4EKDA

Structure of human regulator of g protein signaling 2 (rgs2) in complex with murine galpha-q(r183c)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
318
structure length
318
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFDVPDYAAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVCVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Structural and functional analysis of the regulator of G protein signaling 2-g alpha q complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/inhibitor
total genus 109
structure length 318
sequence length 318
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4ekdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ekdA01
1XJQA 1NVWQ 1SXJC 2P67A 4C0BA 3V00A 2GXUA 4NYIR 1E2KA 4R2IA 5JRZA 4AD8A 3NG1A 2IS1A 4DJTA 5AK0A 1W0KD 3NC1C 1TEVA 1OLOA 1EG7A 3H1TA 1I2MA 2CK3A 3OEEA 2RHMA 2PLRA 2V8OA 5LPNA 2JLWA 2GBLC 4TLDA 3KKOA 3TVTA 5CDFE 3OHMA 2WWHA 3ADDA 1MABA 2GCNA 1G20E 3CWQA 4MKGA 2XNDA 1DAKA 2ASEA 2PZFA 2H16A 4HAWA 4DUGD 2AKYA 3CIOA 2XNSA 2GJ9A 1Q3TA 3LVQE 3RDPA 4RD0A 3I61A 1ZIOA 4Q9KA 3WBKA 3VX4A 3GQBA 2ORVA 2MSCB 1OE0A 1G3MA 2REBA 3VX3A 1X8LA 4XSHA 4JLOA 5F9HA 2FNAA 1II8B 3KUCA 5CLLA 5KU1A 4BPBA 1XBTA 3L82B 1XNJA 1GDDA 3BIFA 3X1YA 2JLQA 3SFVA 2QORA 2IX3A 1OIVA 3M1IA 3LX8A 3C15C 3REGA 3RHFA 2X1VA 1PUIA 2G0NA 1HE8B 2OM2A 5SZJA 2CK3D 5EP2A 1XB2A 4AYXA 2IF0A 5EP3A 1WBBA 1DPFA 3K0EA 2QA5A 1OFUX 4L15A 3AF3A 5FL3A 4BFTA 4D4MA 2DFLA 2OBLA 3K9HA 4UNQA 3U4QA 5FUYA 3T1VA 1OXTA 3OFND 3CO5A 4F4CA 1ZU4A 1CR4A 2BBSA 1XZPA 4ACBA 2RB4A 1JQJC 2HJGA 4PAMA 1R8SA 1CTQA 4KSCA 2ZSAA 1IQPA 4URZR 2YOGA 4G5QA 4ZDJA 1NSFA 1Z2CA 3DL0A 4AURA 3PQCA 3QJYA 2HLDA 3SN6A 1FTSA 2AFHE 3RS7A 2FMXA 1ZMXA 4WA7A 3LY5A 1O87A 2IEYA 1CBUA 2NOAA 2PJZA 3KTAA 3UK6A 4EJSB 4ZIRB 2J41A 4GFDA 3OIYA 4TSFD 2EFGA 2ZRCA 1CS4C 1U0LA 1VG9B 2EWVA 2K5UA 2Z43A 3NH9A 4BEBA 3CX6A 5DH9A 4TMTA 4N0EA 4B76A 3I62A 2F43A 3OEHA 1X1RA 5EXTA 2O8EA 3CNLA 2CXXA 1ZAKA 4ON9A 4JLDA 4FWTA 1P5ZB 3T35A 4LHXA 1QVAA 2Z0MA 3I92A 5FOVA 2ZUDA 4QGAA 2YC4C 4EQ6A 4QM7A 1EFRD 1HA3A 1E2HA 5HE8A 4MGIR 1Z8FA 4JT2A 121PA 1GRQA 1RW4A 1IY0A 4IVRA 5LBIA 4BWYA 4E07A 2QE7D 5KSYA 1OH7A 1Z22A 2P5TB 1HEIA 2VSOA 3QG1A 3QPUA 4EPXA 3QSYA 3EASA 1HT2E 3REFA 5KNBA 5JI2E 4C0LA 1D6JA 2WBLC 1W2HA 1W4AA 4M22A 2D3WA 3KKQA 1E79A 1M7GA 2ZITA 1IAQA 2JJ1A 3R9IA 3CUEF 2NO6A 4P4TA 4EPYA 1GIAA 2BMEA 1TQ4A 4A36A 4KITB 2WVJA 3NKVA 4P0TA 5FH9A 1U99A 1IHUA 1XCMA 2ZI9A 4OK6A 2GDJA 2O8FB 2DWPA 1WB9A 2EFDB 4IVQA 1P75A 1G7TA 1MT0A 1KI8A 2PT7A 3OAAD 4BGDA 4UNSA 1GRRA 1Q1BA 4KV9A 4DDTA 1OH5A 2FEOA 4DDVA 2OG2A 2FEMA 5FTKA 1F48A 2DCUA 2IT1A 5IK2A 4RKFA 5DIFA 4OHYA 2A30A 5K8TA 2B6HA 4UQOA 2RCNA 1TTTA 1E9DA 2WJIA 4P4SA 2EFEB 3LXRA 4OI1A 5K8LA 3PUWA 1AJEA 3AKYA 4HAZA 3UANA 1G7CA 1Q1ZA 4QGFA 4KYUA 1VHLA 2B92A 3ZJYA 2MSEB 3QXJA 4X8MA 3TSWA 3AB3A 5JI3E 4JLMA 3DZDA 3U3MA 1S9HA 2BEKA 4OHXA 5GADl 4PXAA 2XGJA 1GZSA 2QEQA 1XJ0A 2C2HA 3GLGB 3BS4A 3B9PA 1W0KA 2BC9A 3SC3A 4EPRA 4DDUA 4DLRA 4FD2A 4PSVA 3C8UA 1OHHA 3F8TA 4FMDF 2BMJA 3JVVA 2J7PA 3P1JA 4KJZA 2P0EA 5EJEA 1G7SA 3LD9A 2LCFA 4GI7A 3ZS8A 4M1KA 2UZ3A 2DFKB 2YKGA 2P6NA 2IYLD 3KJHA 4EPVA 4IEEA 5FR2A 3DVLA 1X86B 4LC0A 1NMZA 5EXSA 3TQFA 3GLFA 1SVWA 4B3GA 1M7BA 5FTNA 1OHHD 3R8FA 1RJ9A 1KK3A 1FZQA 2XAUA 3NTUA 3A4MA 1AQUA 1JQLB 4ILEA 2XJ4A 1G3QA 1NN1A 2D2FA 2QRZA 1X6VA 4GZLA 5EUQB 5P21A 4HB2A 3P27A 2HCBA 3CRRA 4B71A 5FBRB 3RS0A 4ZI3A 4Q4JB 5JJIA 5EUMA 1YR8A 2GAAA 2WV9A 4GMDA 2I1QA 4HLDA 1OW3B 4IXNA 5G40A 5IT5A 4JLVA 4BRWA 4PTLA 2G1KA 4TQ9A 4V03A 5J47A 3TW8B 4CZ2A 2O8FA 3GJ0A 1KYIA 3RVBA 4A0GA 4IDQA 1XXHA 3VKWA 2AXPA 1YJ5A 2GTPA 4GP7A 5TDHA 1Z0DA 2QN6A 4D25A 4PC1A 5LDDC 2J46A 2WSMA 3QBVA 3RS2A 1U9IA 1VDZA 2CEAA 2AHOA 2RGEA 5ELXA 1GFIA 2WHXA 3W34A 1D8TA 4D2IA 2PH1A 4PO9A 3MFYA 4R9UC 5HKKA 4D0LB 4DBLC 1WQ1R 1ONBA 4DLSA 4MKIA 2JJ8A 1ZNXA 4E22A 3KQHA 4DSUA 1E9BA 2CHGA 1W7AA 4LDJA 4LUCA 2IHBA 2B8TA 5TV2A 1E9SA 1W48A 2X8AA 3T61A 3GJ5A 1C1YA 3R7WA 1L7VC 2HYIC 3MCAA 5EZ6B 4ASUD 3LAWA 3ONWA 3QNUA 3D31A 3WNDA 4AKHA 5JS8A 3QEOA 4B48A 1Z6XA 1LW7A 4O2RA 3IHWA 4TYYA 4LHVA 5CB8A 4Q9JA 4DDWA 4Q7JB 1T6NA 1QHHA 4ITRC 1G6OA 5UKDA 4OQXA 2IBMA 1JR3E 1N5LA 3TRFA 4Q9HA 3SS8A 2XB4A 1EK0A 1VYUA 5JHGB 2RMKA 2QP4A 2DWQA 1OF1A 5EE9A 3U7HB 3OE7D 3U61B 1DO0A 1NLFA 1KGDA 1G4AE 3WYGA 1N5JA 2FSHA 1FUUA 3B8HA 1GOTA 4B2IA 2JASA 2HUPA 1YR7A 4BLQA 3QOFA 4Q4HA 5CJPA 5FOWA 2B8WA 4Q1EA 3X1XA 1P9NA 2OAP1 4JLAA 1H8ED 2PEZA 4HLCA 1F6BA 4J0QA 1BH2A 3KX2A 4PSKA 4L9SA 1TU3A 1Z2AA 2ZEJA 4ASUA 1RC8A 1ZNYA 3J81k 3AVTA 3ZVNA 4H1VA 3QQ5A 2A78A 4AYWA 3ADBA 3FFAA 5FTLA 5AJXA 2FDCA 1EX6A 4XD7D 2WWGA 4Q4JA 4LBYA 1OJLA 1Q22A 4NMMA 1D2MA 2FSGA 5F98A 2JJ1D 3OIUA 5IDVA 2VHCA 3BAFA 2F1HA 4CT4B 4EPWA 2HF8A 1EX7A 1J99A 2CL0X 3N5CA 2O8BB 2TMKA 1KK0A 2A9KA 1W1WA 1WF3A 3T1QA 3ZZTA 4AI6A 4BZQA 2D2EA 2VYFA 1A5TA 4G5RA 1G5RA 3THOA 2MMGA 5DO9A 1F2UB 4US0R 3GJXC 4IDPA 2QQEA 4HZUB 2WOJA 4D26A 4TYWA 1SVOA 2KI5A 5JJKA 2ZR0A 2OXCA 4OJQA 3GLIE 1KI6A 2IYZA 2ZRFA 4K8OA 2Z83A 1KDOA 2BM0A 4HYYA 4C0JA 4YDSA 2ZRGA 1R4AA 4TZ6A 3VU9A 4TLCA 4B2LA 4EAQA 1UKEA 3SYLA 3CF0A 1GNQA 2F6RA 5H8WA 2O8CB 2OXRA 3EC2A 4CIDA 1VKJA 2EQBA 1RZ3A 1FX0B 2ZSBA 4PC6A 5FBVB 2JCSA 1E94E 1M6NA 3MWLA 1E2PA 5HE9A 1W5SA 3KQNA 3MWJA 2RKOA 3THXA 2WOOA 4Z1MD 1HURA 3PIRA 1MH1A 2ZYTX 4RCYA 2ODEA 2ZRBA 4LV5B 4PFSA 5L3SA 1NVUQ 1UKZA 2ONJA 3FHTA 1LF5A 4I1SA 3FOZA 2AD5A 2WWIA 1TU4A 4R7ZA 1UBCA 1ZUNB 4W9MC 3IQWA 3MGCA 2JAQA 2W6ID 2HCJB 4QBIA 4TMWA 5HKKD 3GMTA 5IRCD 3SEAA 3WYFA 4CEJB 1P4SA 4YMSA 3KKNA 1AIPA 4XSGA 4LJ5A 3DZ8A 2ZVQX 1VPLA 4LV8B 1W4BA 3EARA 1QHIA 3HPQA 2EYQA 3RWMB 3A8TA 1YZQA 2F9LA 1Z07A 3FE2A 4ARZA 2H92A 5FFMA 3KDSE 1Z0JA 1CRQA 3MG9A 3R20A 1Z63A 5KYKA 5TY0A 4MQBA 1B0UA 4M9SA 4URYR 3TH5A 3SI7A 2AXNA 4RFVA 1G41A 4RKEA 4V0KA 4PHHA 1GL9B 2EWWA 2QT1A 1IXZA 5DE3A 2XXAB 3HR7A 3WRYC 3B1YA 1DO2A 4G3XA 1GTVA 2RGNA 4TMVA 2IUSA 3B9QA 2FWRA 5EZ5A 1GNPA 3EPHA 2ZJ5A 2W6IA 1GILA 3QKUA 4I1OA 3OF5A 1T8TA 1OFHA 2VHQA 3JZMA 4Q1AA 5JMTA 3BH0A 4HAUA 1ZRHA 2VF8A 1RPZA 3KQUA 3SDZA 2CCJA 1FMLA 5CYOA 4HI0E 2PX0A 1T91A 4B6EA 3PEWA 2IS2A 1EXMA 1HV8A 2PCJA 2IS4A 1SVKA 1R10A 1AKEA 4OI2A 4BECA 2KE5A 1ZC3A 3NDPA 5JEEA 1UEIA 2VP9A 4D81A 4ESVA 4GDFA 3UMSA 4Q48A 3QXHA 1OKKD 2QUZA 5GJCA 5KSZA 2V9PA 1OSNA 3JZAA 5CK4A 2J59A 2WWXA 4ZKEA 2Q0HA 1II9A 2VBCA 2ZUCA 2O0HA 1XEFA 2D7CA 3WHLA 3FMOB 3K9GA 3B82A 3M4YA 3IEUA 1ESNA 3ZD6A 2V55B 4NE2A 1XMJA 3AVOA 2WICA 3HDTA 4FW9A 5DGXA 5J4VA 1J7KA 1KIMA 2XTZA 3K9LA 2ZE8A 4BLOA 2ZM5A 2WWYA 3FMIA 1UADA 1VHTA 1WDTA 2C95A 4W5WA 1TMKA 2BDTA 1GITA 3RC8A 1KO4A 1P2SA 1U98A 3H2YA 2DB3A 3Q85A 3TUJC 1HUQA 3BC1A 3CRW1 1GUAA 2GCOA 4ZCMA 1UFQA 4MUAA 3W6PA 2O8DB 1AZSC 3N2EA 3IIKA 4URVR 4HATA 2O0JA 1Y63A 2IW3A 5J40A 2HDNB 3TKLA 4MDEA 3EZ2A 3VKHA 4DCUA 4B73A 1W49A 4OHZA 1DG1G 1E79D 4JS0A 1IN6A 4D0GA 3EPJA 1N6LA 3ICQB 1S1MA 4IKEA 2QPTA 5GVSA 4G5GA 4OI0A 3ZVMA 1RRCA 3LW7A 3CM0A 1FW6A 1KSHA 1ZUIA 2KJQA 4NYJQ 4AYTA 4C0AC 3U5ZB 1Z0KA 4Z1MA 3VHXA 5KNDA 3QUSA 1JJVA 3HYRA 2QE7A 4OQMA 2FSIA 3IUYA 4V0LA 721PA 2XZLA 1HYQA 2OLKA 4LHZA 3EA0A 5J4KA 1XEWX 2IYRA 4LYHA 2QMEA 4M8NE 5TMPA 2GXQA 2WAYA 1XD9A 3IIMA 2QBYA 2CJWA 4MYCA 1DAIA 4TL7A 5FOXA 1PV4A 1VCIA 3DEFA 4Q1FA 4LJAA 4TLAA 2KBEA 3HPRA 4PR0A 1ANKA 1BIFA 2JDIA 4DKXA 5KNCA 3BRWD 1OIWA 5FL7A 2QM8A 1FNMA 2CVHA 2H18A 1E98A 1P9RA 1U8ZA 5L3RA 1D2NA 3GLHE 4JVMA 2IL1A 3CF2A 4L16A 4PQRA 1CU1A 1U94A 2PCLA 4RFSA 1E0KA 4IDHA 2YWHA 2GJKA 3JVUA 3QKRB 3SR0A 5BXQC 4HUTA 4PPGA 2XOKD 2V6JA 2JLYA 3AF2A 4DEYA 1SVIA 3T1TA 2FPKA 2W0SA 4A4DA 1FMJA 4JKYA 2WMOB 4JLPA 4U00A 2ZI7A 1E9CA 8OHMA 4PO1A 4WXPA 2PMDA 3GEHA 4BEJA 4PPFA 4YDHB 1FQKA 2GETA 1FFHA 3Q3JB 1EWQA 1U90A 2NPIA 3EWSA 4N1AA 3S1AB 1KMHA 1BMFA 4DT1A 2X2EA 1QG4A 3TMKA 1NMYA 2FX3A 1GL6A 2NQ2C 3KUDA 1JAIA 2ZR7A 2VSFA 3GJ7A 3HR8A 2R65A 2ZU6A 1M1YE 5B57C 1KOFA 3CPJB 4PC2A 4XVRA 5JSZB 1AGPA 4Q19A 4B2PA 1FX0A 1G18A 3FYHA 1OH8A 1E1QA 1T3HA 3QG5A 4Q1DA 1XXHE 1OXUA 2BOVA 1GVNB 3AVQA 4V0NA 3B60A 2G77B 3VKGA 1E9FA 2I3BA 3THXB 1NKSA 5HPYB 1ZM9A 4DCSA 4BFSA 3LX5A 4JYBA 2ERXA 1MO6A 1E69A 4LV6A 5JBQA 3LBHA 3W8NA 821PA 1KKLA 3GEEA 1P9WA 3NDBB 2QGZA 4EUNA 1LS6A 2X77A 2BHRA 1N0WA 4QFMA 4S2EA 1QG2A 1XRJA 1KI4A 1FPMA 4QHSA 4WOPA 2JLXA 1SXJE 4O0MA 2NZ8A 2QPOA 3MWYW 3ASZA 4NCJA 2BCJQ 4MA4A 3MRSA 3SFZA 3NWJA 2MMCA 3U7FB 1WBDA 2FU5C 4Q5IA 1CJTC 3E1SA 4KVGA 5H1YA 4JVSB 1TNDA 1COWA 1ZD1A 4BFZA 2PBRA 1Q3HA 4DCNA 4GOXA 3C16C 2FV8A 4F38A 3AKDA 4PAOA 1FQJA 1NMXA 1JR3A 2QG6A 3F0TA 1AK2A 2SHKA 3HU3A 2OV2A 4B34A 3QVVA 3CX7A 3W6NA 4ZI2A 1E3MA 1QHNA 3CONA 3DO6A 4KBFA 2JGNA 3BBPA 5EXPA 2DFNA 4DC9A 4M2LA 4M1SA 3W90A 1N6KA 2NTYC 4PX9A 2NO9A 3CNNA 2IYSA 4N3NA 4OQLA 2ZVPX 2W6JA 3H84A 1UBEA 1JR3D 3QKTA 2IUUA 2KB0A 3ZDQA 1YU9A 4POAA 4YLGA 4XWKA 3L0OA 4Q9LA 1W0JD 1NSTA 1BMFD 2GESA 1UEJA 2VHJA 3OAAA 3CX8A 3ZZ0A 1MO3A 5CITA 3DMDA 1KI2A 3ASYA 4QJ5A 4II7A 1LY1A 1G19A 4B44A 4LJ4A 3CR8A 4M21A 4GZMA 2QQ0A 1G16A 2BBWA 4MGZR 3NBZC 3DKPA 2GEVA 1R7RA 3W3AA 4DZZA 3NEJA 1CLUA 3FMPB 4BLTA 4DIEA 3THYA 5HZHA 4KSBA 3D6TB 5FOUA 1BKDR 1Q12A 3NBXX 4M0LA 2DY1A 1CEEA 2QRNA 4NYJR 5SZKB 1NJGA 2ZI6A 3IPXA 2E87A 4TT3D 5JWOA 2FF7A 2C9OA 3WY9A 3BD9A 4BFXA 4IVPA 1W2GA 4HB4A 4XVQA 1LS1A 5L8VA 3MJRA 1OIXA 1K5GA 2WTUA 2OUKA 1PLJA 4IXMA 2EFCB 3PENA 4CF7A 3MUFA 4FMCF 1S3SA 4LWZA 3TAHA 1EFUA 1JEEA 3MJHA 1L4YA 4RCZA 3NBYC 3WXMA 4LY6A 4DCVA 5KTYA 1E1RA 1Q1EA 2GILA 5L3QB 2NMVA 1SVSA 3H0KA 1KDRA 2ZJZA 2ZE7A 3RSLA 1XD2B 1U2RA 1AGRA 3AUXA 1SHKA 1WA5A 2ZRPA 4Q66C 2FA9A 2Q9AA 4X8LA 1KI7A 3EPLA 1J70A 2GBLA 3BB1A 4HDOB 4C0KA 3C4JA 2IWHA 3I72A 1FP7A 3ZH9B 5JSZA 3D3QA 2F7SA 3PEUA 1G8FA 2H1LA 3DPUA 1UDWA 2NO0A 2UVQA 3QBTA 3GJ4A 2VH5R 2GCOB 1LTQA 4FINA 1Q1QA 3BJIC 1Z3IX 2FZLA 1HY3A 5BWMA 2C9YA 2YYZA 3TSOA 3QKRA 5M04A 3U44B 1VG1A 2X2FA 3BB3A 3ZGXA 1XDBA 2BEJA 2R6FA 3K0CC 2PMKA 3QEJA 5GJWC 2A5DA 2OO7A 1GSIA 5KDOA 2CLSA 3DKVA 4RZXA 4XTRA 4YXWD 2IYYA 2W58A 3O8BA 5BQ5A 1JALA 5AR1A 2QNRA 4M1OA 4HB3A 4O3MA 4DB2A 5KDDA 2V7QD 4BFUA 2W6JD 1XMIA 2DWOA 4A6PA 3VHLB 5SZIA 1RFLA 2ZPTX 2QROA 3QVUA 4WZ6A 4DLXA 4MRVA 4JLJA 4L5BA 1LNZA 1PUJA 1F2TA 2E1RA 3A1SA 2BVNA 4U5XA 3BE4A 3UG7A 4LGMA 1RRPA 4NBSA 4PPNA 1D9ZA 4HLUA 3PG5A 2QI9C 1P2TA 3THWA 3R9WA 2R44A 2NPFA 2J87A 2IYQA 3CZPA 1JPNA 1AN0A 2YOFA 4GNKA 3O8CA 3KJGA 5IHPA 1CF4A 2VP5A 4XOIA 3RABA 1IN8A 5J4LA 4RY2A 1Z08A 4Q4HB 1PVOA 1P61B 5JLJA 4A0RA 4BRUA 2ZYVX 3A37A 3P4YA 3FGNA 4LBVA 3PEVA 2Z5FA 4Q4AB 2DYKA 2VHUA 3NHBA 2XNDD 1KNQA 2GJAA 2JIZA 3I3SR 4DLUA 2AN9A 5FBWB 5KOYA 1JPJA 4NU0A 2WIAA 5AJZA 4A6XA 2ZRNA 1SULA 4WZBE 5FUVA 2KBFA 5DHFA 4LJ6A 1DARA 1ODFA 4K81B 3QY0A 4DHEA 3L43A 2PZEA 2WPDD 1N6RA 1IXRC 2FPLA 4DEXA 1M7HA 2R62A 5HTKA 4RSGA 2PJRA 4QNMA 3K9NA 1ETUA 5CB6A 2BJVA 4V0ME 4W5JA 2GK7A 1QDEA 4YMTA 1OYWA 1VMAA 3O47A 5KSOA 2JLRA 3K70B 3IDQA 2GK6A 1K6MA 2MSDB 2XJ9A 4NPHA 5JFGA 3GPLA 3EPKA 1G3RA 3G5UA 1N6NA 1E4VA 1U9IC 2DR3A 4QBFA 1R0ZA 4TTPA 4NCIA 4O25A 1N25A 1QVRA 4BZXA 3ZIAD 1G1MA 1XX6A 4E09A 1OB2A 1YZTA 2RHDA 1G17A 4LBZA 4KVAA 3WBJA 2IYUA 2RGCA 3BORA 3ND9A 4OJKA 1TF2A 2RAPA 5AUNB 1XMVA 2CNWD 4QGHA 4DLYA 3G0HA 3BFVA 3SBDA 2VP4A 1JAHA 2R6CA 1M8PA 5KDLA 4GT1A 1E2JA 1ZINA 4NH0A 1DTSA 4B3CA 1GKIA 1AA9A 2IXEA 4PANA 1KY2A 3M0EA 1TUEA 4QKQA 1ZNZA 5AWFC 2CE7A 4DSOA 3LH5A 1M34E 4JVLA 3T5DA 1LVGA 2BKEA 1HQCA 4NCHA 2VRWA 3IIJA 3D8BA 4GP6A 2B7CA 4OK3A 1P2UA 1I4LD 1G4UR 2BBTA 4WBSA 4URWR 3B1VA 3BFKA 3A6PC 2FJUA 4JBYA 5CM9C 2V54A 2DFTA 1A7JA 2OESA 5FPSA 1R2QA 4GRAA 5EE0A 2F1JA 4LYAA 4Q00A 2CLCX 1XZQA 1JB1A 2O0KA 4Y0VA 5A5GA 1EGAA 2ZS7A 2GEDA 3U2QA 2R2AA 3AQ4A 4IJMA 4UXHA 4Q21A 1K5DA 4DVGA 5KHOC 4M1WA 3X1ZA 4MGYR 2I4IA 2ZRHA 3WMFA 4RD3A 1W5TA 3B1ZA 1ZM2A 2JDID 4NTZA 4RFSB 4CVNA 5E7IA 2ZREA 4G01B 4R98A 2OSBA 3BXZA 5L3SB 2R6GA 2CCKA 3KL4A 3LLMA 1W46A 2CHQA 3NBFA 1JR6A 4ZPXA 2CBZA 3DOFA 4CEHB 4NL4H 2FFHA 5D3MA 3AVYA 4X8OA 3AV0B 2J9RA 1CULC 1ZIPA 2J1LA 3X1WA 2Q3FA 4DSTA 3KKPA 4TN1A 1OXXK 3AUYA 4IOJA 2AFIE 4GPTA 1P72A 4JZKA 3SJZA 1S4QA 4ABYA 4YONB 4D4JA 4HAYA 2O5VA 1XD2A 1NI3A 1GNRA 2Z4RA 3L8ZA 3UG6A 2CMKA 3EIHA 4IEIA 2JLSA 3WYAA 4YMUA 1OH6A 1KZGB 2VA8A 4ZCLA 1Z6AA 2GJ8A 4OQNA 2EU8A 3ZD7A 1WMSA 3KXLA 4P3YA 3EX7C 2WM9B 2XX3A 2OEPA 3AVPA 6Q21A 2ZRDA 4LCBA 4EPTA 1FTNA 3NVAA 2ZS8A 5BYKA 3ZQ6A 4KU4A 2HV8A 3VR4A 4D6PA 3W6OA 2QAJA 2QAGA 2CHVA 2WIBA 3K0CA 4FN5A 2J45A 1OV4A 4KFRA 4Q03A 1TX4B 3C41J 4KCGA 3F3YA 4P31A 4AG5A 1DAGA 1II0A 2GKSA 2GVZC 3ADCA 4A15A 2BKUA 3RS4A 4KLZA 4TTRA 1E9AA 2H17A 1NF3A 2HEIA 4DLWA 3U6BA 2G3YA 3MAAC 2WJJA 2XZOA 3PJRA 4CEHA 1KI6B 4NP6A 3CWZA 1E0SA 1D5CA 2OAQ1 3GJ3A 3AH8A 1IM2A 2RGBA 5KO2A 2OBMA 2IEZA 3ECCA 4XIGS 3T15A 4A8JC 3PUVA 3WP1B 3FHOA 4ERNA 3PUYA 2J5XA 1UBFA 5FOSA 4HUQB 5FTJA 1A4RA 2BMFA 3I8XA 1QHXA 2YZ2A 2GAOA 4C4PA 5FOTA 3Q72A 2F1IA 2XTNA 1E2MA 3O8DA 4DB4A 3LRPA 1SQ5A 3RS5A 4UJ5A 1LFDB 2P6UA 2RGGA 1XP8A 1I4DD 3ZQJA 1CR1A 3QIAA 1SVMA 1YHNA 2QENA 3OEHD 3F5FA 5G3ZA 2ZRIA 2ZR9A 4JVNA 4BFYA 4LC1A 4Q4AA 5DN6A 3TBKA 4AKGA 3ZYCA 3L8YA 1U0JA 3UKDA 4GOKA 1IN5A 1VCOA 3UXMA 1DBSA 1XWIA 4CGZA 2O8EB 4B32A 2CCGA 2FG5A 5GJVC 4UNPA 2NZJA 3WRXC 1G7RA 3W3ZB 2PLFA 2PEYA 2GZAA 3RAPR 3VQTA 1BOFA 1W47A 2HXYA 3LFUA 1OYYA 4BUJA 2HXSA 1YVDA 2BCGY 2AL7A 2YOHA 2XTMA 2EFHB 2H57A 4Q7KA 1NBME 3NHAA 4B3BA 3SOPA 2QMOA 2VP0A 2ZRMA 3QPWA 2ORWA 1ZM4A 2GXSA 2Q6TA 2AD1A 3KQKA 1QHHB 5CM8B 4F92B 4M1YA 5DI3A 3EG5A 4OK5A 2BMDA 4RD2A 4D0NA 5F2EA 2FFQA 1A1VA 2FSFA 4OKSA 4JT4A 1R8QA 2OT3B 4LHWA 4ZDIA 4AIIA 2ZJ8A 3W5JA 1ZM3A 1SKQA 2NIPA 2QAGB 1ZVQA 5J4YA 3TR0A 1EFRA 3DHWC 3GJ6A 1Z0FA 3EC1A 1Z6GA 1T4GA 4QGGA 2ATXA 4NYMQ 2G88A 1KJYA 1KI9A 1NN0A 3T34A 2JLZA 1CKEA 5FL7D 4JSYA 1PZNA 4Y0AA 4ZO4A 4G0NA 1MOZA 2GF0A 1KDPA 2V1XA 1VYTA 3TJZA 4GOJA 1C4OA 1W44A 1NG1A 5G41A 1Z06A 1T3LA 2FFBA 3CPHA 2F9MA 5CDFA 4TT3A 4O2LA 5JCZA 3AM1A 2V7QA 2VTKA 1M74A 1VYVA 521PA 1CJUC 2O8CA 1KI3A 2ZIAA 4QBGB 5JZVA 3I5YA 4CW7A 4B33A 1SXJD 3CH4B 4I81A 1IN7A 2OCYC 4TLBA 1GWNA 3BB4A 2F3TA 3E70C 3GFPA 4DXAA 1W36C 1UPTA 2GZHA 1N6HA 4TYPA 4C30A 3P32A 4NYIQ 5JCPA 3G82C 3QXXA 3CW2A 5J4HA 1FNNA 1SVLA 4TYQA 1S3GA 3FKQA 3RRYA 5LB4A 3U3KA 1NLYA 1XJCA 5GVRA 1VCNA 1G8HA 1NIJA 1Z0AA 4PZLA 1N6OA 2CVFA 3GFOA 3I73A 2Y8EA 4A9AA 1KMHB 4B35A 4MKFA 1OPXA 1QHSA 2KSQA 3TK1A 5GJBA 2O8BA 2C77A 3PXGA 4Q4LA 3UWOA 3UIEA 2NG1A 5D3MB 1N2CE 2QL6A 3T12A 3DOEA 4LJ9A 3TUZC 1RJ9B 3GLFB 3DMNA 4JYCA 2IYXA 4HAVA 5IF9A 2HT1A 3WNBA 1VIYA 2QU8A 2RGDA 5ANRB 1CIPA 1WRBA 3GLIA 3CZQA 4XH9B 3K1JA 4KFUA 4W7SA 2ZYUX 2GWHA 4M9XA 4YC7A 2Z4SA 4HSEA 5FI0B 2CL6X 1JXMA 4K46A 3KFXA 2G1JA 3TE6A 4G5OA 4I99A 1G5PA 2R6AA 3T1OA 4A82A 2UKDA 4IFBA 4L8GA 4A2PA 4KBGA 4LBWA 3N70A 5AUOB 4A2QA 3PVSA 3VNVA 4EJSA 4ZIRA 5LD2B 3VAAA 1P60A 4WZAE 1F5NA 2W2XA 5E7MA 2D74A 3FKSA 1RE0A 3HYTA 3U7GA 4TSFA 1R5OA 4TZ0A 3WHKA 1G8YA 2WSSA 2QTVB 4RJLA 1RYFA 1GKUB 2KWIA 5E3HA 1Q0UA 5C4MA 2X19A 1VG8A 2BJWA 2C98A 2RGXA 4BQSA 3SZRA 1VECA 2GRJA 4L9WA 1NKTA 4LPSA 4UKDA 4DRZA 4U02A 4W5HA 5FI1B 2XITA 3AF4A 4MH0R 3K53A 4H9GA 4ZDWA 1E9EA 2Q21A 3R7WB 1XTKA 2ORIA 4JLBA 1NBMA 1A2KC 4OBEA 4PPQA 2GXAA 4TMXA 2CL7X 3EIQA 3W9YA 3UMRA 3K09A 2FFAA 1J2JA 1E2IA 3EXAA 4UNNA 2AWNA 3N2IA 3HWSA 4LRWA 2HT6A 2R6DA 1NN3A 4US1R 1Z28A 2QGNA 4V0MA 3QXCA 3V9PA 2QTHA 2VSXA 3L2OB 2J0QA 1DG3A 1BYUA 3BOSA 3LQQA 4LX0A 1NIPA 1MO5A 5EQTA 3OE7A 1R6BX 4IOKA 5DN6D 1Z6YA 3LLUA 3HU2A 3FTQA 1UJ2A 2G0TA 2QAGC 3A36A 1KI1A 2G83A 2VP6A 1OXSC 3RWOA 3KQLA 4FI3C 3C7KA 1XD8A 5FBLB 3KTAB 2LWIA 3PUXA 4MITA 2H8KA 3Q7PA 3L0IB 3BH6A 3GCGA 4B75A 1W0JA 1U8AA 2YNMA 2I1VB 3B13B 4RVCA 4G1UC 2ODWA 3SNHA 1KKMA 4PHGA 4Q7MB 1G5TA 2HLDD 4D80A 2B21A 5K8UA 4UXIA 2IK8A 2C8VA 1QRAA 3QENA 3BERA 5AJWA 1W4RA 3NXSA 1GAJA 3IILA 1DE0A 1W36B 1HE1C 1J8MF 3RSOA 5B58C 1ZBDA 4KFTA 5AJYA 1G21E 2ECKA 2B7BA 4DCTA 2WZQA 1YZKA 2WKRA 4EJSC 5DSZA 1ZD8A 4JSTA 1E4YA 3IBGA 1L4UA 4LYJA 2ZJ2A 1BYIA 3ZS9A 1V43A 3KXIA 3CLVA 5DISB 1U8YA 3WMEA 5G53C 1ZD9A 1PLLA 1NVVQ 4KHZA 1NN5A 2E9SA 2CNWA 2HYDA 2ZANA 3UATA 4LK2A 4I1VA 621PA 3U4QB 4TLEA 1X1SA 2IUTA 4F4IA 3AKCA 1XTSA 2FGJA 2ERYA 5E95A 1MRSA 1UKVY 2P5SA 2Z6VA 5EE1A 2F3RA 2ANBA 3EZ6A 2P3SA 1XU4A 2JATA 2YHSA 5JHHB 2BWJA 2VP2A 4TWZA 4US2R 3K09C 4F4JA 1LF0A 1MV5A 4HDCA 1CP2A 3K0SA 2FPMA 4DLVA 3IQXA 2W00A 5FPKA 1B23P 3SQWA 4JJZA 1JEDA 3ADKA 2OILA 3LV8A 5B64A 1YQTA 2QSZA 2A7QA 2F55A 4LJYA 2ZSFA 2H5EA 3PV0A 2BBOA 1T5IA 5CYPA 3R9XA 4D4KA 1KO5A 2Q3MA 4G5SA 1E2QA 4QL3A 4KXFB 1QF9A 2HF9A 5AJVB 5IK2D 4Z8YA 3LO5A 4JL8A 3I4LA 4JL5A 1KNXA 3AP3A 4NDZA 1W36D 4QM6A 4FMBB 4MYUA 4M9QA 4OYHA 2J0UB 2ONKA 2DBYA 3RLFA 1T9HA 4KI0A 4OQFA 1G8PA 3BFXA 5B30A 2IS6A 2V6IA 3TQCA 4ZDKA 3FPAA 2QMUA 5CIWA 3TR5A 3S1AA 4GSYA 4C3ZA 2YWGA 4RZ2A 1SKYB 1XEWY 2QP9X 2G6BA 4TYNA 4BFVA 4B43A 2YC2C 1DS6A 1US8A 4HLUC 3DM9B 2ZRLA 3SU8A 3SYKA 1JECA 1JI0A 4X8HA 1GG2A 4AY2A 3GLHA 4HEJA 1COWD 1ZP6A 3EZ7A 2J0VA 1DAMA 3M6AA 5HCNA 1NG9A 3VNUA 2J7PD 1C9KA 3THYB 2P6RA 1E1RD 3KJEA 4A1FA 3GEIA 2VPPA 2ZYWX 4AKEA 1H8HD 1EFCA 2ZI5A 1E2NA 2ZRKA 4ESHA 2OE2A 4JBWA 1EWRA 3IPYA 3B2EA 3FKSD 1KSGA 2QZ4A 3QPVA 4IDNA 4LZZA 1J8YF 3P4XA 3EZFA 2ODNA 3EWAA 1ZYUA 1AM4D 1E2LA 2BV3A 4EQ6B 1T0HB 4NZYA 1MKYA 1GKYA 1V5WA 3KB2A 4E03A 4EFLA 4YMWA 3SHFA 2F1RA 2ZQ5A 3ZZUA 1T0JB 4KODA 1YRBA 4B3DA 3U44A 2D4HA 1ZC4A 4PHTA 3GLGA 2JJ2A 3SBEA 3WNCA 2WWFA 3TNFA 5HR5A 1PJRA 4OI4A 4A92A 1G64A 3EA5A 3QKSB 4TMKA 1TQ6A 4MDFA 3QI2A 1E2DA 1L8QA 2ZTSA 1DAEA 1TUIA 3RC3A 1H8EA 1F60A 4TL6A 5K8IA 1A82A 1OXVA 5LB2A 2N46A 1AQYA 5KPDA 4F93B 4RZUA 1KSFX 4WAUA 3U6KA 2IXFA 1XPOA 1WCV1 2JLUA 5F9FA 2IXGA 5HZKA 3FFBA 4NHOA 4AK9A 1YE8A 1DAHA 3U7EB 3FWYA 3AVWA 1S9DA 4LYFA 4RD1A 4ACAA 3O8RA 2XSZD 1SHZA 3L0SA 1FUKA 1MO4A 4FIDA 1IJEA 5C1BA 2OLJA 3A1WA 4PZZA 3UMFA 4HDQB 5FUXA 1CR0A 3QF7A 2ZJAA 1P7CA 3B1XA 2JJ2D 3B85A 3KB1A 2WJGA 4JMPA 4QC2A 2VQSA 1S0UA 4WXRA 1E32A 2C5LA 2AK3A 2REXB 3LNCA 4CEIA 3GLGE 5TVKA 1YR6A 2AR7A 2QSYA 4JJKA 3K0FA 1X8KA 2IYVA 1ZNWA 4Q02A 4DLZA 5DHAA 4BFWA 4BLRA 1Q20A 1S1CA 5DI9A 3B1WA 1NY6A 4QHTA 3Q9LA 1F3OA 2XB2A 4BZPA 4CYMA 3HP1A 1KK2A 4MRSA 1JNYA 1UM8A 1XEXB 4ZKDA 2GEUA 3KZ1E 2EYUA 3VTKA 3AGQA 2F43B 2W83A 4TTQA 4PO8A 2WMNB 3PFIA 3SQXA 1WP9A 1NNEA 1VIAA 3MMPA 1A2BA 4A0FA 2EVWX 4IRUB 2H7VA 4FXPA 1H8HA 1TF7A 1XXHB 2XSZA 4TMZA 3A1VA 3V4RA 2FOLA 2NO7A 2ODBA 4QNRA 3TVDA 4D4LA 2NGRA 4S35A 4IFEA 3LBNA 3VR5A 4F7WA 3R8CA 1NLZA 4IOLA 3SYNA 4GMXA 3SJAA 2A5YB 1XTJA 3TIFA 1NL3A 3U3JA 1G3IA 3IBYA 2ZJYA 3IKJA 1P6XA 4KYIB 3ZLJA 1NY5A 2A5GA 3NEYA 1R5NA 1Z29A 3SHWA 1XFAA 3E5HA 4XD7A 1UAAA 4BE7B 3RRMA 5CJ2A 5DYIA 1K8RA 1UKYA 3CKLA 1YZUA 3MSXA 3QE0A 1EFHA 1XMSA 2GF9A 1ZW6A 2ZAMA 3OIVA 1XCPA 1AS2A 421PA 3CB4A 2ZROA 5AUPB 3EW9A 1KAOA 2C78A 3GFTA 3LW8A 3I5XA 2J3EA 2A2ZA 1AS3A 1XCGB 2IHYA 3AF0A 2LKDA 2QPAA 1SXJB 5A0FA 4Z51A 4A8JB 4C7OB 1SKYE 4CEJA 2VEDA 4TL9A 5H68A 2YJTD 2QBYB 2WKPA 3CH5A 4V0OA 4A2WA 3EZ9A 5EE3A 3K70C 1NBMD 3W5IA 1DEKA 3RYTC 3TSZA 1AKYA 1Q57A 1KZ7B 2P2LA 1CR2A 1N6PA 1CRPA 2OHFA 1G3UA 1KHTA 2ZETA 4AC9A 1US8B 4N0DA 2CDNA 2QM7A 1HT1E 1II8A 3LBIA 4BASA 3OZXA 3PCRB 2ZI3A 5B2ZA 2QT0A 1YR9A 2RGAA 1E99A 1E9RA 2GVDC 2C04A 2C96A 5CK5A 2Q3HA 3RRNA 4JLNA 3SJCA 1T5LA 3KXKA 1Z6TA 2L0XA 4MRPA 2FN4A 2O8DA 2AK2A 1E2EA 2ZRAA 3AVVA 2VIIA 5FPHA 5L3QA 2V3CC 3A58B 2VLIA 1JXOA 5BN4A 2GZDA 3X2SA 3K0AB 4PHFA 5CIQA 1ZJ6A 2HJVA 1W4CA 2OCPA 2R9VA 4YMVA 3W8RA 3V4FA 3QF4B 1T8UA 1RRFA 3MLEA 4EFMA 3EAQA 2GJSA 4HB0A 1BS1A 3VR1A 3NC0C 1RKBA 3L0PA 1S8FA 4NONA 4B74A 1XTIA 1H65A 4C0QC 1JJ7A 3QF4A 2J7KA 4V02A 4ZV4A 4EDHA 3RNLA 4HAXA 1ZM7A 3OESA 4DWJA 4RD4A 5DI3B 3P20A 5KPJA 1UDXA 2G9NA 1YZLA 4EKDA 3VR2A 1E0AA 1AS0A 1AZTA 1WXQA 2GCPA 1P62B 5J5CA 2GNOA 1QZXA 5AUQA 1D9XA 4LJ8A 3UWKA 3MD0A 4DSNA 1KO8A 2ZAOA 4QJ4A 4NCKA 4IDOA 4Q9IA 1NP6A 2WJHA 1X3SA 2YWFA 5LD2C 3Q5EA 4JLKA 3Q5DA 3TGPA 5TARA 3TUIC 2J0SA 2GHIA 4XTCS 2ZJBA 1I4TD 5TXGA 3HU1A 4LSGA 4I1UA 2JEOA 4OHWA 4IHQA 4URUR 2BIFA 1XPRA 3PR1A 2IYWA 5BN3A 4TL8A 3GJ8A 5JWRA 4Q01A 4PQYA 2ZSEA 3AP2A 2WWWA 3AP1A 4QOSA 4Q1CA 2JLVA 5JWHA 1QHGA 2AX4A 4AG6A 1I2DA 2WJVA 3LXXA 3BGWA 1NRJB 2Q9BA 1EFTA 1RVDA 4NYMR 4C0SA 4UNRA 2OBNA 1GL7A 2AKAB 1TQ2A 4FWIB 2GA8A 3IGFA 2ZI4A 3CR7A 4FCWA 4BLSA 5H70A 4FMDB 1DOAA 3H4MA 4HUQA 4ARZB 2ZU0C 2YV5A 4M9ZA 4B47A 1VG0B 1BO6A 4P32A 4IOMA 3HJNA 2AWOA 4D82A 4CRWB 3AGPA 2JA1A 1ZU5A 4PSAA 2D06A 4EIWA 1Y3AA 1E2FA 5BYJA 4A0HA 4GL2A 3C5HA 2IF2A 2CJWB 5C4GB 1FP6A 2FH5B 1HH4A 2IYTA 1U0HC 1OFIA 1NJFA 3GLFE 3PUZA 2ZRJA 2P65A 2ZE6A 4XVUA 3FMFA 1XF9A 3LA6A 2IA5A 4P4UA 3CNOA 3LVRE 5FPTA 4PC3A 5FR1A 5JJLA 3WP0A 4HLQB 1KJZA 4LJ7A 3U3OA 1CJKC 2VO1A 2CE2X 3CRMA 1XTRA 3NH6A 4MYHA 1T3SA 1E1QD 4P4SB 3U3RA 5A4JA 5DNYB 3K0AA 3VMFA 1TQDA 4C2TA 4RZ3A 3ND8A 1ZCBA 3FVQA 1NVVR 4B3FX 3UPUA 4KLNA 1XEXA 1RIFA 2EW1A 2R8RA 1SGWA 2OCBA 3A1TA 2YWEA 4FCTA 2PL3A 2WJYA 4DT1B 1KY3A 3OIWA 4QHYA 3KKMA 2LKCA 1Q44A 3DDCA 3U60B 2OFWA 3P26A 3A4LA 2DHRA 4JIMA 5JECA 2NO1A 2QY9A 1LV7A 4Q18A 4C2UA 4LPKA 1MABB 3IO5A 4FMCB 4DUGA 2WKQA 3AKEA 1KMQA 3FHCB 1OKKA 5EE5B 1MR3F 2RGNC 1HTWA 4KFSA 4L4UA 4UJ3A 5HCIA 3I32A 3THWB 5JRJA 2C99A 2ZSDA 1P73A 1N5IA 1F2UA 2XZPA 4HZUA 4NKRA 4PQFA 4XWOA 1GRNA 4C0HA 3SJBA 2D7DA 3WMGA 2WSSD 3MWKA 3FDIA 3BK7A 2YINC 3PITA 3NIBA 1O3YA 2JIZD 4M4SA 3A1UA 2W2VA 4URXR 2BM1A 1CXZA 4OHVA 1GM5A 2FZ4A 3TLXA 1IN4A 1HQYE 1SXJA 4Z8XA 1DVRA 1G6HA 3LWNA 4HZIA 5FTMA 5KSPA 2OFOA 3D7MA 2ZXUA 1IBRA 1VCMA 4ZCIA 1E96A 1G9XA 3K70D 2OCAA 1KO7A 4AKIA 4MKHA 2IWRA 3OEED 4B3XA 3GLHB 2OFXA 4M1MA 5C2JB 3A4NA 2C9CA 2ZE5A 1TL7C 4B6FA 5JS7A 2W0MA 1ZUHA 2N42A 1Z5ZA 3EIEA 4I4LA 3C5CA 1P2VA 1J90A 3ETLA 1R0YA 3CPEA 4MRNA 4KAXA 1X8JA 1TPZA 4KO8A 1E6CA 3PEYA 3OFNA 4TQUS 4Q1BA 2O52A 3AVXA 5BW8A 3SE0A 1KAGA 4C9BA 5D3QA 2IC5A 4CT5A 4WIAA 1ELOA 1VTKA 1S2MA 3TW4A 3VR3A 3AEZA 4Q7LA 1KK1A 1Q21A 4JBXA 4H1UA 2XEXA 2XXAA 3IEVA 4OL0A 1QHYA 4QBHA 3CBQA 3ZIAA 1IXSB 5KUTA 3BWDD 4MUBA 2YVUA 4DIDA 3VFDA 4CEIB 5JEDA 1Z47A 5C18A 1DELA 3T06B 1NVXQ 2WAXA 1R5BA 2ZJOA 4GBMA 5F3WB 3I1FA 2ANCA 4M53A 4R2HA 2ZUBA 4JL6A 4QRHA 4YQFA 1FL9A 4WW0A 4XWAA 3CF6R 5FUWA 1N0UA 1XTQA 4U7DA 2XOKA 3GD7A 3K0FB 3RS3A 2REOA 4MGKR 5C46F 1DADA 3B78A 4TQAA 3VR6A 2PX3A 3AVUA 1TF5A 3X1DA 4M1TA 4Z54A 1TADA 1RYHA 2VHTA 3K8YA 5EP1A 2Q9CA 1KO1A 2WPDA 1YRAA 1IOZA 4P33A 5E4FA 1R0WA 4PC7A 1FOEB 3H86A 3AF1A 1IY1A 1LB1B 1KTVA 1WE2A 4PAQA 4MYTA 5L3VA 2A3RA 4RD6A 1IONA 4IW3B 5BN5A 2ATVA 2J0UA 1R0XA 221PA 5TB5A 1G291 2V4ZA 3RANA 3Q7QA 1SZPA 2C03A 2ZS9A 1E2GA 4AWXA 4XJXA 3ZVRA 4DLTA 3GP8A 2PZGA 2A5JA 3DM5A 3IHLA 1TAGA 1CJMA 1P3JA 3QXSA 4QJ3A 3T5GA 3BH7A 1CJVC 1UF9A 4BLPA 2A5FA 3LDAA 3C14C 1S96A 1GP2A 1N3BA 1D2EA 4LHYA 1YZNA 3IO3A 5EP4A 1PLKA 5DLQC 4E5UA 1Z0IA 3E2IA 3Q8XB 4LOAA 4UXJA 1IY2A 3ZVLA 1Z83A 2UZIR 5EXXA 4EFNA 4LI0A 5FPYA 3RRZA 1YZGA 3VU9B 4NCNA 2FE4A 1DAFA 1KSJA 1N5KA 3QKSA 1MRNA 4Q47A 4QXAA 5SZHB 3ICEA 2V1UA 1G8GA 3I8SA 4CDGA 1ESMA 4PZYA 4YXWA 2OZEA 2FGKA 5E7JA 1L2TA 2VL7A 3LQRA 1XPUA 4QG7A 1TEXA 2CLDX 3GLIB 2PT5A 1EESA 1ZCAA 1RRGA 2W2TA 1E0JA 3KJIA 5CLQA 5FBQB 1YKSA 2DPXA 3FB4A 1F2TB 4MRRA 4JKIA 2N1BA 2QMHA 5G3YA 3CRVA 3KFVA 1U81A 4WVFA 1KDTA 1M2OB 2VF7A 2RH5A 3CRQA 5DYGA 1OB5A 1KJWA 1OFTA 3B7GA 1N0VC 4A8JA 4C7OA 2D62A 2QP3A 3B6EA 1OT3A 1QBKC 2QTFA 1JBKA 3B5JA 3TAUA 1N6IA 4R71A 4FCVA 1IJFA 1UBGA 4F91B
chains in the Genus database with same CATH superfamily
3LKBA 1XJQA 2PGDA 1NVWQ 3FPLA 3G02A 3V00A 4MWGA 1Z4MA 4NYIR 3I9FA 3IUNA 5J1SB 2IS1A 2R00A 3NG1A 1YULA 4GOND 5AK0A 3DBOB 1SBTA 1WD7A 3D4IA 3F7TA 1TEVA 1OLOA 3G7SA 4KIWA 4UM7A 1R9NA 1FZTA 2CUTA 4NFYA 3D6HA 2CK3A 1EK2A 1T0BA 1ZA1A 5BNFA 3KDAA 5CFQA 5LPNA 5ALFA 5MFPA 5LQAA 5IJ9B 4YRZA 3T1YB 2JLWA 4AY6A 1NR5A 1ZN9A 4LXHA 1R4NA 1TFRA 2GEBA 5KYYA 3ZJVA 3CWQA 1G20E 4MKGA 2E3JA 4C43A 3NC4A 4CETA 1DAKA 2ACVA 1DWOA 3NAQA 1Y1RA 2BR5A 3EJ6A 1Q3TA 3VDMA 2NXJA 2P69A 3LVQE 3WKCA 4CKBB 3HCPA 3LUCA 3OA2A 4RD0A 4W8HA 5AKLA 3SD7A 1ZIOA 3L4JA 2IQ5A 4H3SA 3A1EA 4RHFA 4WK4B 3P71T 3Q3VA 1C0LA 2BDUA 3R6LA 5HCUA 1T2UA 3JQ9C 4DJ5X 4KVZA 2MSCB 3IAAA 3BIJA 4GD3Q 1OE0A 3JVEA 1YS1X 1G3MA 3RH0A 2REBA 1F4PA 1DT5A 1RWOA 1X8LA 3FPCA 4JLOA 2E37A 4UBKA 3CMCO 4O4HF 5CLLA 3WGNA 5F9HA 2A67A 5KU1A 1BE1A 3C5VA 2A0YA 2OHVA 3EXEA 3HVIA 3TINA 2E2WA 3R3VA 4YA6A 4YJ2A 2R00C 2EX1A 1E2BA 4TV8A 1NVKA 5IJAA 1I5RA 2AC4A 2BM8A 2HU2A 4IMIB 2R79A 3SMVA 2QORA 1OIVA 2J5RA 1EM6A 4PRLA 3M1IA 1BJRE 3NR2A 3IFSA 3RHFA 2X1VA 3OCXA 4OXKA 3TSCA 4AO8A 1PUIA 4YJGB 1XZIA 2G0NA 1HE8B 1JEQB 1RCUA 1NW9B 1ZK1A 1Q17A 3TPCA 3EZXA 1EBUA 1GPUA 1HQDA 1IBMB 5EP2A 3AM3A 2CXPA 1IQRA 1FS6A 2WD9A 4CIVA 3DLPX 5BSUA 1XB2A 4H6VA 3WL3A 1F8YA 1GUDA 3K0EA 4MROA 3OTQA 1YA8A 2FVYA 2C3YA 4YQYA 1CZHA 1UBSB 4L15A 1PEKE 1Z36A 1ZHOA 4D4MA 2DFLA 3MUEA 4UNQA 2Y77A 2BLLA 3T1VA 1WY7A 2ETXA 2AGVA 4B5KA 2WSBA 3N87A 5JD4A 1O0SA 4C4TA 1WO8A 2HNAA 4BV8A 1BXKA 3PNYA 1E3TA 4I66A 1BVRA 1ZU4A 4ND8A 3AUTA 1ML4A 1XKLA 1K08A 4CF3A 1J20A 1JQJC 1G5HA 1RQXA 1ZQ9A 3ONDA 3L4KA 1T2VA 1HOTA 3MQFA 5GONF 3TIIA 3UT5A 4DR7B 2NAFA 1S2LA 3IBSA 5J2UF 5KTTA 4GM1A 1HORA 1PJTA 1WVGA 1AXRA 1AQLA 2IEGA 5ISMA 1SRQA 3SN6A 2AFHE 2ID9A 2PXXA 2Q27A 4WY2A 4ZYTA 5KKNB 2FMXA 2NU6B 4RH3A 2FLKA 5T57A 5EQDA 3ESQA 2VSNA 3OURA 1BN6A 1E7SA 1X7GA 1PR9A 2J41A 1QF7A 3PFKA 4GFDA 1H2RS 5IUKC 3IPLA 2AOVA 2I22A 2M9MA 2P1DA 2XZDA 3C5EA 4XB2A 3AFGA 5TT1A 1VG9B 2UUBB 3CVYA 1P1BA 1XOIA 2WJAA 3F7OA 5AVSA 1C3LA 1GNLA 4QRDA 4N54A 4N0EA 2QPLA 1H1LA 2P2CA 3NHFA 3QFSA 4FFWA 4LXYA 4N7BA 4P7KA 2XR1A 4B76A 1OXBB 3PYMA 5CBKA 3ZE9A 5KOJA 1ZOLA 1RZVA 2VDVE 3CNLA 2Y1KA 5F5NA 5A9TA 5FB3A 5IFLA 3Q2OA 3VRHA 1T36A 2Z0MA 3A9RA 1E3IA 3I92A 1CQIA 2ZUDA 3FVVA 4WFKA 5FOVA 4BC0A 3E3MA 1EXNA 3H5VA 3HCAA 1RRMA 2LE0A 4L75A 1D4OA 3N2YA 2X3FA 1Z15A 2VUIB 3L49A 4X20A 3UOGA 5KNDD 4FYKA 1GRQA 2HCFA 1TCUA 2WWRA 5LBIA 2X0KA 3AJ9A 4MQ5A 7REQA 3LYUA 2QXYA 2P5TB 5I9NA 1RPTA 3N58A 1D2CA 3OKPA 3IVXA 1CRWG 1HT2E 2VUHB 3REFA 1VJ0A 3E9RA 2P77A 3ZEIA 1MAWA 2FIQA 2W4MA 5BSVA 1W2HA 3PVCA 4GBGA 3JRNA 1LTKA 2H2HA 2ZITA 4TX1A 2OFFA 2F62A 4HVLA 1IAQA 3EEOA 1TZMA 3WKEA 3W79A 3ZXSA 3B8EA 4BQOA 4BRZA 1V8BA 1GIAA 1CUYA 4L3WA 5JXHA 3LVBA 1JHQA 2F48A 4ZGGA 1GCAA 1NI4B 3QKIA 4P0TA 1QS0B 3GCZA 3T3HA 4BNVA 1D3AA 3QIVA 4OK6A 3SMQA 3HMKA 4UDOA 1HT3A 3DOHA 3GPDG 3PPXA 3H2JA 3LUDA 6REQB 4OBXA 3ZOKA 1WB9A 3TGWA 3K6KA 3L1VA 4IILA 3H75A 2PT7A 4H1HA 3RASA 4BGDA 2P11A 2JGLA 1QJCA 2SECE 5D3KA 1F48A 1IZYA 3PRKE 3HE3A 1RCTE 5CFZA 4UCWA 5HUHA 4Z4CA 1NOJA 3BEDA 5AVJA 2B6HA 3ZLUA 2RCNA 5ADWA 2ADMA 1CNMA 3VA7A 5K8LA 2HH9A 3AMVA 4V0RA 3UANA 1UMBA 2Q1YA 1ACMA 2BFEB 2Y2UA 1SB8A 1YVUA 2YJ5A 2PBFA 4R40A 3N8IA 4JP5A 2FWBA 2MSEB 5HF6A 2O7VA 3TSWA 5E2IA 3AB3A 1JDBB 2P5UA 1LRKA 1PL6A 3VC7A 5K09A 2BEKA 3PDIA 4GI5A 2OXIA 1PE0A 1QKKA 3CY6A 3FUWA 4CM9D 1XJ0A 3IVGA 5LQDA 2XCRB 1MIOB 3BS4A 2B9VA 3B9PA 4KMMA 2DC1A 4Y1GA 1X7YA 3ZHRA 1QE5A 2PGLA 3MWFA 4DCMA 2B8NA 4MVJG 1EVJA 5B4TA 4GGOA 1C7QA 4GI2A 2J3MA 4KJZA 2P0EA 1EDDA 4FC6A 1Q5PA 4HY3A 1FFSA 2DLNA 3PHLA 1QR2A 3AEYA 4UEWA 1Z5NA 2PNJA 4BYGA 2YKGA 1NQWA 4JBGA 4R0MA 3JR3A 3AG6A 3DVLA 4DIOA 4EB6B 1ONOA 1I4OA 3TQFA 4ZK6A 3GLFA 1L7OA 1M7BA 3MGKA 5FKJA 5JVDA 1LDGA 3F5SA 3GAMA 1C0IA 2Y1OA 4QULA 2ZUFA 1FZQA 3NTUA 1YDEA 1MGPA 1DZIA 4YY3B 3A4MA 3DV2A 3BMQB 5K3FB 1QDUA 1XDGA 4ZCQA 1JQLB 4ILEA 4NXNB 1G3QA 2LW7A 3QFTA 5I8ZA 1X6VA 3FUUA 1YB1A 5EUQB 1R0CA 4GBED 1VMIA 2P40A 5KCMA 2O2CA 2YL2A 3TOCA 4DADA 3WB2A 3ZDDA 1VRCA 5FBRB 1TLFA 3S44A 1L7NA 4R83A 4IXNA 1JXAA 3SSNA 3GZNA 4B4VA 4JLVA 4XJTA 1HMPA 3ZCTA 3RUEA 2D5CA 1SJ9A 2V4MA 3U3DA 1O97D 3EOBI 2X41A 1MJNA 5EFOA 2GTPA 3KC2A 3MCTA 5DX1A 2OCXA 3GVXA 1V6CA 3Q1KA 5DCWA 4KXUA 1W6RA 3UFBA 5IANA 3BMCA 1AHPA 4WESA 5LDDC 1B2LA 1G8MA 3JQ8A 4LRTB 2GUWA 1SK9A 4UCXA 3RS2A 5HYVA 3DE3X 2CN1A 4GXNA 4AJPA 5ELXA 3UFXB 5FLYA 5ALZA 4JI1B 1YKFA 5I8WA 5B2FA 3OZDA 3P8ZA 4PO9A 1N5OX 3MFYA 4R7TA 4FGLA 3FDXA 1NSYA 2X6TA 4MVYA 4DBLC 3Q8MA 2BJHA 3ANXA 3RC7A 4AUNA 3SZ3A 3D02A 4E22A 4LGYA 4DZTA 4DSUA 5K4GA 3KQHA 1QP7A 1E9BA 2HF2A 3ELUA 4IG4A 3EEQA 1KVTA 3QX8A 3CS3A 4I5FA 5IVPA 3TI7A 4MB2A 5ALDA 5TV2A 2O23A 2X8AA 4RLFA 4BX9A 1C1YA 2HYIC 3LO8A 1JWAB 2AEMA 1COZA 1RHQA 3ZLVA 2XGGA 2E5LB 3LUGA 4NMLA 3WNDA 1MJFA 4PWZA 1N2XA 1QIMA 3U0BA 4MP3A 4DMKA 1Z6XA 3PQ8A 1LW7A 3CH6A 3TTTA 3F9RA 4OXRA 2OHJA 3LCCA 1PL0A 5EKTA 4TYYA 4ZVSA 4DMMA 1JLMA 1G55A 4DDWA 4QOIA 1FFEA 1SCDA 4KN6A 1BCRA 1QHHA 4ZHQA 2IQIA 5DTEA 4RTLA 1SQSA 1DKRA 5I8PA 3CUYA 1E6UA 1JR3E 1EWKA 1N5LA 1KJJA 2AJTA 2BTQA 2IBMA 2WIFA 2XUFA 3QJGA 3OIDA 2IZ6A 3RGWS 1F20A 2DWQA 2QP4A 4R8SA 4B8YA 3U7HB 3A2KA 1VJGA 1RI4A 3V4PB 3FCSB 3WYGA 4WACA 3B8HA 3QV1A 4B2IA 2GM4A 5G0UA 2JASA 1O54A 2HUPA 3ZV5A 3R9KA 5FIUA 4BLQA 5ICGA 3QOFA 1YD7A 1AKTA 2CXOA 1H23A 3BILA 4PYQA 1QRDA 4Q1EA 2RGWA 2OAP1 1Y98A 5CDGA 1QTRA 5JXIA 1XLTC 4OLHA 5KEIA 1F6BA 1P7WA 2R4TA 2AF3C 4Q3BA 5K3DA 1J8DA 2YWBA 3U17A 1ECGA 5EIWA 3VNAA 4BFCA 4KMRA 1DXOA 2A0KA 2A86A 2J31A 3AHEA 3IKLA 4PX2A 3J81k 3AVTA 3ZVNA 4EI8A 2JFXA 4F8JA 1BJTA 4NQRA 3FFAA 5FTLA 3I9OA 1EX6A 2WWGA 3BL8A 4D79A 4LBYA 3GEPA 2QHXA 2VUTA 4NMMA 4Y1EA 1N5MA 1R6AA 1D2MA 3A1CA 3I1JA 1YJ8A 3KELA 1WHTB 2VRCA 5D85A 5J5VA 3EQ8A 4MUIA 2WTBA 2G4VA 1CYEA 4Y8VA 1U0TA 3TZHA 2F1HA 1ODLA 5J3JA 1RS0A 1C7ZA 4F56A 2HF8A 2XMQA 1RLOA 1DQSA 3N5CA 5IAKA 2QL9A 4OP1A 3WLAA 3ZZTA 2JB9A 1KQNA 2VYFA 1QK4A 4G5RA 2POCA 2ZQZA 3VU8A 1SBCA 5DO9A 2I6FA 3AERA 4FQ8A 1RKQA 4LKOA 5CX4A 3EMKA 5BUSA 5I7EA 2V3WA 1FIUA 3EUWA 4AKSA 2HCTA 5K0LA 5LKRA 1R0KA 2WOJA 3NBUA 3NUZA 4HTAA 1ECFA 1SVOA 4LDRA 5AT1A 3CVXA 3WA6A 3U39A 2IYZA 3DDSA 1BDBA 4IQGA 4PYOA 1E3EA 4EZIA 3NYQA 1TJ3A 2RG1A 2GN8A 2Z83A 4HYYA 4IQ8A 4GGPA 4C0JA 4IKOA 4CE6A 1GG9A 1E4EB 4UUNA 3SZUA 3COVA 1PI3A 3WGYA 1CFZA 4TKLA 5E4JA 1FVHA 4HAOA 5H8WA 1QTQA 4I4TF 4P2BA 3GFVA 3CG4A 3Q8LA 4N0PA 3EC2A 1X14A 2XT0A 1VKJA 1C9DB 1EUCA 4XYGA 4AP9A 4YBRA 1EFLA 3RQIA 3EUFA 3VO1A 1N1MA 3LP5A 1QU3A 1Q7TA 2W71A 1M6NA 2N9UA 5IKPA 3G5LA 5HE9A 3ZKWA 3U81A 3C6KA 3EMVA 4FDVA 5IASA 3THXA 1CY0A 4D4HA 4HNSA 1HURA 2WA2A 1MH1A 1VIDA 1DJLA 1CUSA 1B73A 3B9RA 3TW8A 2JKVA 3QNWA 4EYGA 1ORHA 4PFSA 5HKAA 3JAWB 1M66A 5K0EA 5L3SA 2HA6A 4HMQA 1UKZA 4B45A 4EGQA 2X5NA 3GLTA 4I1SA 3PE4A 2Q49A 3OTGA 3WAGA 1K7CA 2ZT5A 3OETA 1NQOA 3W1VA 1UWLA 3KNZA 4R84A 4W9MC 3IQWA 2Z8YA 4QYIA 2J32A 3N7UA 2HCJB 4UCQA 4QBIA 1M1NA 3I28A 3GMTA 3O4HA 3PZBA 5JMPA 1WVIA 5LZ8A 1MIHA 5HKKD 5IRCD 1PG2A 1W59A 2BEWA 4XWYA 2JGIA 2CMDA 3PT9A 2G5CA 3NCTA 3LRTA 1WMEA 2PL5A 5AKXA 3IS3A 2OTCA 1YVPA 4N8EA 3EARA 1O94A 1RYZA 4QOJA 3S2GA 3CSUA 3HPQA 2YMQA 3H1PA 3RWMB 1T9CA 3A8TA 3QP9A 1YZQA 2BMAA 1AUPA 2F9LA 1JG1A 3EZYA 4MW9A 4X1YB 1GPBA 3GBPA 3KBOA 2Z2KA 3LC0A 3T94A 1YQQA 1W52X 1U7PA 2F3QA 1KYVA 3ZWKA 1QZ3A 1IZ8A 1CRQA 1TFUA 1MENA 3EHEA 3MG9A 5AW5A 4J29A 1B0UA 3WFIA 4URYR 4WK2B 4EGCB 2P6OA 3B3FA 3HEMA 2JRLA 5LOVF 2FQYA 2D59A 2W2NA 1INLA 4TXJA 5A3VA 2M1XA 2C4WA 9MHTA 1GL9B 1WB5A 3J7AC 1LKZA 2A0FA 4JYZA 2O3JA 2AEJA 4YGXB 4L7VA 1GTVA 2IUSA 1M83A 1U2TA 1JG2A 1GNPA 3KAPA 4H7JA 4LXQA 4PYRA 2V7UA 4R6WA 4DA7A 1L3CA 3DEIA 3H9GA 3LP8A 1GILA 1UZMA 1A9ZA 4WZBB 3N2KB 2OC9A 3QKUA 2BMVA 1XQXA 1JTVA 1RI5A 3C6MA 4I1OA 4JGGA 4L5AA 2VHQA 1GGFA 4F11A 3RTEA 2QRMA 4H16A 5LJLA 5ALVA 3VR0A 1USUA 5ENDA 3QZUA 3SDZA 2DPYA 1Q77A 1U3UA 5EJFA 5L45A 1PZXA 2C61A 3JQ7A 1BTOA 3LZCA 3AYXB 3S4YA 1HV8A 2PCJA 2GM5A 2WYHA 1TVKA 4G0QA 1H3NA 3MT0A 3KT0A 1O5IA 4P7GA 2RARA 3DMYA 3ABRB 3NDJA 3NDPA 1H0SA 1UP4A 1YB2A 2VP9A 3M6IA 4JLUA 2JGDB 5TF4A 3TDNA 4D81A 3QXHA 1OKKD 4OX9B 4YRRA 2Q2OA 2Y92A 4LY3A 2D5BA 3HCNA 4PXYA 3CNEA 7ABPA 4ZVRA 4BNUA 2H5JA 4ZKEA 1GQRA 2Q0HA 2YVQA 3TIGA 1II9A 2VBCA 2ZUCA 1WBJB 4RY0A 5T41A 5I47A 1XEFA 2Z6QA 1ZDMA 3OY2A 3PI6A 3K9GA 2IU6A 1ESNA 2O7QA 1PR5A 4O4LF 4MUEA 2WICA 4FW9A 2N0SA 2XTZA 1YTUA 5BT8A 4DW8A 1UADA 1VHTA 4RYLA 4BAUA 2QTCA 1NE7A 1WDTA 2C95A 2EP7A 2LIPA 2NZYA 3DYBA 4BBJA 2CF6A 3JYQA 4IRMA 4OLFA 2VRBA 4AN4A 4B0OA 5DHRA 3RC8A 4PNPA 2AI3A 1DZ3A 1F8GA 1PQPA 1XDWA 1LBEA 3II6X 1HUQA 2Y76A 3EFHA 3N2NA 2DB3A 4RV9A 2O59A 4HQRA 2WNHA 3L01A 4KAFA 2GCOA 4C0WA 1OA1A 1OX4A 4G25A 2ROQA 4M49A 1Q1NA 3W6PA 1Y1QA 5H4GA 4KE8A 4KQJA 3N2EA 3JAMA 4FFBA 1D2GA 3ANNA 1TW3A 1Y63A 3KJXA 1U7OA 4MS3A 2IW3A 3RODA 3UFXA 4BX3A 4WFIA 3TKLA 1L5ZA 4ZT7A 3WWCA 1E7RA 3QX3A 4KO2S 2QR3A 4MGHA 3N8KA 1DG1G 4BRSA 4D0GA 1C9MA 1U5AA 3IMCA 5KVQA 4I4IA 4XIFA 4YRCA 1WKCA 3HXKA 2X0FA 4B40A 4TT8A 4C7MA 3ZVMA 1W25A 5JCJA 3KEOA 5HJ2A 1XZJA 3R0ZA 4YRJA 3QMVA 4INJA 1FW6A 1ZUIA 2NZUG 1UXKA 2GX6A 4U6QA 2IKSA 1WPXA 4HHEA 3TSAA 1B74A 3VHXA 5KNDA 4ZEWA 5LYJF 4DR6B 4BB5A 5GIPE 1H93A 1LPMA 2QE7A 1FTYA 3HYRA 3AR7A 5TPWB 3JZFA 4M7OA 4LYHA 3WG9A 2WAYA 2XWQA 2QBYA 2Y1EA 4W5NA 2CJWA 3V4LA 2H1OA 3HZZA 1NYLA 1DAIA 5FOXA 4PO3X 3DB2A 1NJ5A 2EF0A 4D3XA 3M9WA 1ANKA 1BIFA 3L8CA 1UDAA 4HDRB 1VPEA 5K9ZA 2C2YA 4DKXA 1DC4A 1A3CA 5JD3A 2D1QA 2VAPA 1L1RA 5HKBA 3L40A 5K2MA 3P9YA 5IXSA 3DE7X 2CGEA 2E85A 2JLCA 2VWPA 2IL1A 3BSFA 3CF2A 1RQPA 3FCAA 1CU1A 1U94A 1X70A 4PQRA 4QRIA 4Z0PA 1E0KA 2A9JA 1ULUA 4IDHA 2JFOA 1SXGA 2GFHA 2J9FB 1YL7A 3JWEA 1LLCA 1EQ2A 1YI8A 4KIJA 8MHTA 3J81A 1WXDA 3AF2A 4R2XA 2AQKA 3A2MA 3AI7A 2O2YA 3KAKA 2XA9A 1SELA 3V9AA 2FPKA 3T1TA 1NQ5A 4FT4A 4JLPA 4LE1A 2PMDA 2J3LA 1HOXA 3KRTA 3SQMA 2GETA 1EWQA 5CIYA 2QG4A 1U90A 5JE8A 2X9GA 2ONCA 4N1AA 2HRCA 4YCBA 5HKLA 1BMFA 2YJNA 1A76A 1DIOB 1OY1A 1TK3A 2Z8YM 4DT1A 3NRCA 4O5AA 1ZXBA 1SG6A 2FX3A 5A0VA 1GL6A 2BGUA 3SX2A 1FF9A 2I7XA 2NQ2C 3PXCX 1RBYA 1W9HA 3HB7A 3CEAA 1NJ6A 1H1DA 4R3WA 3SWWA 4QO8A 4KIGA 3GJ7A 2C9DA 1LDEA 3LK7A 5L7TA 4HH3C 1M1YE 1YUNA 3MF4A 3PQEA 1A5ZA 1J2YA 1AD2A 1VZ2A 2IRWA 3CPJB 3KOYA 3A9VA 5JDCC 2ZJ0A 2VAWA 4AY5A 5JSZB 2C9MA 1MX5A 4NAUA 2ZM6B 4N7JA 2PRSA 3FYHA 4GWLA 5DTIA 1RI3A 4Q16A 2CYCA 3QG5A 3IQHX 1XXHE 4X3CA 1GPLA 4JI2B 4Z4EA 4OEHA 1VGQA 4JUDX 4BNHA 3LM8A 4V0NA 5HS6A 1RXEA 3CO0S 4W5TA 4O5OA 2R4QA 1P80A 2ZBVA 5HPYB 1ZM9A 1PJBA 2VQFB 1DBWA 5ELLA 1GVHA 3SZGA 3L5OA 3KVOA 5C8YF 2GFIA 4LG1A 4L5YA 3B6MA 4YJFB 3TNDA 4PNZA 821PA 4CKEB 1A9RA 3DQQA 2XRZA 3L8MA 2CFRA 1M8JA 1YJXA 4RVDA 2QGZA 3LCUA 3REQA 5FXMA 4DLPA 4XGRA 4YJ3A 4RDIA 4S2EA 5JCOA 3LTEA 4BNJA 3NI2A 1FPMA 3VSCA 1NPTO 1NRXA 3L4EA 3TXAA 5IDYA 2QPOA 4F9FA 5CLFA 1JFFA 2VJBA 4K2AA 5C0OE 4DR4B 5TJ9A 3SFZA 1RM3A 1K89A 2XUQA 4LX8A 5DSTA 3U7FB 5K6TA 1WBDA 4K40A 4Y6LA 3W77A 1L4FA 4FJ0A 4TUYB 5H1YA 1VP9A 1A2OA 1PYOA 1EPUA 1T6ZA 3HFJA 1MB3A 3NNDA 2GBFA 4EYSA 4CL2A 1SUAA 2PRZA 2CJFA 1I3NA 3VZCA 3BTVA 1EVLA 1Q3HA 4DCNA 4GOXA 3B48A 4MKXA 1QRRA 1PR0A 3C16C 2FV8A 4Q7EA 1PQUA 3D3WB 4C06A 3CT4A 2N3ZA 1U8CB 4UVGA 5E1BA 1GGNA 3JZDA 4WVLA 1QF6A 1IBSA 3DLHA 3N05A 1NMXA 1SU6A 3HU3A 4CKCB 2SHKA 2PTGA 2RC5A 1EQUA 2Z98A 3QVVA 1JFTA 1QHNA 2C4MA 1EUQA 3W5SA 3PUHA 3DO6A 1EMDA 3RVLA 3WIVA 1T10A 1NTOA 3OZCA 2W6PA 5EXPA 5FYDA 2TSYB 4J0EA 5D6OA 1HGXA 4KPUB 2NO9A 2I1LA 3PZRA 4DRXB 4N3NA 4IBOA 2AOXA 4A5OA 2OG1A 3QM1A 5EMJA 3QKTA 2HADA 1MOSA 4UUBA 3VZBA 2H1SA 1SCUA 3R0VA 2PUHA 2I8AA 3PX7A 1ZJ4A 3P0RA 2RAFA 2RKBA 3CNHA 3L0OA 4AJKA 1BMFD 4J2HA 1UEJA 1Y34E 1N36B 2ZDHA 3CX8A 3ZZ0A 4BU0A 3WKDA 4LHSA 4YR7A 2Z9CA 4RK5A 4QJ5A 3HU5A 4II7A 4RXUA 3QE4A 1EB9A 4HMPA 3V55A 6YASA 4WGGA 4G89A 4GZMA 4AZ0B 1PGOA 2XODA 5B53A 1Y5RA 3ZY3A 2JFGA 3PYLA 2V0NA 3HDJA 4CL0A 1N1GA 2PQ0A 5U1PA 1IK4A 1P6QA 1CB7A 3NEJA 4BMCA 5CP8A 4BLTA 4FGKA 3QHQA 4KSBA 3MOSA 1XPJA 4PSDA 5FOUA 3HBFA 4TRJA 1GRVA 3RIYA 4FWTA 3BDAA 2DY1A 3LT2A 4MP8A 2I7DA 4GVPA 5SZKB 3VBCA 3W8DA 4UVDA 3V1LA 3IPXA 5E6SB 1HE4A 3G9TA 3MQ4A 3NHWA 2XBUA 5JWOA 2FF7A 4Q39A 3EOAI 1QUEA 2G9ZA 4BFXA 5AKHA 2XGOA 2HOQA 3B2QA 4KXQA 4JAVC 2JHAA 1PV1A 1F5SA 3OPXA 5HILA 4N5DA 1KEKA 2UV8A 5FLEX 2PRKA 1NJSA 2WTAA 2HCRA 1OIXA 2F8MA 2N47A 5GONA 4KYTA 4DIFA 3TW0A 2IV3A 2GB4A 1AC5A 3PENA 1I10A 1SOMA 4GUAA 4FMCF 1S3SA 5KX5B 1AKUA 4TV8B 1JEEA 1KVRA 1U28C 3GELA 1UKBA 1THMA 4EMSA 4JK3A 4K05A 5EZYB 2FSVA 1PG0A 4DCVA 3JWJA 4CMBA 5KTYA 3QUAA 5L3QB 2HQSA 1XTPA 4F3NA 4EH1A 1VBNA 2QRQA 1FLAA 2ZE7A 1AGRA 3WOHA 2HSEA 2P6PA 3I2HA 2ZRPA 4BV2A 1YS7A 2VBFA 3NNSA 3U16A 3LFTA 3ZW9A 1PEYA 4TZTA 1J1IA 1IWBB 1ITZA 1GN8A 3BK1A 4HDOB 4PAGA 2IWHA 3SLRA 3N2ZB 4EYEA 5JSZA 3QBTA 3PEUA 1JHVA 1G8FA 2ZUEA 3W5CA 3EEFA 4E4YA 2V7PA 2QUHA 3E81A 4AMYA 5BWMA 2FZLA 1HY3A 1TCVA 2QSUA 2QTBA 2VCYA 4MWBA 3TSOA 1XZ8A 4FYXA 3IBFA 1SPXA 4QYWA 1QLJA 5L6LB 5BMVF 2BEJA 2PY6A 2WM8A 3QEJA 1WUHS 2PMKA 3DZCA 2OP1A 4RPGA 4W82A 5GJWC 3RT9A 5HX7A 1VI6A 3RJMA 3NORA 2YTZA 1NUQA 1H0RA 1QVWA 2W58A 3MHPA 1YRQA 5AR1A 3GWGA 5FPPA 3SP1A 3HXPA 1EDZA 2UYYA 3AJRA 1V3VA 4NCXA 5LZ5A 3X43A 2WIKA 5KDDA 2P0AA 5EKSA 5IMBA 1XMIA 5EESA 1HBJA 2P9YA 2CWDA 5DGTA 5ARDA 2O7NA 1VLMA 2IY9A 3JARB 4L9AA 1RFLA 1U1IA 5FRDA 1OWNA 5FWDA 3RTGA 2Q1UA 1X7YB 2PUVA 2PQMA 5DBOA 3U1TA 4DLXA 4QZVA 1L5NA 3A10A 1FFGA 2I29A 3QYPA 4RCVA 4WEQA 3LT5A 4BP8A 1O2DA 2QQ5A 4P84A 5B1HA 5HVNA 2O48X 3H5LA 1VA4A 4U9HS 3L9WA 3H18A 5FJIA 1KQFA 5K3OA 2WD7A 2IZ0A 3WIDA 1GCUA 2W2OA 3KYCB 3LF1A 3OEWA 3JASA 5KWEA 2CLMB 1ZCZA 1P2TA 4ZCTA 1ID1A 2K2WA 3G5TA 4RF5A 5JOQA 5C9ZA 1SA0B 4R69A 4MUGA 1JILA 1L5RA 3FDZB 2JFWA 3IAEA 4NU6A 3KJGA 3RTBA 5LR6A 4AB1A 3WGIA 1CF4A 2VP5A 4XOIA 1IN8A 3CUKA 4N12A 1P61B 2C84A 2ZYVX 3A37A 1R4MB 3RBXA 3CR3C 3FGNA 2XAAA 3QFRA 2XHZA 4Q4AB 3WXBA 2PKXA 3HNPA 4A91A 4D4GA 1TGVA 4I3HA 5C5CA 2J6IA 2WHRA 2GJAA 2JIZA 2Q4RA 1QZTA 3I3SR 4DLUA 1XN1A 5FBWB 2NADA 4KZKA 1SBQA 4YLYA 4MNTA 3NZEA 4NY1A 1LZKA 1CB0A 2WIAA 2HDOA 2J6HA 3FGZA 1M2JA 3UJ9A 1GUFA 4A6XA 5INTA 2VTDA 3PC7A 3HLYA 3JQFC 3GRVA 4GSKA 2IX9A 4MUKA 3E2PA 4OA5A 1VQ1A 4B3SB 2KBFA 3ZYZA 2DE0X 1ZMOA 5KNCD 2BTOA 5DHFA 2GPJA 5TE9A 3OE1A 1G1AA 2VATA 3FPBA 3RVKA 3WQSB 4DHEA 1SKUA 1PYDA 3A9CA 4K9RA 1MMFB 3JQGA 4E07A 4ZFNA 3W0LB 1CZRA 2J8ZA 1YR1A 1PK9A 1H66A 3KV3O 1VJTA 3S6JA 4DM4A 1BFDA 3I9KA 3TOXA 3C85A 3HTXA 4WBNB 4YMTA 1OYWA 3O47A 4GI1A 5LA6B 2BE9A 3LLVA 5K8JB 3GFGA 5H16A 1GD1O 1ETHA 4IDAA 5JFGA 4IF6A 1RRVA 4I3GA 1FP1D 4LOIA 1JEQA 4NE7A 4YO8A 1LDYA 2QI9F 1U9IC 4G36A 2OGTA 3NJRA 5DNUA 1QP4A 1PKEA 3F47A 4NCIA 4BNDA 2XZTA 2X5JO 2ZG6A 1N25A 1MJGM 1W4ZA 3UAOA 4DAEA 4BZXA 3ZIAD 4W99A 4ME6A 1Y9JA 4G8BA 2G63A 3OZSA 4PS0A 2PLNA 1TM3E 3I52A 1LGYA 2IYUA 1WZEA 5LQCA 1TF2A 3R7AA 5A5DA 1THGA 3WLIA 3G0HA 3SBDA 4D9BA 1HLGA 3HEAA 2C4VA 1M8PA 5KDLA 1NA5A 5A1JA 4G0OA 5ES4B 4HD8A 4BBAA 5IJWA 1FJXA 3P9NA 4GT1A 1ZINA 1W35A 2ZVDA 4NH0A 4I46A 3WFJA 2FW6A 4AS1A 3O75A 4ZVKA 1AA9A 1R3UA 4PANA 2JFUA 1UBMS 1TYZA 3QH4A 4YJHA 3DFFA 3VU1A 3VZRA 3WC4A 1E1KA 1E6WA 3QYFA 4LC9A 4QUBA 3T5DA 2BKEA 1Q11A 2EHJA 3O91A 4KQMA 2Y1LA 1QIGA 4GE3A 1P2UA 4IIBA 1ZVJA 3IT3A 4XE5A 4MRMB 1G4UR 3ND5A 4O4JF 5K1ZA 1S3FA 3OPQA 5JYCA 4JBYA 5BNZA 1UK7A 4NOLA 4C7BA 4CLOB 1R2QA 2ATIA 4UAVA 3GP5A 2V3VA 3B51X 1JB1A 3ANMA 1Y81A 4Y1RB 5A5GA 5H81A 2P4EA 1EGAA 4O63O 3RVDA 2E1PA 3INYA 4FYYA 1M6VB 1NBWB 4CQJA 1KMIY 2NPOA 1BH6A 1SUIA 3AQ4A 3DOCA 4BV9A 3BE6A 2DHQA 3KYDB 3ZU6A 5AVZA 2G4LA 2VYVA 4MGYR 3VJMA 2I4IA 4PYKA 3GVHA 4F3RA 1P4HA 4W9NA 3KJQA 4DLAA 1TVMA 3FNEA 4NBUA 3TTXA 2BGRA 4D45A 4LN1A 2WZBA 2JDID 4J0JA 4KUHA 4NTZA 2EEZA 4XX1A 5E7IA 4ZGWA 3BTUA 4U2GA 4UZSA 4R98A 1UODA 5B7QA 4FR5A 2HV9A 2CCKA 1N1DA 2J4FA 3NO4A 4GHWA 5JZSA 3C1OA 4ZPXA 1UOEA 1AY0A 1SKBA 3OLWA 3EXEB 1JKIA 2FFHA 4NL4H 3OX1A 2J9RA 3IMGA 3PFNA 1ZIPA 4QSMA 1NVTA 1ZSVA 3EEIA 4FDTA 5E6UB 5KUTA 1SBNE 3T7IA 4JVOA 2P9TA 3HUEA 3N75A 2Y1XA 3BGVA 1U0RA 3AUYA 4YJHB 4DBZA 1SQGA 3SJZA 4D4JA 4QTXA 3EVNA 1IB0A 3PDIB 2YIJA 1NI3A 2VI5A 3M7IA 3PGXA 3UG6A 2QRGA 4NFHA 2JLSA 3GMSA 1P1KA 2UYQA 3WYAA 4YMUA 1KZGB 3H1AA 1G5FA 4LVOA 3GP3A 5DWQA 4OQNA 2EU8A 2NYAA 3INGA 4K6OA 5EAIA 4H7KA 5FWXB 5I4CA 3OD5A 4WNYA 2DX7A 1DC3A 1MFPA 2XX3A 1XF1A 2OEPA 2ZT8A 3IBTA 1ULBA 3KUXA 3BJEA 3I1YA 3C6BA 1SXHA 3D54D 3QU5A 1Z6QA 1VKHA 2ZS8A 3A11A 5EKXA 3DMFA 4KU4A 1E4OA 2HV8A 4P81A 1M5TA 2VQDA 2EHDA 2ZFUA 3W6OA 2B94A 2C5FA 2O2SA 4HBZA 2P7HA 4CLEA 2A33A 3CUUA 3M4NA 4KFRA 2VJPA 4QVIA 1EEXB 2ZJ4A 2IEDA 1QNLA 3F3YA 4INOA 4P31A 1DAGA 3DAPA 1II0A 5IBCA 2IVZA 3VPFA 5EXDA 1CUZA 3ADCA 3IQEA 3RS4A 4KLZA 3EYAA 5K3FA 1GZUA 3JCZA 2HEIA 3FCYA 3WJ7A 2G3YA 2WJJA 5CMLA 3AESA 1NXSA 5A5FA 4YECA 3U6BA 3PJRA 1KI6B 4NP6A 4WKPA 3WLKX 3GZ4A 2UUAB 1ZR2A 3EIXA 2TMGA 4D9FA 2E6KA 3AH8A 4K6KA 1KRHA 1LSOA 2RH4A 1CP3A 2XCOA 4GDMA 4PFKA 3TEFA 2EXXA 3L6CA 4MAFA 5CH8A 3BMOA 3BICA 3JD2A 3M82A 5FOSA 2NV6A 3SJ7A 4IWYA 1H5UA 1X38A 4HWTA 4L51A 4FYVA 4U4AA 1TYDE 3QFCA 4C3OB 3AIOA 4D9HA 1QHXA 4OSEA 4EHIA 5KTKA 5MF6A 1T5HX 1DRWA 1VC2A 3Q72A 2F1IA 5FOTA 3ZEAA 1BC5A 1E2MA 2F3PA 1KQ3A 2IHZA 3MB5A 4MB6A 3RS5A 3H11A 2JHCA 3ZU3A 1LFDB 2P6UA 1U1FA 2BZGA 1XP8A 2EGUA 5DK4A 3AQIA 3ZQJA 1BFKA 5JNSA 1H4SA 1JLRA 1NF2A 2QENA 3HCFA 3F5FA 4FDLA 5G3ZA 1AO3A 2BFCB 2ZRIA 3IAFA 2CV1A 4Q4AA 3TBKA 1A4UA 3JYHA 3M89A 4JB8A 4B2YA 3UXMA 3DBLB 3G2QA 2EG5A 4ZVUA 4BVEA 4CGZA 5EY5B 1TGYA 1EA7A 1I5OA 3QE3A 4L6CA 5KTSA 4MLPA 2B1RA 3DAYA 2Q9UA 5GJVC 4ZTUB 1GPAA 1SHLA 2E55A 1HYHA 2D0IA 6LDHA 1M34A 1JG6A 4IYJA 5DYWA 2MOKA 2PLFA 3I9V1 3SR4A 1OUMA 4HX5A 3RAPR 5B3KA 3VQTA 4IWXA 4EHKA 3VO2A 2PFKA 1QV9A 3NPAA 3R3WA 3VVMA 1ZD4A 4YV2A 4WL0A 2YOHA 3I30X 2PMEA 4C7KA 2DUWA 2EFHB 4YWJA 3ZDYB 3VTAA 3HFRA 4GYYA 3NHAA 2JGRA 4P1ZA 4S1PA 2H06A 1ATIA 2AD1A 2LGJA 4TXMA 4LVCA 3STXA 5CM8B 4B31A 1NUTA 3EVBA 4RL4A 5DI3A 3EG5A 2IDKA 4RPCA 2J33A 4RD2A 1O0CA 2A88A 3D64A 4CMGA 5IX8A 2FFQA 1A1VA 5C5IA 2PIAA 3WLJA 2BI7A 1O8CA 2H51A 4JBIA 4ZDIA 3GDOA 5DYNA 1Z62A