 1P61B 4TYPA 3ZZUA 1Q1BA 4GNKA 3U5ZB 4Q4LA 1JR3E 4JLMA 3UANA 1J2JA 1MOZA 3TJZA 1IN7A 4X8OA 1W1WA 1ZD9A 3PG5A 3LDAA 2QAGA 2D4HA 3N2IA 4O0MA 4Q01A 4Q4AA 3SQWA 5GVRA 4MQBA 1PLJA 3BIFA 4EPXA 2WVJA 1CEEA 4KVAA 4HZUB 1G9XA 5CK5A 4AURA 2QEQA 1KTVA 2IUTA 2R9VA 1KDTA 1JAIA 3H4MA 4S2EA 3WYFA 4FIDA 4G01B 3L0SA 5KOYA 1NVWQ 1PLKA 1P9NA 4HAVA 1NKTA 4BQSA 2XTNA 3X1WA 2XZLA 3EA0A 3VR6A 4K81B 5HR5A 4HZIA 3W3AA 3ADKA 3CM0A 4BLPA 2MSCB 2ZEJA 2V9PA 4RFSB 1VIYA 1NL3A 3FKQA 1DEKA 2C2HA 2VSOA 4I4LA 5FH9A 2VHCA 3UG6A 1N6OA 3EX7C 5FOUA 1XRJA 1VHTA 3KQNA 1OFHA 5JRJA 3KJHA 5FTNA 4MRRA 4GPTA 1E79A 3FFBA 3TH5A 1P2TA 5F9FA 4PAQA 4UJ5A 1DG1G 1KI8A 3DEFA 1FFHA 2W6IA 4PC2A 1UAAA 1II8B 2FDCA 2DB3A 5DHAA 2RGEA 4FINA 1RIFA 1X3SA 1E2QA 3ASYA 2PJRA 1UKVY 1UKEA 2MMCA 1UKZA 3R9XA 2BMFA 5D3MB 3A8TA 5SZHB 4PC3A 4ZKDA 4UJ3A 3KB2A 4M2LA 1Z22A 4DEXA 3A58B 4TYYA 1JR3D 4MKIA 1Q1ZA 2B21A 1LB1B 4QBIA 1GRNA 1GNPA 3RRMA 1CJUC 2C9OA 4F92B 2HF9A 4ITRC 4E22A 4M21A 4DC9A 2IF0A 2YWHA 3C16C 1ANKA 4TTQA 4BEBA 3LW8A 3REFA 3B2EA 2QGZA 3SBEA 4WW0A 1Z0IA 3LY5A 4AYWA 1TX4B 1YZNA 2H17A 4G3XA 2XNDD 5CJ2A 4F93B 4YMUA 3I32A 5KTYA 2ZRKA 2OESA 2W6ID 3FDIA 5LBIA 1XEFA 2WKQA 2ZRMA 3P27A 1CJVC 1SVSA 4V0ME 4XSHA 4KITB 3AVTA 3EG5A 3ADDA 2D7CA 3I8SA 2K5UA 2GVZC 3EZ9A 4LJ6A 4MRSA 3HDTA 4TLAA 1G64A 3QUSA 3UPUA 1OJLA 5J4LA 1H8HD 4QJ4A 5A0FA 3KTAB 3Q5EA 1XEWX 1J7KA 3K8YA 1EFTA 3VR3A 4DDTA 4OHVA 2BEJA 1M7HA 3KKQA 4ZI3A 1Z6YA 2BM0A 3K0FA 1IN6A 3K1JA 1E0SA 5KDOA 3UKDA 2Q21A 5IT5A 2GK6A 1E9SA 2BMDA 1II0A 2P6NA 1VYUA 1VG0B 4EQ6B 2NO0A 1F2UA 1EG7A 5TXGA 3KQLA 1GL9B 3KUCA 1TTTA 3IBYA 1BYUA 1G8YA 4D80A 3OIWA 2NO9A 3NBYC 4QJ5A 5JWHA 4HEJA 3RLFA 4DCNA 3IDQA 1X8KA 4PFSA 1XMVA 1MH1A 4X8HA 2REXB 3K9LA 3PEUA 5FI1B 1GWNA 5KSOA 1S8FA 5B64A 2QP3A 2BWJA 2P67A 2WWGA 4QBFA 2VBCA 2YWGA 5L3SB 1Z0AA 3PEVA 3TR0A 1NLYA 2IYLD 1WF3A 1ODFA 3LA6A 4LZZA 4CZ2A 4LYJA 2VLIA 3TLXA 2WJGA 3MGCA 4ON9A 1JJVA 2A5FA 1KK3A 3QENA 4JT2A 4PSKA 1K8RA 1DARA 3LWNA 1IHUA 1LTQA 1QVAA 5JZVA 5TVKA 5JS8A 2Z43A 4J0QA 1OB5A 2C03A 3DZDA 2WOJA 1U90A 1ZUIA 1QDEA 1G8GA 2EFGA 2E1RA 3BK7A 4N0EA 5TV2A 5E4FA 3CRMA 1JJ7A 4DIDA 2ZYUX 3LVRE 5DI3B 1F5NA 1NBME 2VP9A 1P6XA 3BGWA 3ZJYA 2X1VA 1PUJA 3I3SR 1MT0A 2AK3A 3UK6A 2WWYA 1EXMA 1OH5A 3C15C 3CX8A 1JAHA 3KKOA 1W46A 2R6DA 4BPBA 1US8A 3NDPA 4XWKA 2H92A 3BE4A 1CIPA 2F1JA 1KSGA 3T1VA 4LHVA 4YDSA 1KAOA 2BVNA 2G88A 4A1FA 4Q9JA 1G7TA 3C41J 1AKEA 2FSFA 2VH5R 3U44B 2ODBA 3KQUA 2NPIA 2O8BA 2A5GA 2G77B 3HR8A 1A7JA 1J99A 2ZRLA 3GD7A 4B76A 1QVRA 1YRAA 3GLFE 4BGDA 2IK8A 3GQBA 1D9XA 3SN6A 4B43A 1TQ6A 2W2XA 3HJNA 4GBMA 1CJKC 2HLDA 1YZTA 4B3CA 3IPXA 3G82C 4Q1EA 2ZRIA 1C4OA 4YXWA 2RHMA 1FMJA 1RRGA 5GVSA 1W36D 2EFHB 3NEJA 3AP1A 4PHGA 4RVCA 2B8TA 1TEXA 4GMDA 4R98A 3UXMA 1HT2E 4B74A 4NCNA 2NQ2C 2LKDA 4DCUA 1OE0A 4EFNA 5KDLA 1NY6A 4JMPA 1XCPA 4UNNA 3SHWA 3Q7PA 1T3LA 2GCNA 4Q4JA 1T0JB 2O8CB 1Z8FA 4V0KA 5FTLA 3EC1A 4MYHA 2ZIAA 4DLUA 2G3YA 4Q47A 5L3SA 1Z5ZA 4AC9A 4B33A 4G0NA 4KU4A 2IEYA 3QKUA 1KK0A 3WXMA 2G0TA 1QRAA 1ZP6A 3NBFA 3AUXA 2CVHA 1GAJA 5CYPA 3MG9A 3HU3A 3VKWA 4DDUA 3SFVA 3QKSA 4L4UA 1KZ7B 4G5GA 5JLJA 2GAOA 2QU8A 4H1VA 4WA7A 2IUUA 5G53C 4DSTA 1KSFX 3AVYA 3WY9A 4JSTA 2VTKA 3X1ZA 3BXZA 4V03A 4U02A 4IJMA 4NYMQ 5FPHA 2GTPA 3TAHA 1TADA 2IYTA 1XEXA 2WAYA 5EXPA 1GTVA 2IC5A 4NPHA 3WRXC 1Q3HA 3PITA 3MWJA 4TQAA 4WOPA 1Q20A 3TAUA 4OQLA 1IONA 2C98A 2G1JA 5SZIA 3AP3A 2C96A 2IEZA 1P72A 1NG1A 3AQ4A 2FPLA 3PIRA 1H8ED 3I62A 3MUFA 1E2FA 4F91B 1HE8B 4IEIA 3VU9A 3DDCA 1TF7A 2FWRA 3IEUA 4C0KA 3PEYA 3QNUA 1YZQA 4R2HA 5FL7D 4NKRA 4B75A 2Y8EA 3TUZC 5EJEA 4A36A 1OIXA 3MJHA 4NCHA 1G4AE 1E4YA 1FTNA 4CRWB 3LFUA 3DOFA 4KCGA 4QHYA 4EDHA 3D31A 3OEHD 4QG7A 3WBJA 4DLXA 4HZUA 2XTMA 3OIVA 4CVNA 5FOTA 2JJ8A 1SVIA 2QNRA 1QHHA 3BC1A 4JLDA 4EJSB 1XMSA 2W0SA 2YC4C 1E2LA 1NVVQ 3UATA 3KXIA 1S1MA 3QF4B 3SBDA 1S96A 3W6PA 3WMFA 1NBMA 4B44A 4U7DA 2QMOA 1EGAA 1VECA 2QAGC 4QNMA 2LCFA 3EPHA 3LX5A 1Q1QA 1N6RA 2ZRPA 3RSLA 3W5IA 5JEEA 4LJ4A 4PZYA 2FZ4A 3UMSA 3NWJA 2FMXA 2QT0A 4KSBA 2GAAA 3BFXA 4KODA 4LBYA 3TGPA 2ONJA 1FZQA 1G3RA 2BC9A 2XNDA 3W90A 3T06B 2KSQA 5FPTA 2GCOA 1R0ZA 1W2HA 1O3YA 2RCNA 1NG9A 1AQUA 4YONB 2ZRBA 4OI0A 4I81A 4RZ2A 3QIAA 4IHQA 5KO2A 4QNRA 1CF4A 4TLBA 2FNAA 2H5EA 3L82B 4JLPA 1ELOA 1ZCAA 4URUR 1YZKA 3LAWA 3PEWA 2FFQA 4MGIR 4DJTA 1RC8A 2LKCA 3PCRB 3TQCA 5AUPB 1E94E 3AF4A 1YJ5A 4NMMA 3EASA 1KO1A 2ZYTX 4D82A 4B3FX 3ZD7A 1CR4A 4L8GA 2EQBA 1E2KA 3R20A 2X2FA 1ZINA 3NDBB 2PX0A 2OSBA 2NZJA 3IQWA 1BYIA 3QXXA 1SKQA 2GBLC 2ORWA 1EFCA 3O47A 5IF9A 2O8DB 2VO1A 3WP1B 1J90A 2HJVA 3K0CC 1KOFA 4QM6A 1KNQA 2IHYA 1OIVA 4KXFB 1U8AA 4ZI2A 3VU9B 3THYB 2XB4A 3I5YA 3NVAA 5DSZA 1TU3A 1WDTA 1ZNYA 5C46F 2VSXA 1N6KA 3KDSE 4TMVA 1T3SA 3LD9A 3N2EA 4LJAA 5JSZA 4OI1A 4ASUD 5C1BA 1ESNA 1N0WA 4UNSA 1GRQA 1PJRA 2GEDA 1F3OA 4P33A 5F98A 4HLCA 3UMFA 1XTRA 1OF1A 4FWIB 4JVSB 4TQ9A 3CRRA 3M1IA 4W5HA 1DVRA 1GILA 3RC3A 1II8A 4ACBA 3FHTA 4P0TA 1VCMA 4TZ6A 3TVTA 1LVGA 4IKEA 1CR0A 4UNRA 2CK3D 4PAOA 1DAKA 1NIPA 4H9GA 1WBBA 4E03A 1ZJ6A 5FL7A 2O8BB 4OI4A 2EYUA 4MA4A 3GLGA 2BM1A 1KMHA 1XWIA 2PCLA 5JI3E 1H8EA 2J41A 4B3BA 3KJEA 4RD0A 1ZNZA 5J4HA 2XZOA 1NRJB 3LV8A 3T1OA 4A6PA 1XFAA 4RZ3A 3VR1A 1W48A 3AVXA 3LBNA 3B9PA 3WMGA 5DNYB 2BBWA 2JLXA 4F4CA 5JBQA 2R6AA 3U7EB 1J8YF 1XPOA 1BOFA 3GJ6A 3H0KA 1S3SA 2H57A 5K8IA 4UXHA 2ZJZA 2VHUA 3EARA 4FW9A 2CHVA 4AK9A 2XOKA 1WRBA 3T1TA 4PANA 4BLOA 2N1BA 5K8UA 2EVWX 1Q57A 4YMSA 5BYKA 1ZVQA 3EZFA 2XZPA 1WBDA 5HPYB 2YNMA 4B2PA 3I73A 3A1UA 4Q1FA 1LF0A 3QG1A 2Z6VA 1UKYA 3SE0A 4ARZB 1E9CA 5HKKA 1IXRC 3LXRA 3A4MA 3HPRA 4DLVA 1P75A 4BFXA 1G6HA 3QXJA 1QHIA 3TUIC 3GLFB 3ZYCA 2JJ2A 3RANA 3U4QB 2JLYA 3OAAA 1KI6A 5GJVC 1I4DD 2GJAA 4QGAA 2DPXA 4MITA 4JLAA 2IYUA 1DAEA 2VF8A 1F6BA 4GFDA 3MFYA 4RKEA 3U2QA 4O2RA 2FEOA 1E3MA 3EA5A 4JVLA 3AH8A 2QSZA 2WPDD 3W34A 4CEIA 1NI3A 4JBYA 5KNDA 2J0UB 4K8OA 2OM2A 2CCGA 1WE2A 3QXSA 3RRZA 2WPDA 1G8PA 4PXAA 1QG2A 1YZUA 5HCIA 2C8VA 4DWJA 3KL4A 5TDHA 4AKIA 4UNPA 2D2EA 1A82A 2FPMA 2IXGA 2HDNB 2XEXA 4EPYA 4AKHA 1N6IA 3V4FA 4OHWA 3QY0A 5IHPA 3PJRA 3GPLA 3A1SA 1G20E 3NBZC 4LHZA 1XB2A 3NKVA 3SQXA 4HB4A 2ZE7A 4ZCLA 2R44A 1Z2AA 3WNBA 5CLQA 3QVVA 1KJZA 4ZPXA 2OT3B 3SI7A 3GP8A 1I2MA 3AGQA 1AA9A 4GOJA 5C4GB 1NNEA 4DLSA 2CL6X 2OO7A 3DM9B 5GJBA 2DY1A 3L8ZA 2WWWA 5JJIA 1TQ4A 4TYWA 2ZAOA 1E1QA 2O8CA 2FOLA 1MO5A 2YINC 2AHOA 3KFVA 3SOPA 1XTJA 5JWOA 5SZKB 2ONKA 3THOA 1SXJE 4TL7A 4HB3A 3ZVLA 3CH5A 3CWZA 3FKSA 1JR3A 4IDNA 2HT6A 4TL8A 2F55A 2V3CC 4TLCA 3PFIA 2WJJA 3HWSA 1T3HA 5CB6A 3K0AB 5HCNA 3QPUA 4DUGD 1LS6A 4HDOB 2JJ1A 1EK0A 3DOEA 4P4TA 2UZIR 1IY1A 2ZANA 4BFTA 4DBLC 4JT4A 3OF5A 1ONBA 4MRVA 5CIQA 1HYQA 1I4LD 1L4YA 3CNOA 4WZBE 1GOTA 2O8EA 2ZRAA 1TAGA 1XPRA 4JBXA 5EUMA 2D3WA 1SXJC 4RD4A 1W5SA 4G1UC 2GBLA 1N25A 2CLDX 4RKFA 4AY2A 1G3QA 2V4ZA 2EWWA 2QL6A 2P65A 1G3UA 2OBLA 4BLQA 5ANRB 2O8FA 2R2AA 1OPXA 3PUZA 1CR1A 3FMOB 2SHKA 3V00A 2Q3FA 2OG2A 4M9XA 3H1TA 3SJZA 1KI6B 2IYVA 1XXHB 2NG1A 4LV5B 2P5TB 4TLDA 3GLFA 1X86B 4LYHA 2XITA 4FN5A 4HAYA 3QXHA 1AJEA 3SJCA 2BHRA 2PZFA 1P2VA 4Q21A 1S0UA 4Q9KA 5B2ZA 4EPTA 1MABB 5BYJA 1T91A 2OILA 4PR0A 1GG2A 1Z47A 5L3VA 1Z0KA 4GI7A 2BJVA 1VCIA 4B2IA 1XU4A 2C04A 4Q9HA 2FFAA 3ZZTA 5HE9A 3N70A 4PZZA 1ZM4A 4LCBA 4GZLA 2QMHA 1DTSA 3K9GA 1R4AA 4NP6A 3QPVA 5FOWA 1GNRA 3PUWA 2E87A 3CRVA 2ANBA 3U44A 1Q44A 2I4IA 5AJYA 1F2TA 2A78A 3U3OA 3GLIA 3GLHA 4RJLA 1S1CA 4TMTA 4DT1B 1DO0A 3FPAA 2H1LA 3R9WA 4LHYA 1CTQA 3NTUA 4KAXA 5JECA 1KI4A 2ZYVX 3KZ1E 3HP1A 2P6UA 3P26A 2RMKA 1AS3A 4HUQB 1GP2A 2KE5A 3D3QA 1SQ5A 3K0AA 1NSTA 5HZKA 2ODWA 1ZM9A 4BFZA 2CLCX 1K6MA 2RGNC 4FWTA 1VPLA 3PENA 1YR9A 1Z6GA 1R5NA 4JVNA 4N1AA 4P4UA 1SVOA 2NIPA 4LV6A 4IFEA 3ASZA 1KK1A 4PPNA 3OIUA 2IA5A 5FOXA 2A3RA 2CNWA 2J9RA 1ZC3A 3RHFA 1DAGA 3BORA 4LK2A 3CZPA 4UQOA 5AJZA 1U99A 3RVBA 3CKLA 3CX7A 3LXXA 4XD7A 4RCYA 3SR0A 4DIEA 3X1DA 2FSHA 3HYTA 2P6RA 5JCZA 1KY2A 1MO3A 4V02A 2YJTD 1OH8A 1DAIA 2VA8A 2O0KA 4OQNA 1W4CA 1XTKA 4TMXA 1M1YE 1KDPA 1HQYE 2G0NA 4GRAA 4D2IA 3LH5A 4HAZA 1AZSC 4Q4JB 4DZZA 4JVMA 1P2SA 1VG1A 2Z5FA 3AF2A 4Q7JB 1GL7A 2FGKA 3LO5A 4RCZA 2WM9B 5CK4A 1GZSA 5EE0A 1CU1A 4GT1A 4NYJQ 1LFDB 5FTKA 3IGFA 1KZGB 3EWSA 5C4MA 2JLQA 2C99A 1MR3F 3VHXA 4BLSA 4B2LA 1R0YA 2ERXA 2MMGA 4KJZA 1XZPA 3B60A 4D4JA 4DEYA 1WCV1 3ZLJA 3WHKA 5KHOC 4I1VA 4A9AA 3KQKA 4QOSA 2D7DA 1NF3A 5GJCA 2QTFA 1GNQA 3M6AA 3R7WB 4C9BA 2OHFA 2HYIC 2IHBA 1N5JA 4I1UA 1LNZA 4OJQA 2WIAA 3E2IA 1OSNA 1G4UR 1KMQA 4ZDJA 3GJ0A 3S1AB 1ZM7A 1TF2A 2X8AA 2V6IA 1EWRA 4G5OA 5IDVA 1EX7A 4BEJA 3U7GA 1W5TA 1OKKD 4LBZA 3CR8A 3K0EA 4BFYA 1SXJA 1NN1A 4RSGA 1LF5A 4QHSA 4IVRA 2VPPA 4B6EA 3BBPA 5FTMA 1D9ZA 2F9LA 1KDRA 5FBWB 2FSGA 3TSZA 1Q0UA 3BB3A 2DFKB 4C0QC 2IS6A 1W47A 3GEEA 2IWHA 1W36C 4OBEA 4F38A 5DYIA 2PL3A 3I92A 1P4SA 5E7IA 3X1YA 4V0LA 1OXUA 3B78A 2ZPTX 2J59A 1G7CA 5FFMA 1X6VA 2ZREA 3P4YA 2J0SA 2YV5A 1IM2A 1MABA 4GMXA 3NHBA 4X8MA 2A7QA 2JASA 1SHZA 2WBLC 2QSYA 1TQDA 2GRJA 4B47A 3SHFA 5J40A 2WIBA 5G40A 5EP2A 3A37A 4Z8YA 2KJQA 2AXPA 1SGWA 2V7QD 4A2WA 4BFUA 2YHSA 5BN5A 1XJ0A 1F48A 2WSSD 1P9WA 2AK2A 2ZQ5A 4A15A 3TUJC 1YQTA 4C7OA 4DHEA 2ZI4A 2J46A 4JBWA 3IUYA 2G9NA 1IJFA 1MKYA 1Z0JA 4PHHA 3PV0A 1G5PA 4HSEA 3H84A 1AIPA 1H65A 2XSZA 4LV8B 4NCIA 721PA 2F3TA 3LBHA 2WTUA 3QKSB 2BCGY 2RAPA 4Q7MB 3MD0A 1AKYA 3MWKA 2ZS7A 1OKKA 3ND9A 2A5JA 3SZRA 1ZUNB 4D4KA 3VHLB 3D8BA 3CB4A 3A1VA 1BO6A 3BOSA 4IXNA 2GDJA 4PC6A 3MRSA 5CB8A 1WXQA 4JJZA 4Z1MA 5CJPA 1QZXA 5L3QB 2J3EA 1YRBA 4M1YA 5TB5A 3THXA 4QRHA 4QGGA 3F0TA 2VP5A 3P20A 1R5BA 3CPEA 5J4VA 4LDJA 2QRNA 1SVLA 5IK2A 2QUZA 1DE0A 2RGNA 2PBRA 1FQKA 1UBFA 5TARA 1E0KA 3PR1A 1SVMA 3QXCA 1D6JA 1UPTA 1W0KA 4BRUA 5LPNA 4PZLA 4KLZA 4W5WA 4OK5A 4Q18A 1Z07A 4EUNA 1JQLB 4TQUS 1DELA 3ZVMA 1XDBA 1JQJC 4OJKA 3GLIE 1P9RA 5ELXA 4B35A 2ORVA 1G6OA 2HJGA 4GOXA 1G19A 2N42A 1UF9A 4Q1CA 4HLUA 4M1MA 1XJQA 2WKPA 5CM9C 4LJYA 4EJSC 3Q72A 5D3MA 1SVWA 4LSGA 3HR7A 2GCPA 1NJFA 1XCGB 3EWAA 4O2LA 2WV9A 1U2RA 3TKLA 4D0LB 3ZGXA 2ASEA 4LY6A 4O3MA 1RW4A 3SYNA 3VQTA 4Q7KA 4KV9A 3FE2A 2KBEA 3CX6A 4IFBA 1X8LA 1Z2CA 4QBHA 4YC7A 4JYCA 4NYIQ 2OCPA 4IOLA 3WBKA 2ZJ2A 4MH0R 3UWKA 2GJSA 3E5HA 4HUTA 3GJ4A 4YMTA 2ZE6A 3OEED 4M1TA 1T6NA 2MSDB 2D2FA 5J4YA 4ABYA 4TMWA 2WOOA 5H8WA 4CEJA 2W00A 4LC0A 4M22A 5HKKD 3CRQA 2IXEA 3I61A 5DH9A 4NCKA 3NC0C 1KHTA 4C4PA 4PQFA 2QI9C 3D6TB 3U3JA 1FW6A 521PA 4CT5A 4OI2A 1ZW6A 4XSGA 5FUYA 2DR3A 2QBYA 3GJXC 5CDFA 2ZSFA 3OE7D 1E9RA 1UBEA 5EP1A 4UNQA 2CL0X 4PO8A 1NSFA 5KNCA 1L2TA 3QBVA 4M1OA 2A5YB 3OFNA 2ECKA 3FHCB 3CF0A 3MCAA 1E2GA 4D26A 2IS1A 2QPOA 1OYYA 2D06A 1JBKA 2CHQA 2DBYA 2ZETA 3ETLA 2B7CA 4M9QA 1E0AA 1GDDA 3BERA 4LHXA 3FVQA 1JALA 2FG5A 5H1YA 1XBTA 1P7CA 1XTIA 4LOAA 3RS4A 3SEAA 4QBGB 2VP2A 2D62A 1FNMA 5L3QA 2LWIA 3GMTA 3ND8A 1NVUQ 2DFNA 3W6OA 3AB3A 1W36B 2QG6A 2R65A 1DBSA 2ZJ5A 1D2EA 1QF9A 3C14C 3BJIC 2UZ3A 3QQ5A 2VF7A 3B13B 1E9FA 1Q12A 2J7PA 5F2EA 1XJCA 3RS3A 2JLWA 1RE0A 2PCJA 3UIEA 2XSZD 2HXYA 2WAXA 3I1FA 1FUKA 2GESA 3SS8A 1XMJA 5L8VA 2J0UA 3IHLA 4RD1A 1E79D 4OK3A 5EQTA 1QG4A 1WQ1R 1PUIA 1Z06A 4XTRA 4POAA 3VR2A 2NPFA 2F9MA 2IUSA 4OKSA 1YZLA 4OQMA 1ESMA 3RDPA 3K70C 2QTHA 1DG3A 4KBFA 2XXAA 3A4NA 2GKSA 3TR5A 5FL3A 5FBLB 4CT4B 2CMKA 1KDOA 1OT3A 2R6FA 4M1WA 3ZIAA 1QHGA 4MRNA 1N0VC 3ZQ6A 2GZAA 2L0XA 3LLMA 1U94A 2OBNA 1B0UA 1MRSA 3PUXA 4JLJA 1N6LA 1WA5A 1XP8A 3THYA 1TU4A 1N3BA 1VCOA 5DYGA 1PVOA 5JJLA 3X2SA 4KFRA 4M9ZA 4US1R 1U0HC 2IF2A 2ZJAA 1ZU5A 4CYMA 4YLGA 1AGPA 4NBSA 2VRWA 3U6KA 2YVUA 4A82A 5FOVA 4Q4AB 4WIAA 5FPYA 5JI2E 3L0OA 2QMUA 1Z3IX 4ZIRA 3DMNA 2ZM5A 2A9KA 2QBYB 4CW7A 2JJ1D 1DOAA 3K9HA 4MUAA 3BB1A 4DUGA 2W6JA 1IN8A 2CE2X 4XH9B 3RAPR 1DAMA 2ZTSA 4H1UA 1YHNA 4RZXA 4LHWA 2XX3A 3Q9LA 1GM5A 2DFTA 4DLTA 4LX0A 5JJKA 1BIFA 1GRRA 3UMRA 1W7AA 5E7JA 1W0JA 2ZR9A 2H8KA 4US0R 1D2NA 2JAQA 4XVQA 621PA 2ZVPX 1U9IA 1A2BA 1NMYA 3GEHA 4B48A 4AG6A 1IAQA 4RFSA 1KSJA 1RYFA 5FOSA 3MLEA 3FFAA 3U7HB 3EIHA 1CKEA 2HCBA 4DDWA 3MAAC 1AGRA 5FBVB 2P0EA 1N0UA 3HU1A 2WZQA 3UG7A 3L8YA 4ZIRB 1OFIA 1R5OA 4LI0A 2IXFA 4RY2A 1J8MF 2IYXA 1ZBDA 5E95A 2VHJA 5KSZA 4JLOA 1ZNWA 1QHHB 1FOEB 2GK7A 3E70C 4TSFA 1N5KA 3AF3A 3CWQA 1KI9A 3QF4A 2V1UA 1OW3B 3EZ7A 2BCJQ 3KJGA 5UKDA 1KK2A 4GSYA 3IIJA 4PX9A 3ADBA 5DN6A 4GOKA 4LBVA 5DIFA 4UXJA 4WZ6A 4KSCA 3PUVA 4DSUA 5AK0A 4BE7B 4BWYA 1E9DA 2E9SA 3ICQB 4NL4H 3VFDA 1FP6A 1XCMA 1JXOA 1ZUHA 4ZO4A 3U3KA 1E32A 4JL5A 2XXAB 1BMFA 2ODEA 1XXHA 3D7MA 4HAWA 5BN4A 2C78A 3LVQE 5B30A 3QPWA 3QBTA 4KI0A 1L4UA 1P2UA 2BMJA 4V0NA 2WWFA 3OAAD 2IL1A 2JEOA 1E0JA 2CNWD 4Q7LA 3LRPA 2QT1A 4B3DA 2GF0A 3ICEA 2G1KA 1FMLA 3A36A 4KYUA 5FUWA 1W0KD 3M0EA 4NHOA 2CVFA 4NU0A 3B7GA 4WVFA 2W58A 4BECA 4KFUA 1S9HA 4OL0A 1W0JD 3QI2A 5CLLA 3GLGE 2P3SA 3A4LA 2XOKD 3KTAA 4AD8A 1Z6XA 3LW7A 5EXTA 2O0JA 4MGYR 3QEJA 4JKYA 3RWMB 4UKDA
chains in the Genus database with same CATH superfamily
3UTDA 3VR4A 2FPGA 3KZNA 3DZIA 3F46A 2JATA 3ITNA 4J0DA 4HRYA 4QC2A 3FNQA 4D6PA 3ZZMA 4OQ4A 2YOHA 1IU9A 1M2WA 2I1QA 3OPYB 4PPYA 4R9RA 5AHXA 4YWJA 3EXFB 5KZMB 1QBGA 4IFIA 1XQXA 3MAJA 5DLQC 2REOA 4ILKA 4X8LA 1S9DA 1SCUB 3JQPA 2GO1A 4ZT2A 2JLUA 2X3YA 4QJ3A 2FKNA 3KKPA 1NXTA 4E5UA 2O6HA 5JS7A 2PT5A 3WL5A 3K5IA 3E1SA 3NTLA 2H8GA 2CCKA 1KIMA 2O0HA 1T9HA 3M83A 3N05A 3V9PA 4K9RA 2OXRA 2IDZA 3C7KA 1G17A 4PQYA 2IV7A 3DAYA 1PR6A 4ARZA 3LP5A 5CB4B 1T4CB 3GVHA 3AY6A 1RJ9B 1H9CA 1WWKA 4IGAA 3UCFA 3C39A 4L76A 4M86A 1MMFB 3YASA 4WKNA 3CNNA 2AKAB 2QNBA 4WD3A 3WYAA 4JI8B 4TKUB 4F9EA 2JGMA 1XQYA 4JITA 3NP9A 1FTWA 4P31A 2WSSA 2ADFA 4DIKA 4YB8A 1TE2A 2N3ZA 3H86A 4NV0A 1KAQA 2G1PA 4Y18A 3HCWA 1JU9A 1QBKC 3BK2A 3G1WA 4HSGA 1Y5RA 4D9HA 1PJ3A 2GNOA 5A4FS 5KJFA 2BZ1A 3R3SA 5EQJB 2X9VA 3T5BA 3AKDA 4KQWA 3L0BA 5CXSA 2EEZA 1J33A 2H18A 1LY1A 3QU9A 4HDSA 2GZSA 1DX6A 2C9ZA 3BX1A 4M7PA 5J59A 5BWCA 2R8XA 3CW8X 4JGIA 4CNQA 2H7VA 3IAEA 3VAAA 1EGVB 1K4KA 3CO5A 5HGXA 4X62B 2RH4A 3A10A 5DOVA 4AUEA 1KY3A 2O8FB 5IWAB 3JYLA 2G4CA 3ENVA 2QE7D 2VHQA 2XPCA 4I9HA 4M7RA 3RJZA 4WX2B 3ZVRA 3ZCTA 1SELA 2PZEA 1Y8RA 2EU8A 3KSZO 4EHDA 1GU1A 1LTHR 3LQRA 5JTUA 3D8TA 3TLEA 4QWWA 3L8DA 2MR5A 4B7AA 1ISFA 3QF7A 2OD9A 4AJNA 2A0YA 5GOTA 1E96A 4M0LA 4B7XA 2OGZA 3BRWD 4DWVA 2WA1A 4C1NA 5DNUA 5B2FA 2CL7X 1FXUA 4PRZA 2VCHA 3H9GA 3SIXA 4ZVTA 2NWQA 2HPZA 3H04A 3ND5A 4RIIA 1RLJA 3LQFA 5HUHA 4A2CA 5I4IA 2B1GA 3LUKA 4IWXA 1CRPA 2JAPA 3GCGA 3U4CA 1ECGA 2ZJ0A 2VXYA 4K46A 5DBEX 3VX4A 7MDHA 1QANA 3W4KA 1VSTA 3TD9A 5IAOA 2XE8A 1CQJB 1JYEA 4YH1A 1NT4A 5AJUA 4UAUA 1VRWA 3E9QA 3I09A 3TLYA 4CF7A 2VTVA 4GLOA 2HFJA 1P9OA 4UFNA 4D57A 4M53A 1T1JA 1QTIA 1H6AA 4Y0AA 1XKTA 2VG8A 5L6MB 3K70B 2WSYB 1E2EA 3H5VA 4EPVA 2XAUA 4ECEA 2C77A 2ROQA 2CXXA 4MX8A 4D0GA 4EPWA 4HGNA 1HRDA 1N8TA 3TMYA 2WTMA 1UFRA 1AB6A 1DCTA 1OJ7A 4D25A 3B6ZA 5ILOA 1Q5PA 2PT9A 1W30A 3UPDA 4MYUA 1KPHA 3BH7A 1U3GA 2HMUA 4MWTA 5BNZA 1MRZA 1OYOA 2AZDA 4FFNA 4YREA 2Q1YA 3D0RA 3WZMA 2HA6A 1SZDA 3A9RA 2J9ZB 4MPDA 3B8EA 3KZOA 4RPHA 1PV2A 3OWOA 3VI4B 2CMDA 4MYSA 2D1YA 3DO6A 2B99A 3AEXA 2GF9A 3KSRA 2VJQA 4RX1A 1TZ2A 1BROA 2X5XA 2P9EA 4JELA 1X2EA 2FPPA 3OZGA 1VG9B 3TBKA 3QU2A 1N2CB 2BCEA 1CFJA 4EKDA 2PLFA 4UHEA 4QRIA 4AUNA 4HGOA 3MS2A 3V7FA 5LL6P 1SKBA 2D8AA 9ATCA 2PWYA 2A1UA 4FMCF 4NZZA 5D6NA 4Z0HO 421PA 4DC1A 1MGOA 5JPCA 4S0XA 3TW8B 4HFMA 4WJLA 4ZCRA 2A2ZA 3CC8A 1C7QA 2Q7OE 2D5IA 1XZCA 1E1MA 3AHGA 4KN9S 4UNNA 3FVWA 5F3RA 3T5AA 1FFYA 2FRXA 1X1SA 2QYOA 3ESXA 4ZHQB 1XNQB 1FFCA 1T24A 4YPOA 3PQCA 3BHMA 4ANFA 5JFGA 4JC8A 1L4KA 3EJ6A 1PGNA 1F51E 4Z2YA 1XYVA 2J5KA 5CEEA 1KU6A 5K6AC 2QGNA 1C0LA 2GN0A 4TWJA 3RS0A 2YQZA 1HC7A 4DRZA 3TVYA 5ADWA 5HUJA 1IUNA 1PZNA 5AR1A 2OHXA 2ZB4A 1VA5A 1S2LA 3RB8A 1KIFA 8AT1A 4GPD1 4BBZA 1NI4B 1RLTA 2ZRNA 4KDRA 5FCDA 4OHXA 4FWTA 3E53A 1U5BB 1ISIA 3TIXB 5JXIA 5EC8A 3IP1A 4HJXA 3OI7A 1DTEA 2FETA 4PLVA 3QJYA 3BQNB 3WGUA 3EGCA 4RS3A 2B8JA 3I30X 2G72A 1TJNA 3AEYA 5DNVA 1I3MA 2ODNA 3MOIA 5KNDH 2GHIA 3M6UA 1DO2A 1Y4DE 3Q5DA 3Q7QA 5ARBA 5KNCH 3OJ0A 1TM4E 2PMKA 3I72A 3ZX4A 1NQVA 5FI0B 5C51B 1JG7A 2FQXA 3I53A 3GMSA 1H2FA 1TFUA 2ZWVA 3QU5A 4IZHA 4R9NA 2XEDA 4BJ3A 1JLLB 4RA9A 4UE2A 3OESA 1UFVA 2E5FA 5A4JA 1YZFA 1T6YA 3IXMA 4HQNA 4JR2A 3TZBA 3U4HA 3AKEA 3V42A 5FWXB 2E4ZA 4QGFA 4K6OA 3PXDA 3TDKA 2XB2A 3ZI7A 4HX2A 4MV9A 5E2IA 1QWOA 2I3BA 2NM0A 5K1ZA 4C22A 4WLOA 2OYRA 3TQOA 1I2DA 1V48A 5TPZA 2RBEA 1CIJA 1G291 5B1SA 3CYFA 3V4RA 1R8QA 3BPSA 2H63A 2SBTA 3IVRA 1M6VA 5A62A 3WFJA 2W4QA 3B7WA 3SJ7A 4BZQA 4ZV4A 3ZS8A 4KH1A 1YI1A 1V16A 3KFXA 5CCDA 4C20A 3EGIA 2IXAA 2ZE8A 4HI0E 5B58T 2PSDA 5ERGB 4EA7A 2IW3A 1VE3A 5K20A 1E3WA 1P2FA 2XYQA 3IS3A 1I4EB 5AVOA 3RK4A 1IE3A 2VC2B 3EE6A 4HFRA 4D3FA 4F4IA 3GJ8A 4E30A 1YS7A 1WPRA 3F5FA 2XDWA 3EDMA 4PCLA 3TBFA 1Y42X 3H5WA 1H93A 3DCIA 2VOJA 1ECCA 1NMZA 4AJIA 5ECDA 5TMBA 2A58A 3KAQA 3P4XA 1KMCA 1J7JA 5ALLA 1L5LA 2XTAA 2Z5VA 2HJWA 5JEDA 2I3AA 5HUQA 5IMBA 1CRQA 1KEPA 1R0WA 4U3JA 2REBA 1TL7C 4MUXA 1FSZA 4Q39A 5HF9A 1N9KA 3S68A 3GFOA 5CFNA 1VKJA 2BIFA 3RO7A 5GIPE 1BQ4A 1WJGA 3NH6A 2F1OA 1JECA 2HLPA 2XUOA 3SHVA 1G8FA 2PVCA 4H4EA 3BHJA 3PQ3A 3CLUD 1D8TA 1LBEA 4H3VA 5EP4A 4B6SA 4C4TA 3MGGA 5IYZA 2B8WA 4LRWA 1QRDA 4IJKA 1QOQB 5AJXA 5DRYA 1ZH6A 2A9PA 3TQFA 1OXXK 1ZAYA 1G2OA 1P1KA 5KPJA 1E66A 4NBRA 3R7WA 1I7QB 4X6UA 2BFFA 1MW8X 3E3LA 4JODA 1CQXA 1XD8A 5TJ9A 1FDTA 1W44A 3QYJA 4K3UA 4PHTA 3G1TA 5BN3A 2GM5A 4II7A 4LE2A 5EP3A 1KFCB 1QO9A 3I83A 3HFGA 4ZYYA 1L5MA 3AHDA 4UU8A 4HC4A 3VNQA 2CZGA 5KWSA 4C7OB 5T4FA 1VJCA 5C7YA 2YZMA 2QGFA 3NBKA 1T25A 3QVWA 4CI9A 5FWXA 4F12A 1A2KC 5FEMA 1DIAA 2EKZA 4QYMA 3STVA 2AUTA 5JY1A 2IH2A 1ENZA 3QFRA 4EF4A 1VYTA 2WU3A 2H6EA 5F1PA 4UUNA 2YFKA 5IX8A 2AOTA 1BS1A 5ED0A 4D43A 4DSZA 3JW8A 1Q0HA 3V8VA 2DKFA 1IXYA 2XA1A 3EIXA 4E4TA 1UEIA 3WNCA 2ZUEA 4L5BA 2YS7A 2ZKLA 2QN8A 1SVNA 1ZL2A 1NR7A 3WL4A 1DTWA 1YZGA 2IYYA 1GPJA 4QL3A 1C1HA 1HSZA 2C1ZA 1JPNA 3A1WA 3ZKAA 1SM4A 1U2GA 2AW3A 2ZAMA 1ATIA 3JV7A 2ATIA 1GL6A 2PSJA 2A35A 2I4TA 4J1SA 4PO1A 4UATA 5DK6A 2GLUA 4XYBA 3WHPA 5DWDA 4N5NA 1MP0A 4D98A 4EG5A 4B6OA 4RKYA 3MJCA 2OBMA 5LBUA 1Q1EA 4D4LA 1JEOA 1P62B 2JI9A 1EWQA 4R51A 4P4SB 4INAA 4OJTA 3SC3A 4CQJA 1NBHA 1SO8A 5AVWA 1STOA 4C0LA 5BUCA 2H4HA 2PS3A 3M9WA 3HO8A 3T7DA 4CKEB 3DBRA 1I3OA 1YE8A 3RVLA 3U4IA 2XMQA 3R3ZA 3B82A 1Z7GA 4HQOA 2J9YB 3Q88A 5K4GA 2QY9A 4Y2SA 5CBPB 4HDKA 2QLJA 4RPGA 3KYCB 1IEVA 3OPVA 3FSRA 1H4SA 2HW8A 1XP5A 1TK3A 1G7SA 4WCFA 1QHSA 1SIWA 1JW9B 1PGPA 3BGOS 1PJBA 2EFEB 3CEMA 3Q3HA 3W2FA 4BZWA 1KZ1A 3WHLA 4QKQA 2HA5A 3BL5A 3CZ4A 3HPQA 1TKBA 2BFPA 1V9CA 1Q1GA 2YNMD 3L92A 4BO6A 1W4BA 2OLKA 3ZJYA 2WJYA 2XWQA 4YCMA 4AI6A 4I36A 3U7FB 1V6SA 3BCSA 3PE6A 2ZYGA 3JQGB 4UUQA 3GZ4A 5F1YA 3B9BA 4FD2A 5HOEA 2XRYA 2W6OA 4WXYB 4LYFA 1I0IA 4ZK2A 5LNK1 1FNSA 3ACCA 3R0VA 4LY3A 1QE5A 1AKQA 2EYQA 2HHAA 2X6TA 4WXMA 2AFHB 2GFQA 4L5AA 1VCNA 2C0QA 2QQFA 3G85A 1JLHA 3NHSA 4F6CA 1RT9A 2I2BA 2O20A 5JH7B 2V6JA 4CR7A 4XWAA 3VJLA 3ZYZA 4EITA 3LJKA 4L4ZA 1YKFA 1GKKA 2ZU6A 1L8QA 3JVEA 1QDUA 2F8MA 5TIIA 5C31A 1Y7PA 1RRMA 2UDPA 4V39A 2CVOA 3J7AC 2VNSA 3W8NA 4PHCA 3VJKA 4RF3A 1J70A 5KTNA 1GRCA 4TWZA 3R5XA 3KHSA 3OLVA 3ZY4A 1DX9A 3BJRA 4OLJA 3NCHA 1T3GA 4ND2A 4H7PA 2KYRA 4D0NA 4JJKA 4GE3A 5CG1A 3I9KA 1BEZA 4OXKA 1L6IA 2WT8A 4TXHA 3KWJA 3D1LA 2VJYA 1EH5A 1IULA 4DMGA 3KZXA 5IRCD 3DDWA 2ID4A 2RKOA 1DS6A 3ENZA 2O2JA 3ZWYA 1JPJA 1K5DA 3GGCA 4LXUA 4G6ZA 3LKVA 1Z4NA 4NE2A 4W7SA 5GONA 4YQEA 3CUUA 2R6CA 1L7EA 1FW8A 3GVPA 3UBTA 5F2OA 4A26A 3PQ2A 1SJ9A 4B34A 1IDN1 4F84A 1AMOA 1JQ5A 5DZSA 4YXWD 4HDMA 3SXPA 3TXXA 5BNTA 6AT1A 3ZBPA 1BCSB 1U3DA 4DBVO 4N3AA 4QDKA 1E20A 2PRKA 2B6HA 3AHFA 3HFRA 4MVJM 4YRPA 3UV3A 2WM3A 4BVKA 3RSOA 1VJ0A 2JA1A 1JEEA 2BD0A 2FYTA 2PRZA 4WNIA 4A0FA 2HKIA 4JB3A 4YO8A 1FFEA 1U3FA 1UC9A 3B1WA 1JPUA 3VU3A 1LRKA 3WMEA 2BONA 4BMNA 1OR8A 3VNRA 4Z2AA 1LC3A 1P1BA 3T7AA 3BWCA 3VO2A 3HUUA 4AKGA 3SR4A 1SBZA 3A31A 1GGNA 1CF2O 1I5OA 2ZRDA 4A0HA 5A02A 3CLRC 3B1VA 4REQB 3Q8XB 4LGYA 1CJMA 5HDQA 1F8YA 2WIDA 2Y3IA 3KTOA 4P5PA 1HT1E 4FCVA 3C3XA 3ZI4A 1XLTC 1VM6A 5K3OA 3FIUA 4OGKA 4ZCPA 3ONNA 2JFVA 2GJKA 1BDMA 4IIYA 1QCDA 4I4TF 10MHA 2XQJA 2FZLA 1D2MA 2DHRA 3B3QA 4GVLA 4OAQA 5DTRA 2FMUA 2P6MA 2OUKA 2V7BA 2XGMA 2QTVB 3K73O 1JI3A 3P0HA 2XT9A 4BP8A 1RAFA 1T8PA 1UDWA 3QE2A 4PQEA 4HAXA 5D5PA 4Z3OA 3EF3A 4PCUA 2YXLA 5L7YA 1C8LA 2PKWA 1DBIA 2YS6A 1XDWA 1VE9A 2ORYA 4XLLA 3DPUA 1RKQA 2QRZA 4G8BA 3ZDDA 2QTNA 2IH4A 1H9BA 4WZAE 4LDAA 3D8UA 2XVAA 3JD1A 3HVKA 1E2HA 1ZI8A 3IERA 1QIKA 4M9SA 4OBBA 1V41E 4BVGA 3BB4A 2O57A 3KP1A 2XWPA 5CGZA 3VSCA 4RFVA 1DDIA 4EJ0A 3LLCA 1I8TA 3RFUA 2CXNA 3KXKA 3LLUA 3GZTB 1G8SA 2A0WA 2BSQA 1W6RA 1M10A 1SCUA 1H94A 4DYDA 4EPRA 1PV4A 2IYNA 4K8RB 2IUYA 4CL8A 4ALMA 5ESDA 3NW9A 2UVQA 1TUIA 2DG2A 1JIVA 4O2BF 2NVWA 4PZPA 2G6TA 3TOCA 3PPWA 2PIDA 3HTXA 5CPFA 1OHHD 2O7VA 4JL6A 1V8BA 4TMKA 3ZTYA 4DAOA 2OR3A 4OP2A 3VNAA 2Q5IA 4M36A 2Z30A 4QQNA 4NWIA 2QENA 3RBZA 2BEVB 4JLKA 3UHJA 2EWVA 1TMKA 1U0JA 5JW6A 5YASA 1KL7A 3DLBA 3GLVA 5J9FA 1Z15A 5G1PA 1FVHA 2Q9BA 3MJSA 4BLWA 2EZ4A 3EGEA 4M3NA 3OJXA 3OU6A 3CW9A 1E77A 4DCTA 3TQIA 4LY9A 3K2BA 3CTPA 3L0CA 2JFPA 3VKHA 1KP2A 4MCAA 3QJGA 3USZA 2VQ3A 4IW3B 3WNVA 1C3EA 3QWHA 4BMOB 4CT0A 2YZGA 2WUFA 3KLBA 4BNYA 2Q5OA 1NVFA 4KWIA 2PGAA 4EYEA 1MVNA 4N47A 4BVBA 1C7RA 2OD2A 1SB9A 2BJWA 3A1TA 2JVKA 1CY7A 3LSYA 4V0QA 4KO1S 5ALOA 3REGA 3HXTA 4OAOA 1CW2B 3JQ7B 4U5QA 4ESVA 2GM3A 2DSTA 4YALA 4KNYA 5EIHA 4DB2A 1PR2A 1U0NA 3U61B 3KCNA 4IO0A 2ZI9A 2B36A 4MEJA 5EXDA 3RASA 3KJZA 1N92A 4MI3A 4F4JA 2ZS9A 4QFCA 3UA4A 1BDJA 1J06A 1G21E 3WGJA 3WB0A 4C0XA 1W5AA 1XD2A 5JHGB 4LWQA 3CO0S 3DF7A 4HEA1 5C2JB 4RAQA 4RMJA 2P75A 4A8TA 2W2LD 5IVPA 2O7SA 3JXEA 2BBOA 3KSUA 2P5SA 1X1DA 3DWIA 5AW5A 1QJ4A 1KE1A 4OHBA 3H65A 3TS1A 4XVUA 4UDXX 4N6NA 1T1GA 4PLTA 2V7UA 5EHZA 1G5HA 1ZY2A 4CN8A 5LJIA 1W4RA 1YSCA 2BKEA 2FWIA 1SCIA 3F49S 5A4KA 2AN4A 4UM9B 1P0FA 2XXBA 5C8XA 5K3CA 1VIAA 1UC4B 2I9KA 4ZAFA 2QVXX 3KB1A 1OBVA 1TGVA 4AIIA 4C78A 2FA9A 1C2YA 3K5HA 1L1FA 3WJ7A 1Z25A 2YV4A 5I48A 5ISMA 4HEHA 1EWTA 1KPIA 3ISTA 3KM0A 3W8RA 2YL2A 1OWLA 2F1IA 3K53A 1ODIA 2XOEA 3CF2A 3IMKA 5EZ6B 3WGYA 1SKYE 1TKAA 2Z4SA 3LF1A 4UCXA 1QF7A 4FCTA 5M34A 1EB9A 1RAEA 1Z6TA 1M5RA 1GPAA 5G0TA 4E94A 2DHCA 2YZKA 4O1MA 4P34A 2HPVA 2J6BA 2J32A 2JFOA 4TL9A 4TSFD 1CD5A 2CXHA 4WXPA 3RT7A 1VI6A 3BGDA 1MQSA 2R1TB 3A6DA 1U6JA 3BQ9A 4PC1A 1J5XA 4N3NA 4TYQA 5TQ2A 4ENVA 2VSFA 4DLZA 4OHYA 2ATXA 1EK6A 1V4VA 3STTA 2E7ZA 4A5OA 4BO5A 4TZTA 4HTFA 4PICA 3C3DA 4RY9A 3MJRA 3EGXB 1LLFA 4BPRA 4N3CA 3K6SB 1OIWA 5KB3A 5I9TA 1Z6PA 2Q1UA 4KVZA 4ZQIA 4MIKA 1OYVA 1MDBA 2AG5A 4NOJA 4Z8XA 4P4LA 2HQBA 1P29A 4AKSA 4O59O 3PNLA 4RSMA 3UYLA 4PSVA 5AUNB 5BRNA 5LLSA 3OSZA 2PGDA 1EJ6A 1XMIA 2F9FA 5LSAA 2GI4A 3SF0A 3CMCO 3L18A 1Y34E 2CN1A 5F7OA 1SA0B 3SDSA 1JXAA 2WJVA 1Y4SA 2RGAA 5E8JA 1KGDA 4ZDWA 4KVFA 4GC9A 4LRTB 2CLEB 5EZ5A 2YJ6A 1YTLA 3PCTA 3VPGA 2WC1A 3X1JA 2RHJA 1DAPA 4C3ZA 1KTIA 4DRXA 2GCGA 4JLSA 4UHHA 2OXFA 3DL0A 2YY6A 3FHLA 4I1SA 4TLMB 3OETA 1BDIA 3PXUA 3JVIA 2KBFA 1N2GA 4HWPA 4R8MA 3G79A 1EK2A 5KYGA 2IUFA 2OWEA 5FKJA 2FU5C 1CJSA 1RYEA 2AR0A 4D45A 5BVHA 2JAUA 3SJUA 3OPYA 4UNIA 6REQA 1K8YB 3LI2A 3S5JA 3I01M 1MOSA 3IQXA 3K0CA 5F73A 4HNUA 2GZ2A 2JIZA 3TRIA 1CRWG 1V0JA 2ZU0C 4FHCA 4QDOA 5JTTA 3CONA 1ONPA 5HJ5A 3DULA 1ZQ1A 4M87A 1LPMA 2A3NA 2C5HA 1JI0A 2GGSA 4FYVA 1Z28A 5E6SA 4BRWA 1EM8B 2P30A 4NYMR 5EXSA 4YPFA 4ED9A 2GERA 3D4LA 5EOVA 1WZUA 5JRZA 2B1IA 2AXNA 4TUYF 5BXQC 2M1XA 4JZYA 1NJ6A 5DU2A 3V6MA 2QQ0A 1LC0A 2CLFB 3FZEA 3OM8A 4LTNA 1Y6JA 2F3RA 2PWBA 2JAOA 1OWNA 2H1RA 1K9SA 2XVYA 2XR1A 5HIJA 4DRXB 2HIMA 1Z29A 4TVBA 3PFWO 3NS7A 3OKFA 4RE5A 2VH2A 3V1NA 1T3TA 1FNNA 2JAWA 3E9YA 1BWRA 3CF4A 4RDCA 3D3WB 2QU7A 5AH0A 3UWOA 3VC2A 3KRTA 1N2HA 1W49A 1WV0A 1UADA 3NX4A 2XRZA 4UMDA 3S4YA 3VOSA 3AVWA 5AVJA 5C18A 2OHJA 1UJCA 1G2IA 3B8HA 2GCEA 3CG0A 4QUBA 1WXWA 3QYAA 5E2BA 4CCYA 4ID3A 2Y67A 4R5HA 2Q1WA 5BOVA 2WZCA 2Z08A 2X9LA 3GRRA 4BO1A 4DJ5X 1HK7A 3B1XA 4Q3NA 4AULA 1XEXB 2VOEA 4OP3A 3PX3A 3S28A 4QT4A 3GWGA 4HNVA 3BUSA 1B00A 3SP1A 4J43A 5JASA 2VQSA 3TRFA 2WYHA 3H5IA 4YECA 1AH2A 2BAGA 2YOGA 2GH1A 4V2UA 3ZWPA 3OZ7A 2HSWA 1MTOA 4MYTA 2UVPA 1B41A 4JYBA 2V55B 3OM9A 2IBMA 4FK8A 4D9KA 3CWCA 1SBNE 5DT9A 5KNCD 4Y6OA 4GZMA 2QX4A 3AXSA 5EIXA 4EM6A 2OENG 4YACA 3QEOA 2XWJI 3NG1A 3M49A 1HDZA 1AO0A 2DUMA 5JYBA 1A9PA 1QYWA 1J24A 4BCDA 4LGVA 2GXAA 2EG5A 4OX9Y 3U48A 1N8KA 2C7GA 2NO7A 1XZFA 3SQMA 1OXSC 4OVKA 4B3XA 1IWPB 2WHPA 2OVBA 2DR0A 4C30A 5AW3A 2PS0A 1U4SA 3FUWA 4UW9A 3BZUA 3HSYA 4JC5A 4MVJE 3KQSA 2O5RA 1Q11A 2Y99A 3LFTA 2VYND 3HJGA 2FW9A 3T41A 3WKEA 5TS3A 1V6AA 1ZD8A 2W71A 4ND6A 4HB0A 3ZEIA 4A8HA 2RGRA 1YWGO 4JBGA 1V3TA 2JFHA 3EGDA 2MTBA 3DEIA 1CUJA 5EJIA 4DIFA 2QL5A 2CXOA 1C7JA 1NW4A 3TLGB 1HY3A 1P4AA 1J2TA 1LSOA 1KQOA 1P77A 3QKTA 4IY1A 1P2DA 1W85A 3E82A 1A8PA 3MC1A 3VPFA 3GCDA 4HXEB 4WK0B 3UICA 3IDZA 5NLLA 4X6YA 7REQB 1NMXA 1R6AA 4LF8B 2G9ZA 1FL9A 2YKGA 1T36B 2EW8A 1CR2A 1JR2A 1RBMA 3EGXA 1SUSA 2KQUA 4ZT5A 3WLQA 3DSRA 5ICMA 4L16A 3IB3A 3VNSA 2IY9A 3PSHA 5DM60 5K2MA 3D8HA 4N0PA 3W7VA 5LZ2A 1V8FA 4WFIA 4HDCA 2KB0A 3ZCUA 2NU6B 2AWOA 4G56A 5ICCA 3AETA 1S4MA 1DAFA 4MWGA 3S1AA 3FXAA 3K1AA 4ZZIA 2FXVA 2XJ4A 1PHRA 3EW9A 2X3UA 5LDDC 4M89A 2VKTA 3GLGB 2BRUA 4ND4A 3V7WA 1T4GA 3OHMA 1Q15A 2XYHA 2QRGA 4IZ6A 4FYWA 3TCKA 3AWIA 3PL1A 4HS9A 5JQGA 4MDFA 3S3TA 1NR1A 2UVPB 1KC1A 5LUAA 4PZUA 2BFBB 2O3SA 4RJKA 5I4CA 2BUBA 1KAHA 3WMRA 4IF6A 2XCLA 4CGYA 1OOEA 1NIJA 1UM9A 2PGNA 4ZDKA 1QDLB 3WRYC 1FP1D 2HWUA 2GPAA 2B98A 4RL4A 4R1OA 2BE9A 4C14A 4E4RA 2R00C 2D5CA 2NO4A 3IQFA 3WRWA 1NWHA 1NRIA 3ONFA 3OZFA 2D0IA 5CEJA 3QV1A 3IJEB 4O8ZA 1KZ6A 3H2YA 1MC8A 5HZHA 5DYYA 4BX8A 9GPBA 2BHSA 4LSWA 4AWXA 1AKWA 4DCCA 3F5SA 1X74A 4YCCA 2QNIA 4A8JA 2P9BA 3WNQA 4E07A 4QM6A 4DILA 3LE8A 5AW0A 4BNTA 1XD2B 2HNAA 4TYPA 3UQZA 1Q1BA 1R1DA 3ZZUA 1ENOA 1KFBB 2AN5A 4MKZA 2QXTA 3U5ZB 1JR3E 4NATA 3HBLA 2XVXA 1J2JA 3TJZA 1IN7A 1TZBA 5HQTA 2INGX 2IKSA 2HGZA 3RIHA 2QAGA 5EMNA 2C88A 4LKOA 4BGIA 4KB5A 1H05A 1XAIA 3N2IA 3O2QB 2RI1A 1L7NA 4V0RA 4BMXA 2W6ZA 1CZUA 3A7EA 3FPEA 1W19A 2NT3A 1TIKA 2NU9B 4MB0A 1G9XA 4AJLA 3JQAA 2I71A 4BC1A 2HZ7A 7YASA 2R9VA 3MT7A 3IUEA 4QGBA 3H4MA 3OTHA 3WYFA 5A5FA 1J5EB 3M33A 3L0SA 2E37A 1TMOA 1HFKA 1NKTA 3IR7A 3JSXA 1FS6A 5DNWA 4NEQA 1D2GA 2H1IA 2ID7A 3UYKA 5FDFA 2WYIA 2HMSA 1M8GA 5KOHA 1JP7A 4RC9A 1NL3A 1BHJA 1J97A 3FKQA 1AKVA 1KA9H 2CDAA 4LCEA 3LCCA 2D6FA 4M83A 4R2XA 3VAZA 3GC6A 1R4MA 5AHRA 1DWUA 3EX7C 3OT4A 3QX3A 3D5QA 3KJHA 5BV7A 3PDCA 4MRRA 2M6KA 4RK6A 5AW2A 1YAHA 2FW7A 3RSZA 2O59A 2VTBB 4G4JA 4CLEA 2CNOA 2C54A 4M55A 4QUEA 3TH5A 2H2FA 1P2TA 2Y2UA 3S8EA 3ICCA 3FLMA 2BFEB 3SC2B 1LPNA 4G0YA 5HTOA 3RRBA 1KI8A 1R4NA 1N3YA 3CKYA 4RKRA 5LQAA 5LU8A 3ERCA 4PC2A 1II8B 3HKBA 3GVXA 1C1XA 3I0MA 5EYPA 1UJ6A 1UZMA 4FINA 2YJNA 4FYJA 4FDAA 1E2QA 3FVVA 1F38A 1UKVY 2MMCA 3G0BA 4LZOA 1YCHA 5AKYA 3KOWA 1NXWA 4J07A 5D3MB 3A6LA 1Z22A 2Q2VA 3VR0A 1JR3D 1QZTA 4QTUB 2CV1A 1ZJYA 3IYLW 1NNLA 2AI3A 3FG9A 1D4FA 1GT6A 2A57A 3UOAB 3WHIA 5KWVA 2R3SA 2AOVA 3H8VA 4HBGA 4IIBA 3U31A 2O2DA 4DC9A 3F1KA 3C16C 1U8TA 2XUPA 4GE0A 3WTBA 4BEBA 5LOVA 1EFPB 3QBDA 3REFA 3W1WA 2GLTA 2QGZA 3X0DA 1XLVA 4WW0A 1AZLA 1E1YA 1WX1A 1Z0IA 3DWFA 4AYWA 2FPSA 1PJ4A 4J75A 1YZNA 1MOQA 3WB1A 2WLTA 4UE6A 4DUYB 1Y89A 1B1AA 2IZ0A 3RKUA 2XNDD 1ZOSA 4JROA 4KR0A 1RS0A 1QS0B 1BTOA 1P2BA 2XKBA 3CLSD 3KDAA 1E8DA 2HRCA 3D3WA 5F2KA 3SYMA 4BU0A 5CT4A 4ITUA 3K94A 4YJ2A 1J09A 1QKJA 3V1LA 5JZSA 2WKQA 1PWEA 1Z74A 3E03A 1CJVC 4RO0A 4XSHA 3SXUA 4KITB 3HK2A 2RGUA 1U8FO 3N6RA 2BSAA 2GVZC 4FOTA 4LJ6A 4DV3B 4MRSA 3ZD9A 1YD7A 4TLAA 3TFQA 5LQKA 1OJLA 4HS4A 4QJ4A 5A0FA 3TW8A 3KTAB 5DULA 1EFDN 2G5PA 4YNBA 1NA5A 4RH0A 4LZNA 4ZI3A 2BM0A 4PXSA 4NXNB 1IN6A 4KFCA 3K1JA 1E0SA 3AFNA 5BVGA 1E9SA 3KVYA 5C9ZA 2P6NA 3HJFA 3KLNA 1VG0B 2BISA 4B4OA 3DD5A 3M6WA 3HRHA 2IXTA 3FIJA 1YL5A 2V9CA 1EG7A 4JEMA 1JHAA 3BWEA 1TA4A 2OCDA 4ISBA 5B4TA 1TTTA 5DTIA 4RPLA 3IBYA 1Z56C 4MP8A 1FJ2A 3JATB 3WK5A 3U1BA 1F0PA 1T1IA 1ST3A 4RTPA 3RJ9A 2YXNA 5DX8A 3Q9UA 3FOAA 4PFSA 1XMVA 4X8HA 1JG3A 3R0QA 5KSOA 5B64A 3NTQA 4TTJA 5K0SA 2R84A 2WWGA 4QBFA 3RYIB 2Z8XA 2VBCA 3CQ9A 4J4HA 4EBBA 5E8RA 2H4FA 5LXTA 2ZSKA 3PEVA 4XGNA 1MV8A 1WF3A 4FYMA 5CYFA 4YJGA 1OQAA 3TLXA 4WERA 5T41A 2A5FA 4PSKA 1K8RA 2HRQA 2JBAA 4MMZB 1NV8A 2HL6A 2PV7A 2QRMA 4PBTA 1EB8A 2Y77A 2Z43A 2ZDHA 1RQ2A 3CT4A 3Q6NA 1OB5A 2AIRA 3S2GA 3NVKI 3ZV5A 2WOJA 5TV2A 1MXHA 4ARCA 2E1RA 5CA0A 2IHNA 2Q6OA 3BGIA 4LJLA 3CRMA 1JJ7A 2XOXA 3MILA 4DIDA 1VPVA 1DIHA 2QK4A 3K8OE 3LVRE 3O2JA 1A8UA 4YHBA 2X2PA 3TNJA 3V4VB 5JV5A 3OTWA 3ANLA 2GPBA 3Q7RA 1P6XA 1RMQA 3S29A 2IBTA 3ENKA 4P22A 1E59A 3IDFA 3L93A 5ENDA 1YUMA 3I3SR 1PUJA 1MT0A 4AN1A 4EDFA 5SYNA 5B3KA 3FOFC 1R9JA 2WWYA 5I4KA 5FBKA 1TTQB 1BZYA 4W7HA 1NVGA 2XMCA 1H1TA 4JCCA 4CUZA 3RQSA 2PDAA 1T9CA 3WDLA 5TT0A 4EUKA 1W46A 2R6DA 4KPYA 2O4UX 1NE2A 4IFTA 2NSJA 4XWKA 1X1BA 4DNOA 1CIPA 2F1JA 5EJ8A 4YDSA 3OO1A 4ZQCB 1SOWA 2G88A 4S1NA 3UUFA 1DRJA 1EPUA 2Z6QA 3TN7A 2C5BA 4KGXA 4PSDA 3C41J 3VH3A 3HADA 2VH5R 4UMEA 4F4UA 3KQUA 3F4KA 1HNXB 2FEXA 5BW5A 4MV6A 5J58A 4G63A 1VLJA 2BELA 4LVOA 3ZNQA 5U9CA 2D5BA 3EFHA 1J99A 3T4UA 1VJRA 4JUAA 3K8ZA 1QVRA 4JB8A 5JNVA 6REQB 2IK8A 1ZVMA 3SN6A 3ASVA 2EX1A 4HRVA 5T8KC 3V34A 3TI9A 4GBMA 1IH8A 1OBCA 1CJKC 3I0ZA 3IPXA 1FFXA 2QM3A 4NH4A 1C4OA 2J3QA 4OQDA 2GHRA 5U4QA 3WI7A 2YN0A 1EJ0A 1RRGA 1W85B 3EQ9A 1B2LA 1VL1A 1QFXA 2EFHB 3AP1A 2FVXA 4RVCA 3A4TA 4CU2A 4R98A 1NX9A 3L1UA 3GOHA 3P9IA 4FT2A 3GJRA 4FEYA 5JATA 1SEPA 1T4DA 4ZGWA 1GTG1 5GAJA 2LKDA 4B85A 2I8AA 4MPPA 3TQSA 4DCUA 4B46A 1PJ8A 4AVYA 4N7RA 2P2CA 3Q40A 3K7EA 2O7QA 1NY6A 4I3FA 1PEAA 4FB5A 3SHWA 1RLOA 3HNOA 3OH8A 4UULA 5HS4A 5EJ4A 1KEZA 4IIDA 4V0KA 3EC1A 3IOYA 1WHTA 1K4YA 2EKBA 1TYBE 2VN8A 3T3GA 3MTEA 5KTSA 3OY7A 1IEWA 3OOJA 3FRIA 1KAEA 1JDUA 1P0MA 3GROA 4NF2A 4TYNA 1KVSA 1U2SA 4KU4A 1OPRA 2C7PA 4LMAA 2HGSA 3CEPB 1KK0A 3A9UA 4QUKA 1T8RA 3PC2A 3EEBA 4REQA 3NBFA 2PFGA 2CVHA 1GAJA 5KTKA 4WLVA 2Q4TA 3WL3A 1LFAA 1O57A 2IEGA 5ILQA 2UXDB 3IB6A 4LZPA 4RNDB 3QKSA 4KE9A 4RV9A 2E48A 2CJXA 1GGKA 2CYAA 4QNNA 4U7GA 2PFSA 2Y4OA 1BMTA 4KQXA 5I01A 2DSNA 4JP1A 4KAFA 2QU8A 3AESA 4DSTA 1KSFX 4RSHA 1ESDA 3D7SA 4JSTA 5DWQA 5EJ9A 3AVYA 1O6BA 3X1ZA 4KQ2A 1ODJA 2PKXA 3KVNA 3N53A 3NALA 3ZY6A 2GTPA 3GV0A 3L1HA 1TADA 2CF6A 5KYTA 2BFFB 3LCUA 1CV2A 2IC5A 1YR2A 3WRXC 2YV2A 3QMVA 1YNOA 4NI5A 5B7QA 3MWJA 1Q20A 1WSBA 5JQGB 4OQLA 2DETA 5SZIA 4JX9A 5CJJA 1REQB 2IEZA 4KRYA 1BVUA 2CZCA 2YNMC 3QBJA 1RWMA 5G2OA 6ABPA 1M1NB 3I62A 3TBHA 2X13A 3MUFA 3EQ2A 4C76A 4DLPA 1ZR2A 3ZZNA 3VU9A 1Z5UA 3B7PA 1FLVA 2CFTA 1K8QA 4C0KA 1YZQA 1L7AA 1NR5A 3PWSA 4NKRA 4FSXA 5K3FA 5EWMA 2JG3A 4FEGA 1RKUA 2YWJA 3MJHA 3U39A 9ABPA 4NDAA 3ZUGA 4JI3B 4IV8A 4DRYA 2J3HA 3DOFA 4C7BA 2IRWA 1E9VA 2OC4A 5CDYA 1EWVA 2PGXA 1M67A 2C9MA 5GINE 1V8DA 3Q2OA 4WESA 1QZ3A 3OIVA 5K0BA 4JUIA 1RJEA 2JJ8A 1SVIA 2QNRA 1QHHA 3K0BA 3CSDA 4JLDA 5AI6A 2W0SA 2YC4C