4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
1ZCAA 2MMGA 4JBYA 5JJKA 4MRRA 4JKYA 1P2TA 1Z2AA 3B1VA 3VX4A 5JS7A 4DZZA 1QBKC 2CJWA 1XTRA 4L15A 4US1R 2J45A 3GJ6A 1KHTA 2V6JA 4JKIA 4LBWA 1SULA 3TMKA 2YOGA 1FFHA 5FOWA 2ONKA 2PZEA 5SZIA 2V1UA 1J2JA 1GDDA 1VG1A 1D2MA 1Q21A 5DH9A 4BFXA 4KYUA 5HKKA 2WWXA 4LZZA 1UJ2A 1YQTA 3EPHA 2C96A 5GJCA 3AKYA 3U3JA 4PSAA 1RRFA 1EFRA 1T3HA 3S1AA 4LBZA 2N46A 4EFNA 3EIQA 3SU8A 2IYZA 4JVLA 2CVHA 2XGJA 3VNVA 4LHZA 5CJPA 4Q47A 2LCFA 5AWFC 2EFCB 3V9PA 1DG3A 4LJYA 4XOIA 2VP6A 5KNBA 1OYYA 1KDTA 1RRGA 3AP3A 4IEEA 4Z1MD 2O8FA 4ILEA 3ND8A 3E2IA 3WNCA 1DAMA 3UATA 4AYTA 4EJSC 5JECA 3PEWA 1P61B 1Q44A 2C99A 1XPOA 2V4ZA 1AZTA 5FR2A 2YKGA 2DWPA 5JEEA 1UDXA 4TMVA 5SZJA 4DJTA 1XZPA 1VECA 3GLGB 1H8EA 4EJSA 2B21A 2WWGA 1Z29A 2H92A 3RRNA 1LF0A 3KQKA 3NDPA 4BWYA 1GZSA 1U2RA 2IT1A 4NMMA 3AF4A 2YNMA 3QBTA 4U00A 1Z0KA 2PX3A 4FCWA 421PA 1KMHB 2DWOA 5EE9A 1GILA 3PENA 4TSFA 5C1BA 3ZGXA 2QBYB 2VSFA 1Z0IA 1BMFA 5FUXA 3BRWD 2GXQA 4MRPA 5CJ2A 2IUUA 3U3MA 4IOLA 1TUEA 4LGMA 1W36B 1DEKA 1VCOA 4A8JB 4DSUA 1W5TA 1SHZA 1JR3E 4I1UA 4A8JA 1E96A 3R8CA 1P9WA 4PO9A 4DVGA 2CCGA 5KHOC 2XTZA 3W90A 3I1FA 4LBVA 4G01B 3TQFA 1KI4A 1YR9A 3EPJA 5KO2A 2BBTA 2VF8A 1E9AA 1NN5A 5CIWA 1P62B 2C77A 4EPYA 4CVNA 4PQRA 1II8B 1RZ3A 1YZQA 1OSNA 121PA 2QTVB 4B74A 3AVTA 1U98A 4PQYA 4MYHA 1ZM7A 2PX0A 4XD7A 3CNLA 2J59A 5EP2A 3WYAA 4B6FA 4ESHA 5LD2B 2DY1A 4IVRA 4X8MA 1JAIA 2GK6A 3ETLA 2SHKA 3QUSA 4QL3A 3QG1A 5DI9A 3T5GA 4NYMR 3IHWA 5DI3B 4NCIA 1D6JA 4D0GA 2RGDA 4QNMA 2CL6X 1TPZA 4M9ZA 4ZCMA 2JJ2A 1W4AA 3MWLA 3CF6R 4DDUA 4OK6A 1GL7A 3ZD7A 1QRAA 4DIDA 2J41A 5BWMA 4IOMA 4EFLA 4Q00A 1W0JA 3AV0B 3FMOB 2ZRLA 4GZLA 1AQYA 2FFAA 2R8RA 4YMUA 3WMFA 3KJEA 2YV5A 4BLQA 1P9NA 1E4YA 3MJRA 1DE0A 1L8QA 3I62A 1EGAA 3OEHA 3U44A 2VHUA 5FL3A 3BH6A 4KSCA 2EYUA 2O0KA 4M0LA 1KJYA 3SQWA 1XU4A 3NTUA 4AIIA 3U44B 3ZD6A 1ZRHA 4ZO4A 1NVVQ 1OIVA 2CMKA 5H68A 5JHHB 2PEYA 1AGRA 5B58C 1V5WA 2GZHA 1XTQA 1YZUA 1NKSA 1UBFA 4RJLA 4Q9IA 4PPFA 2QORA 4URXR 3KQUA 1MKYA 2WJVA 2FSFA 2NPFA 2EU8A 3U4QB 3I8SA 1E94E 2BHRA 3OHMA 3AH8A 1FZQA 1U0LA 4RKFA 2GXUA 3CX7A 2GESA 5FBQB 1N3BA 3QF4A 1H8ED 2JASA 4HLUA 3LWNA 4B6EA 4MQBA 2AWOA 1FP7A 2DFKB 2O5VA 1HQCA 3QKTA 4WAUA 4MGZR 3RS7A 4BQSA 1KNXA 2HYIC 2KSQA 2ZRHA 1E0KA 1XJ0A 2GKSA 3X1ZA 2I1VB 2FG5A 1SXJB 3T34A 5J4VA 1KK0A 1UBEA 2AL7A 3AUXA 1MABA 4G0NA 2J1LA 2OAP1 5EE3A 3TVTA 2JJ1A 2YWHA 3I73A 2QY9A 2QAGC 4EIWA 1N6PA 3HPRA 3BAFA 2FGKA 4F7WA 3LD9A 2VP4A 4JLKA 4OI2A 1U8ZA 5TB5A 4C0HA 3RC8A 3VKGA 4FN5A 4NYJR 221PA 2XEXA 3F5FA 4KLZA 1I4TD 2AK3A 2I3BA 3T06B 2KB0A 3THWA 1KK3A 2GAAA 1EK0A 3I5YA 2A7QA 2GEUA 4MUAA 3W6OA 4F92B 1TX4B 1TQ2A 2WSSD 2UZIR 2B8WA 3CWZA 4XTRA 3WMEA 2V54A 2ORVA 3ADBA 1Z6XA 3G82C 4TL6A 2IYLD 1UKYA 4OQMA 3L0OA 4KI0A 1QHNA 4EUNA 4CEHB 2ZUDA 1ZIPA 1RYHA 1X6VA 1CR2A 1NP6A 3K0EA 4IKEA 3T1VA 1EFTA 1SXJA 5AJVB 4HLDA 3TIFA 3X2SA 1Q20A 2C04A 3A4LA 3HDTA 4O2LA 3B1YA 3RS2A 5TY0A 1G8YA 3K0CA 2ZSDA 5FTLA 2C5LA 3GEHA 2CCJA 2BMJA 4R7ZA 3FYHA 4XTCS 2IWHA 4OBEA 5JZVA 2MSDB 2WV9A 4WA7A 2WOOA 1R10A 5JSZA 1ZNYA 1E2MA 4BGDA 2QTHA 4TSFD 1XX6A 3EX7C 5FTNA 3CRMA 4PC1A 1KAGA 2F1RA 4LK2A 3VFDA 2F1IA 4C9BA 3U6BA 1A4RA 1GRNA 2PBRA 4FI3C 1FQJA 4RKEA 1Q0UA 5D3QA 3DVLA 4A0HA 1E1QD 2AFIE 1X1RA 5D3MA 1GG2A 4OKSA 3A1VA 2ZR7A 2OZEA 4QBIA 4JLAA 3WYGA 2C2HA 5C4GB 5BW8A 4Y0VA 4TYYA 3RNLA 2G88A 2VHTA 5GJBA 1M2OB 4PFSA 2H57A 2QP9X 3E70C 5FBRB 1ZD9A 4K8OA 4R98A 1II8A 2FPLA 2CVFA 2WJGA 1G5RA 4M22A 3K9NA 1TF5A 2FEMA 3DOEA 3VR4A 4L9WA 1W0JD 1E2JA 1IOZA 3B82A 2XSZA 4PPQA 5TXGA 3O8DA 1HH4A 3QKUA 3DEFA 2W2TA 3ZQJA 4LJ5A 2BM1A 4KAXA 1XPUA 1F2TB 1S3GA 2ZE5A 5FFMA 4LY6A 1F2TA 2GF0A 1LF5A 2FA9A 2ZRCA 4GRAA 1BO6A 4QOSA 4OHYA 3AP2A 1S1MA 1FP6A 2O8BA 1DVRA 2FSIA 3OE7D 3VR6A 4JLBA 1G5TA 5CITA 2WAXA 5AUOB 1NVWQ 1F2UA 1CKEA 3LBIA 1LS1A 1E9DA 2QMUA 4AKGA 4XSHA 4HB3A 4GP7A 2C03A 1A1VA 2W6JA 4AKEA 1XEXB 4G5SA 5E95A 5J40A 5EP3A 5JHGB 4DB4A 1G20E 3IQWA 2IBMA 3BFVA 3Q9LA 2FOLA 4IXMA 2RH5A 3TUIC 3DMDA 4P31A 3B1XA 3AVPA 1W4RA 3ZZTA 3QXXA 1G6HA 2FDCA 1P73A 1G3MA 3BOSA 5KPDA 1OB5A 4TYWA 1GSIA 2ODBA 1CJKC 1TF2A 1HEIA 1AK2A 3WP0A 1X8KA 1LV7A 1DOAA 4GOXA 2O8CA 3DO6A 2FGJA 4V03A 3CBQA 5K8TA 4XSGA 3W5JA 1XCGB 4C2TA 2XB2A 4LPSA 4NZYA 2UKDA 3H0KA 4YDHB 1W4CA 1Z5ZA 3CF0A 4OL0A 4C3ZA 1JNYA 1WDTA 3Q7QA 3K70D 5EUMA 4ZDIA 2IHBA 2FSHA 5HE8A 2JJ8A 2MSCB 4DLWA 4R9UC 1XJCA 3SJZA 1SXJC 4B2PA 3THXB 2FZ4A 4TLBA 2R65A 4B35A 2WWIA 4LYFA 4AYWA 1M1YE 2HXSA 3O8BA 1XCPA 5AK0A 4DUGA 3U60B 3THXA 1YHNA 4OQLA 5HKKD 4QGAA 5C46F 1Z6TA 1M7BA 1PV4A 3OAAD 2IF2A 4JLJA 1NN1A 3CW2A 1R0XA 5KNDA 1FW6A 1C9KA 4LI0A 1A82A 1N0UA 2GDJA 2IUTA 4EQ6A 1Z22A 4JSTA 2Z4RA 5FPHA 4LHXA 4A6XA 4POAA 2Z6VA 1NMZA 1CIPA 2OFXA 3I72A 1DARA 3NBZC 2ZETA 3RWOA 1T4GA 3RS0A 1U94A 4GDFA 1M7HA 3OIVA 1N6KA 2ZSEA 1OFIA 3KQNA 3K9GA 5FBLB 4BRWA 4CDGA 3AVVA 2VHQA 1E2HA 1WE2A 3RDPA 3DHWC 3DKVA 5AJZA 3A6PC 4HDOB 4LYHA 3BERA 1JJVA 2VL7A 2V6IA 4URUR 3GLFE 3GJ3A 4DEYA 1NIJA 1ETUA 2WJYA 4PSKA 1JALA 3SS8A 4JLPA 1G4UR 2OXCA 1KO4A 2RGNC 2KWIA 3W8NA 1KI6A 2OBLA 1NLFA 2QAJA 1WA5A 2YYZA 1NVXQ 3D31A 3K1JA 1AIPA 2QRNA 2GCPA 2OHFA 3MMPA 4Z8XA 5KDLA 2PCLA 2WWYA 1D8TA 1G7SA 2H1LA 2B7BA 3TSWA 3I3SR 2X8AA 2ZS7A 2OG2A 3GLHB 3BK7A 2DFTA 3HU3A 3NIBA 1J99A 4TMZA 3IBYA 4DDWA 3CWQA 3P4YA 2LKDA 3DDCA 4MGIR 4TT3D 3LX5A 1Q12A 5J4YA 4A6PA 1XD2B 2ZXUA 3W34A 1H8HA 2FMXA 5FBWB 5GVSA 3CPJB 3L0SA 1VG9B 3OESA 3VU9A 1TAGA 4GOKA 1XMSA 3U3OA 1MO5A 3EZ7A 2GJKA 1XTJA 2CNWA 4ON9A 4L5BA 3DL0A 2AWNA 3MJHA 4UNPA 5EE1A 5IDVA 1FNNA 1R7RA 3CZQA 1ZM9A 2JLZA 1W44A 5AJXA 2CJWB 4Q9KA 1I2MA 4E03A 4PX9A 3K09A 5FL7A 4N1AA 4ESVA 3UMFA 1ZM3A 4MDEA 1T6NA 5BQ5A 3T15A 721PA 2ZR0A 2ZUCA 4I1SA 4KO8A 3LA6A 3L0IB 5K8LA 5EXPA 2RGNA 3AVWA 4KFRA 3GLFB 2QGZA 5GVRA 2CHQA 1II0A 1G3UA 4FIDA 2OBMA 4TWZA 3RRYA 1LNZA 2PZGA 2OCAA 3A36A 2G0NA 3ZS9A 1QZXA 4JJKA 1T3LA 4JL6A 3VKHA 5ANRB 1KMHA 1P75A 5DO9A 3BWDD 3L8ZA 3CKLA 3ICEA 4YMSA 4DLXA 1TMKA 4Q9LA 4Q4JA 1PZNA 1W0KD 1H8HD 3FGNA 4LV8B 2OO7A 5JMTA 1ZD1A 4KV9A 5EUQB 1J8MF 3MLEA 2VQSA 4TLDA 2EW1A 3FWYA 1JECA 4NTZA 5EZ6B 4DKXA 1O3YA 2QZ4A 2NO1A 1CR1A 3X1WA 4UXIA 1N5JA 2QENA 3P32A 2BBSA 2IL1A 4BUJA 3TK1A 1KOFA 1UKZA 3C8UA 5FI1B 3QY0A 4IHQA 1LFDB 2YOHA 4QJ3A 3Q5EA 3LQQA 1KY2A 3K0AA 1JBKA 3P1JA 1GKYA 2WZQA 4G1UC 2D74A 4P4SB 3GJ8A 1MO6A 4FXPA 3AEZA 4JBXA 4L16A 3ZVMA 2C95A 4IDHA 2FPKA 2ZJZA 5FPKA 1MT0A 3CM0A 3SJAA 2OAQ1 3ASYA 2JLUA 3BGWA 3SEAA 4BFSA 1L7VC 1YZTA 4J0QA 4M1SA 3THOA 4MDFA 3C4JA 2HYDA 4NP6A 3QPWA 2CEAA 2J7PD 1Y3AA 3B1WA 1CULC 4A36A 4CT5A 2XZLA 1MV5A 3JVVA 4UXHA 3J81k 2LKCA 4L4UA 3RS5A 3TR5A 1COWD 1RPZA 4CEJB 2IS4A 3V00A 2QEQA 5DE3A 2NGRA 3JVUA 2ZS9A 4HLQB 4IDOA 1FUKA 1VMAA 5E7MA 1JR6A 2XX3A 4JS0A 4JT4A 5HTKA 4BLRA 4BZXA 3CONA 3L8YA 2QUZA 4KBFA 4E09A 5IT5A 3GLGA 3T5DA 2IX3A 2D2FA 1ANKA 1KK2A 2DB3A 1E69A 3LW8A 1XEFA 4HYYA 1R8SA 1Z8FA 1OJLA 1VYUA 2ZRFA 1YR8A 3P26A 4UQOA 4IDQA 2DYKA 1ZP6A 4BFVA 1IY0A 4DB2A 2QAGA 4ACBA 1NBMD 5BN5A 1CR4A 3QNUA 3O47A 2IYXA 3TKLA 5TVKA 3SI7A 1XMVA 1S9DA 4WBSA 4PZZA 2FSGA 1T5LA 2B6HA 4HZUA 4JLOA 5FL7D 4HB0A 8OHMA 1QHYA 3PIRA 2PL3A 1EXMA 4MA4A 2ZTSA 4P0TA 1WBDA 4ZDWA 4CEJA 5FOSA 1QDEA 2ZYTX 5HZKA 1KI9A 2XXAA 4KLNA 1KYIA 3LNCA 2WMNB 2CLSA 1YRBA 1ZVQA 2P0EA 3QENA 2ZJ8A 3A1UA 1S1CA 4I4LA 5J4LA 3K53A 4YMVA 4PC6A 1YE8A 2ZE7A 2JA1A 5FI0B 2B92A 1SHKA 3CRQA 2FFHA 5H8WA 4EPXA 5LB4A 4D2IA 1S4QA 2ZIAA 1UBGA 1QG2A 4FD2A 4R2IA 1OXVA 3QXSA 4IVQA 5AUNB 4MRSA 2NTYC 4BRUA 3Q7PA 4ZI2A 3IKJA 1A5TA 1VYTA 3W3AA 621PA 5JLJA 1J8YF 3K0FA 4PO8A 2PLFA 2A5DA 3KXIA 1AGPA 3CRVA 4I81A 2VP0A 4Q5IA 2O0HA 1V43A 2JDID 1WB9A 1A2BA 2G6BA 2O8EA 3Q85A 3EPKA 4A8JC 1FTSA 1E1QA 1HQYE 2ZJ2A 4X8LA 1MR3F 5FPTA 3W5IA 4B33A 1Q1BA 4B3BA 3UMRA 4DXAA 1KSFX 4B71A 3PUYA 2WJJA 1OIWA 5J4HA 2NQ2C 4PHHA 2CL7X 2RHDA 3TQCA 2FE4A 1NNEA 3UWOA 4RD3A 4A9AA 3AVOA 4AD8A 2EVWX 2O52A 3QEJA 4LJ9A 4BLOA 4C0BA 4DCSA 3A4MA 1EG7A 2CBZA 5E7IA 3RWMB 1N6IA 1U9IA 4JMPA 4ZCIA 2IA5A 3KKNA 1MABB 1ONBA 3IBGA 2G9NA 1MO3A 4MUBA 1OH8A 2OE2A 5TDHA 2BIFA 1G41A 3M6AA 4RZ3A 4NYJQ 1S2MA 1JPNA 3T12A 4LJ8A 3WNBA 3LFUA 4G5GA 3D8BA 4Q4HA 4EQ6B 1EFCA 1E2QA 1IONA 1SVIA 4OQFA 5FPSA 2WKPA 4TZ6A 2F43B 5TARA 1JB1A 3ND9A 4HUQA 3HR7A 1GTVA 2WPDA 1G4AE 2VSOA 1K5DA 2QT1A 2HJVA 4IFBA 4EPRA 4PZYA 1SKYE 2PT5A 5L3QB 5JJLA 3Q5DA 2ZRIA 1L2TA 2ZYUX 4E07A 2ORIA 2FN4A 4NCKA 4R2HA 4D81A 3SR0A 3LAWA 1PLLA 4BECA 3KTAB 3PG5A 3JZAA 4RZUA 1W7AA 1C4OA 1I4LD 2J87A 2ANBA 4DBLC 4F4CA 1E0JA 1SQ5A 2ZQ5A 1SVOA 1U99A 1XMJA 3B6EA 1XTSA 3QPVA 1RW4A 3K0AB 1COWA 1U8YA 2DHRA 3MCAA 5HCNA 2DR3A 1U8AA 1BYUA 1UADA 3OIWA 2HXYA 2FH5B 4QJ5A 3QE0A 3HPQA 1FNMA 5F98A 3WNDA 1NMYA 4Q7MB 1X1SA 2A9KA 3PV0A 4M1WA 2EYQA 3HU1A 1W48A 4N0EA 4A0GA 2YWFA 3ASZA 1CRQA 1Z6YA 5JSZB 4IRUB 4OHVA 3TUJC 2RCNA 3R9WA 2EFHB 2GK7A 1X3SA 1VYVA 3BS4A 4IXNA 4A2WA 4RCYA 2GCOA 1LB1B 5DYGA 1R6BX 4NBSA 4Q4JB 3CO5A 3EWAA 3ZDQA 2VRWA 1ZNXA 1WCV1 4M1TA 1D9ZA 2JGNA 4RZXA 3SNHA 2Q6TA 5KSYA 3QKSA 1JJ7A 4FCTA 4M9SA 1W47A 1E79D 4DHEA 4UXJA 1JQJC 1P6XA 4B3XA 2V1XA 2GTPA 2R6FA 4WVFA 5EQTA 3UKDA 3PITA 2C78A 5HZHA 1GAJA 1OFTA 2G1JA 5LB2A 2AXPA 3V4RA 3AVUA 4H1VA 4NL4H 4ZKEA 3NBYC 1VDZA 1G8HA 4DCNA 1ZMXA 1CP2A 3P20A 2VP5A 1YR6A 2NG1A 2R2AA 4KODA 2GVDC 2B7CA 1ESNA 1QHGA 3GLFA 1E4VA 1AM4D 5KDDA 4IW3B 1NI3A 3B13B 2ZAOA 3KKOA 3NBFA 4URVR 4Q1DA 4MKFA 2ZE6A 3B60A 2VP9A 3VAAA 2G0TA 2IXEA 1QF9A 3QKRA 1VG8A 4MRNA 1G3RA 4LYJA 4PTLA 4DSNA 4M4SA 2GCOB 3KB1A 4GL2A 4C30A 3L43A 2F3TA 2A5JA 4QJ4A 1TUIA 2BEJA 2PLRA 2Z43A 4PO1A 2Q0HA 1ZUIA 3GLIB 4X8OA 3C41J 1DAGA 4FMCF 4S2EA 2ONJA 1NVVR 4A0FA 4BFWA 4L8GA 3UWKA 1KI7A 2XOKA 3KKPA 2QU8A 3TRFA 4BLSA 1H65A 5CDFE 3KDSE 3C5CA 1KDPA 3BH7A 1IN6A 1WP9A 3UMSA 4DCTA 3THYB 1JQLB 2ZITA 4NE2A 2P6UA 2H16A 4M9QA 2RGXA 3OF5A 3TGPA 1XEXA 2Q3MA 1SGWA 5E7JA 1Z6GA 1XBTA 1OF1A 2BBOA 3OFND 2HF9A 4GZMA 1T0JB 1XXHB 3VR1A 1Q57A 1U81A 2FFBA 2IEYA 1R5BA 2REBA 1FPMA 5DLQC 3D6TB 4EPVA 4CIDA 1T0HB 3E5HA 4WOPA 2JLWA 2F9LA 1S8FA 1T3SA 2QAGB 2RGAA 3GPLA 1G5PA 2EFDB 2PMDA 4DEXA 4HZUB 1E3MA 1DBSA 1KIMA 2AD5A 1FQKA 1IJFA 1E2KA 6Q21A 5JFGA 4LHVA 2O8CB 1OKKD 3MFYA 1E2EA 1TU4A 3KJGA 1HV8A 2W6IA 2GBLA 3AKCA 3F8TA 3MG9A 1YZGA 3SN6A 4XWKA 3W6PA 3JZMA 2JLSA 4BZPA 3PFIA 1UEIA 3TE6A 2ODNA 3HJNA 3IIMA 2G83A 1W36C 2Z0MA 4AYXA 2ZSAA 4XIGS 1CBUA 1HUQA 3U3KA 4KJZA 1KSJA 3EPLA 2BOVA 1E9RA 4M9XA 5DGXA 2QM7A 4Y0AA 2OCBA 4NCHA 2FNAA 1VCNA 2V8OA 4WXRA 1AJEA 3PEYA 3Q8XB 3CNNA 2VHCA 4G5QA 2ATVA 1XF9A 5BYJA 1G16A 4ZIRB 4O3MA 3U7HB 1PJRA 1OH6A 1ZC4A 2BC9A 3CLVA 3EIEA 4Q4HB 2BWJA 2J46A 2QROA 3FVQA 3U7GA 1CR0A 1YZKA 3H1TA 1KI1A 4DLUA 5JJIA 4NYIQ 3AVXA 5J5CA 1Z63A 3EZ6A 1KK1A 2QQ0A 4B3CA 2GJ9A 1AZSC 3MUFA 4F4JA 5CK4A 3GD7A 3KUCA 1ZW6A 2BM0A 2W83A 3ZYCA 2KI5A 2W6JD 4TL8A 4UNNA 2J7KA 1UPTA 3M0EA 4QGFA 1ZNWA 2PEZA 4U7DA 2ZRBA 5FBVB 4QXAA 4P4UA 4RD6A 2ZJAA 521PA 4TQUS 2GHIA 4QBHA 5CB6A 2JIZD 1OIXA 4JYCA 4Q1EA 4GMDA 1RJ9A 4YLGA 2GEVA 2NZ8A 3TSZA 1AS2A 2GF9A 3QSYA 2O0JA 2FF7A 2IYQA 1NKTA 2WMOB 4PC3A 4DDTA 2W0MA 2JCSA 1RVDA 2ZI5A 4JLNA 3C16C 4LJ7A 5FOTA 3C5HA 2ZYVX 3D3QA 1P2SA 4XWOA 1FX0A 2IXFA 3K0SA 3RYTC 3PCRB 3NDBB 1P9RA 4AG6A 1GIAA 3IO3A 5F9HA 3ADDA 4C2UA 4Z1MA 5FR1A 3CH4B 1YZLA 1JAHA 3LVRE 5EE0A 1G18A 1ELOA 1NMXA 1IN8A 3AVQA 1NJFA 2KE5A 4LC0A 4PAOA 4PPNA 3BFKA 2Z4SA 3PJRA 1N6HA 4ZDJA 3THWB 4TMXA 1YJ5A 4QRHA 5A4JA 2Q3HA 3HWSA 5FTKA 1E2IA 5CLLA 1E6CA 4Q66C 1G17A 3CH5A 1KSGA 4TMWA 2GJAA 2OM2A 3PEUA 3SJCA 2OUKA 1KJZA 3SDZA 3EZFA 1OHHA 4IOKA 2D06A 4NDZA 3AF2A 1TNDA 4II7A 2J0UB 3RHFA 4QM7A 1XMIA 3K09C 5DN6D 2ATXA 5FTMA 2WHXA 3AM1A 1NY6A 2PJRA 5HE9A 2QA5A 3HU2A 4W7SA 2BCGY 1JPJA 4EAQA 1K6MA 3U7EB 4V0KA 3RAPR 2IHYA 3KQLA 1OPXA 1DS6A 4EDHA 1D5CA 4D82A 2ZRJA 4PQFA 3PR1A 1Q22A 2ODEA 2RB4A 3ZVNA 2QE7D 4B75A 2W0SA 1XP8A 1XZQA 3CRRA 1MH1A 3VKWA 3U7FB 4D6PA 4LWZA 4GBMA 1EFUA 2JLYA 4JYBA 2HJGA 4DT1A 2A78A 5EXTA 1HE1C 3OFNA 5IK2D 5CM8B 2X2FA 1P2VA 2E1RA 4Q02A 3P27A 3BE4A 1HTWA 1DO2A 4C0KA 1QHHA 2RGGA 2IUSA 2OT3B 3CPHA 4D4MA 1DTSA 4JBWA 5SZHB 2WJHA 4QM6A 1OXTA 3BXZA 3FMFA 4B2LA 2VHJA 3B1ZA 1E9CA 4FINA 5C2JB 4G3XA 5KDOA 3EZ9A 2VO1A 4B44A 2RGEA 2Q9AA 3NHAA 5B30A 1HT1E 3I92A 4A2PA 3T1OA 4CEHA 1NJGA 2QSYA 3C14C 3SHFA 2IW3A 3EZ2A 3UPUA 1VHTA 5G3YA 1DAIA 1KKLA 3BJIC 1U0JA 2AHOA 2ZI3A 5L3RA 1GUAA 4V0ME 2XJ4A 2CNWD 4C0QC 3LQRA 1I2DA 2OEPA 4DSOA 4KHZA 2NZJA 3QEOA 3KFXA 3O8CA 4PC7A 2OFWA 3N2EA 4S35A 3S1AB 3GJ5A 2W00A 3EAQA 3QVVA 4YDSA 2F1JA 3I32A 2JAQA 1Z0FA 4KFUA 5EXXA 2VEDA 4FWTA 3K70B 3DM5A 1ODFA 1GOTA 2ZSBA 4ARZA 3IIJA 3TVDA 2ZM5A 3SE0A 2VH5R 1ZD8A 5BYKA 4PSVA 4BFTA 1CRPA 3LXXA 2O8FB 3KZ1E 1GL9B 2GILA 2JJ2D 3DPUA 3GFOA 1CLUA 2ZRNA 4E5UA 2V7QD 2ZS8A 4F93B 2FWRA 3QBVA 2WTUA 3EIHA 2ERYA 4LX0A 2HEIA 3QJYA 3WRYC 3K0CC 4XWAA 3NBXX 1ZBDA 1GFIA 4URWR 1N6NA 1Z6AA 3RLFA 2AX4A 4LYAA 1AS0A 2F7SA 1ZNZA 4TYPA 2KJQA 1OYWA 3GJXC 3TBKA 5GJWC 2W2VA 4WZ6A 2ZRAA 1GL6A 1OH5A 3U4QA 3TUZC 2D7DA 5KUTA 4D4LA 3EXAA 1OHHD 4RZ2A 2OXRA 4LJAA 2RHMA 2KBEA 2Z5FA 3AKEA 4NH0A 1Q1QA 3MRSA 2PJZA 4M1MA 3MAAC 2ZU6A 4A1FA 3G5UA 1ZUHA 3UXMA 4RFSB 1G3QA 4Z51A 2YC4C 1G8PA 5CK5A 1GRQA 2EWWA 1LY1A 3NHBA 4D4JA 2V7QA 3IDQA 4OHZA 4XVUA 3LY5A 3N70A 4M8NE 4ASUA 1E0SA 1W49A 4YC7A 4HLCA 4TQAA 1KMQA 3M4YA 2QMEA 1P2UA 1HA3A 2ZJBA 5DYIA 4QBGB 1DAHA 2D2EA 1AN0A 1K8RA 3SJBA 1RFLA 1P72A 4HZIA 2WWHA 3IPXA 2WSMA 1GNRA 4Q7KA 4IDPA 4Q18A 3K0FB 5JBQA 2N1BA 5CM9C 4ZCLA 2DBYA 4YMWA 2DWQA 4AKIA 2IYSA 5JCPA 2F43A 4B73A 1XD2A 3K70C 3X1DA 1CJVC 1L4YA 4WIAA 2D4HA 1P3JA 4UNRA 2MSEB 3VR5A 2QT0A 1M8PA 1XRJA 1XXHE 2AK2A 2HV8A 3AGQA 3FDIA 5JEDA 1QHXA 4JLDA 3GJ7A 4DLRA 3W6NA 4FMDB 3A37A 2C98A 2C9YA 4D0LB 1JEEA 1Q1ZA 3NC1C 5G41A 4TN1A 1O87A 1GP2A 3FFAA 3D7MA 1XEWY 3ADCA 5DNYB 4UKDA 4TMKA 1BOFA 3QOFA 2XOKD 1YRAA 3AP1A 5FUVA 3KB2A 4IVPA 4JL5A 4MGYR 1FUUA 3X1XA 3HR8A 2GXAA 4X8HA 3CX8A 4W5HA 4LBYA 2JLRA 2QNRA 4OK3A 4XVQA 5KPJA 4LJ6A 2ZUBA 3RSOA 4CW7A 1AKEA 2P2LA 3MWYW 4TTQA 2X77A 2X1VA 3TW4A 5LPNA 1HY3A 1G8FA 2WICA 1P5ZB 2XTNA 4DT1B 3I5XA 3T35A 3BORA 1XD9A 1K5GA 2BKEA 4DLTA 5L8VA 2H17A 5JWOA 4ERNA 2QGNA 2DFLA 5L3QA 5FTJA 4LV5B 3ZZ0A 3H86A 1G3IA 1HE8B 1KNQA 1EWRA 2GZAA 2W2XA 2ZRPA 2RKOA 2YOFA 1P60A 2PT7A 3WYFA 4FW9A 3OEEA 2D3WA 2CDNA 3F0TA 3IUYA 3L0PA 5KNCA 3V4FA 1SVLA 3A4NA 3HYTA 1KO1A 4AK9A 4EPTA 2ZE8A 3IPYA 1ZM4A 2FEOA 1NBME 3R7WB 3U6KA 2CCKA 4WZBE 1G1MA 4RD1A 4D80A 1UDWA 2BEKA 3FTQA 1TF7A 4HAYA 1DAEA 1M7GA 2WIAA 2F6RA 3MSXA 2ASEA 1M34E 2GJSA 4HB2A 1IM2A 1KY3A 2XJ9A 5JWRA 1W36D 1E2FA 2ZI6A 2ZRMA 4LOAA 4RD0A 1RIFA 4DWJA 3WBJA 1EFRD 4AG5A 4B43A 4OHXA 2H18A 4FCVA 3H4MA 4ABYA 5IF9A 1VKJA 5A5GA 4Q48A 3QKSB 3IO5A 4NKRA 2IWRA 1AQUA 1U9IC 2CHVA 2OFOA 1JXOA 4FMBB 1NSTA 1LS6A 1FMLA 2WJIA 2ZEJA 1AS3A 2ZYWX 1NF3A 2BV3A 2YWGA 2A2ZA 4LRWA 4E22A 3QQ5A 3ZIAD 1UM8A 4PAMA 1D2NA 2NO7A 1G7CA 4Q19A 3WHLA 5DIFA 4YQFA 4ZDKA 3VR3A 3WBKA 4D0NA 1BMFD 2H7VA 5DHFA 4AY2A 3WRXC 4OK5A 4CZ2A 4TL7A 2J3EA 4OQXA 5P21A 2ORWA 2VYFA 1F60A 1ZYUA 4GPTA 4TL9A 3B5JA 1RE0A 1R5OA 1EESA 4N0DA 2GVZC 3H2YA 4F4IA 3ZIAA 1OXSC 1X8LA 2OCYC 4O2RA 2IS1A 3KJHA 2KBFA 4Z8YA 4DLSA 3RABA 1Z28A 1BIFA 1IY2A 2FPMA 2GBLC 4B32A 3RANA 1U0HC 3VMFA 4RVCA 1GVNB 4Q1AA 4PXAA 5EXSA 3L2OB 1W2GA 4DIEA 4Q7LA 3FPAA 2CLCX 2JATA 4OYHA 4JZKA 3U2QA 2HLDD 4BPBA 1OE0A 4US0R 3RRZA 1ZC3A 1IXZA 1ZU4A 5M04A 4WXPA 5FOUA 3VNUA 2DPXA 2F1HA 5B57C 4XD7D 3EASA 4GSYA 3RRMA 4HLUC 1UF9A 3W8RA 4PHTA 3R9IA 1EX7A 2XNSA 4U02A 3SC3A 4GOJA 4ASUD 4BLPA 4EKDA 5BN3A 5IRCD 4BLTA 1SKYB 2AKAB 4C7OA 3WP1B 4KVGA 2QPAA 4CEIB 1KJWA 1MO4A 3I8XA 2Q21A 4P3YA 1QVAA 4G5OA 3SYLA 1NN0A 2A5YB 4B47A 1R5NA 1J70A 4TZ0A 1T5IA 3FMPB 5IHPA 4K46A 3QKRB 5CLQA 2FU5C 1N2CE 1SVMA 1T91A 3AF0A 1TADA 1OLOA 3EC2A 1TL7C 3LH5A 3SBDA 1NVUQ 5L3VA 2NO6A 4PPGA 1II9A 4HDCA 1N6RA 1KGDA 3LW7A 1IJEA 4ZPXA 5K8UA 3U5ZB 3GJ0A 5BXQC 2BDTA 2XITA 1DELA 4N3NA 4CF7A 4NONA 4Q4AB 1ZINA 2HLDA 4I1OA 4QFMA 5DN6A 4K81B 1EX6A 1F2UB 1SVWA 3GCGA 1E9SA 4BASA 3O8RA 3BIFA 3A1SA 3GQBA 3FHOA 3GMTA 3QG5A 4JJZA 3B9PA 3F3YA 4W5JA 4OQNA 1U90A 2ZRKA 2IYRA 4D26A 3GLGE 4IDNA 4C4PA 1US8A 1G19A 4CT4B 5FOVA 3AVYA 1OXUA 2RAPA 3KXKA 4A92A 1G9XA 2IYYA 3NKVA 2AD1A 5DISB 2XNDA 3GJ4A 2QMHA 3R8FA 3DZ8A 1Z07A 5JI3E 1DAKA 4JVMA 5B64A 2YZ2A 1QHIA 2ZJOA 1Z83A 4IEIA 4Q9JA 1E98A 4HAXA 5CDFA 2P6RA 4GT1A 4V0NA 1RYFA 1E1RA 4KBGA 2OLJA 3HP1A 1PUJA 1IN5A 5E4FA 1OB2A 4O0MA 1G7RA 4RCZA 2JLVA 2BMFA 3ONWA 3FKSA 1S9HA 3QF4B 5AUQA 4JIMA 2D7CA 4NPHA 4CYMA 3OE7A 2H5EA 1PVOA 2XAUA 2ZSFA 2RMKA 3T1QA 5AUPB 2F55A 2B8TA 5FUYA 1QVRA 1J90A 1Q3HA 4URZR 2GAOA 2YWEA 4NYMQ 1RRCA 3B7GA 3ADKA 1JXMA 4LDJA 1VIAA 3GEEA 4KSBA 3R7WA 1OT3A 2E9SA 5JI2E 2N42A 1L4UA 3KKMA 3SOPA 2ZRGA 4I1VA 1ZAKA 2IS2A 2BBWA 4UNSA 1TQDA 2YJTD 5EP4A 2DFNA 4KXFB 1N0WA 3BFXA 3KJIA 4HEJA 3QF7A 2VF7A 3FOZA 4DLYA 2O8EB 1OXXK 2GA8A 4PC2A 4KITB 4KYIB 1UKVY 2BCJQ 3OAAA 4GP6A 4OI4A 4XJXA 5SZKB 3CRW1 3LVQE 5TMPA 1E79A 2VIIA 3MD0A 2NOAA 3ZVRA 4GI7A 4ACAA 1P4SA 5F3WB 3LV8A 2WSSA 4RD2A 5CB8A 4UJ5A 1OH7A 2ZJYA 1W46A 4MGKR 2P67A 1IXSB 2EQBA 2NIPA 3ZZUA 4NCJA 4QBFA 3SFZA 4DCUA 1XPRA 1Q1EA 2QM8A 1ZCBA 1FX0B 1X86B 1ZJ6A 3GP8A 3U61B 2C9OA 2OBNA 4L9SA 1DG1G 1Q3TA 3BB4A 3CF2A 3BB3A 4ZKDA 1KO8A 3GLHA 4PANA 4DUGD 1B23P 3NG1A 2AKYA 4V0MA 2CK3A 4R71A 3CNOA 3C15C 1KI8A 2NPIA 3PUXA 2JIZA 1IN4A 1P7CA 3QXCA 3B2EA 5LD2C 3CX6A 3FB4A 1QHSA 3MWJA 3FHTA 4H9GA 2ZJ5A 5JS8A 4WZAE 4BFYA 5CYPA 4OI1A 1Z47A 4MH0R 4W9MC 1T8TA 2UVQA 2G3YA 1YZNA 1XNJA 1XCMA 3WHKA 1A2KC 3AF3A 4I99A 4OJQA 4LCBA 4HUTA 5HPYB 2OLKA 2VPPA 5IK2A 3TSOA 3IEVA 2X19A 5JRZA 2ZRDA 4NHOA 2ERXA 5CIQA 2REXB 1WXQA 1SVSA 1UFQA 3G0HA 2PH1A 3OIYA 3TW8B 2FFQA 4PHFA 4BFZA 3ZQ6A 4CGZA 2PMKA 1SXJD 4C0SA 3W9YA 1Z06A 5AJYA 2E87A 3CIOA 2YVUA 2ZROA 1JI0A 2JDIA 3PUWA 4LJ4A 3SQXA 2EFGA 2BKUA 2ZREA 1KO5A 2R6CA 5AJWA 3CR7A 1CXZA 1NG9A 1N6OA 4B34A 4EPWA 5TV2A 5LBIA 3OEHD 1G8GA 2IC5A 4RD4A 4Q7JB 3WXMA 1GRRA 2I4IA 1W5SA 5H70A 3GLHE 2P5TB 5LDDC 1IBRA 4GMXA 1JR3A 1WBBA 3U3RA 4KFTA 2Z83A 4MRVA 4PZLA 4BEBA 2V55B 5D3MB 5F9FA 1NLYA 4NYIR 2OILA 4B76A 1NG1A 2AR7A 3NC0C 4LUCA 3PQCA 4MKGA 1TEVA 2QE7A 1MRNA 2YC2C 3HYRA 4KFSA 2HT1A 4NU0A 1QG4A 1ZIOA 5H1YA 4TLEA 4EJSB 3C7KA 4HAWA 3RS4A 1PLKA 1LVGA 2ZAMA 4MKHA 1JR3D 1BKDR 1E2NA 1TQ6A 4PHGA 4Q1FA 1KTVA 5KYKA 4RSGA 5EZ5A 2QP4A 3H84A 1CEEA 5HR5A 4CEIA 1E2DA 2REOA 3A1WA 5ELXA 3IIKA 3K9HA 3QIAA 1E9FA 2A5GA 2IF0A 2IXGA 1IY1A 1NSFA 5L3SB 1KI3A 3EWSA 3FHCB 2UZ3A 5G40A 3KKQA 4HAVA 3RSLA 3IEUA 5G3ZA 2JJ1D 5UKDA 2HF8A 4TTRA 1DAFA 5K8IA 1ZU5A 3QI2A 4ARZB 4KCGA 1E1RD 4DSTA 1HYQA 1YU9A 2QPOA 4YMTA 1NIPA 1S0UA 4HAUA 3AKDA 3GFPA 5FUWA 1RRPA 3EW9A 2OCPA 4LSGA 3LBNA 4C0JA 4MITA 4IFEA 5AR1A 3X1YA 4URYR 3CPEA 4A82A 2C9CA 2JEOA 1GKUB 1LW7A 1PUIA 1MRSA 2D62A 3FE2A 1SKQA 1VTKA 2W6ID 2P65A 4TLAA 821PA 4US2R 4M21A 1NBMA 4F38A 3UG7A 2ZI7A 2PCJA 1XTIA 3PVSA 4Q01A 4XH9B 5KSZA 1WRBA 2IK8A 2ECKA 2QRZA 3NXSA 2QMOA 3PUVA 1RKBA 4C0AC 1XDBA 4AURA 1KAOA 1G291 2QP3A 1VIYA 2ZANA 4LPKA 2HCBA 4QHTA 3VHXA 1JEDA 3K8YA 2CHGA 1UKEA 2P6NA 1IN7A 1E2GA 1E0AA 1XJQA 2P5SA 4B2IA 5CYOA 2QPTA 1E2LA 2HT6A 4A4DA 3K9LA 4OJKA 4HSEA 5JRJA 1XFAA 4RFSA 2QQEA 2AN9A 2J5XA 1TEXA 5GADl 3CUEF 3PEVA 2G77B 1F5NA 1KZGB 1X8JA 3AB3A 4FMDF 3RS3A 3EA0A 2J0SA 2R9VA 2RGBA 3LBHA 2OV2A 2Q3FA 2GWHA 4B3GA 1TU3A 4IJMA 3TR0A 1XB2A 5J4KA 4P4TA 4JVSB 1R0ZA 3UK6A 3MWKA 2VLIA 4W5WA 3EARA 4PR0A 3B85A 3QPUA 4HATA 4UJ3A 1BYIA 4DRZA 2IS6A 3R9XA 3DOFA 1XWIA 2WWFA 5A0FA 4M1YA 3VHLB 1E9BA 4HDQB 4B3DA 2WKQA 1LTQA 1CJUC 3LLMA 4QHYA 5JCZA 1S3SA 1E32A 1XEWX 2WM9B 4JLVA 2FJUA 1YR7A 4NCNA 2WKRA 2HDNB 2ZR9A 2JLXA 1UAAA 2R6AA 2O8DA 2XNDD 2IEZA 1KI2A 3KTAA 3GLIE 1FTNA 3TAUA 4FMCB 1NL3A 3EA5A 3FKQA 3NH9A 3SYNA 1SXJE 1YVDA 4P33A 5G53C 2J0UA 3IILA 3OZXA 3MGCA 4DDVA 3TAHA 3QXJA 3WMGA 3REGA 4KVAA 5EJEA 1N25A 3E1SA 1KDRA 2GCNA 3FMIA 3AF1A 1Z0DA 1Z0JA 3UIEA 1OFHA 5KTYA 4P4SA 2WVJA 4V0LA 1KSHA 1DADA 1MOZA 4MYCA 4DCVA 1GM5A 2NO0A 3W3ZB 2JLQA 1F3OA 4BFUA 2XZPA 5KOYA 3UANA 2IYUA 3LRPA 3ECCA 4TT3A 4HI0E 5KU1A 2QBYA 3B9QA 2R44A 2FV8A 4Q21A 5J47A 4G5RA 2MMCA 1N5KA 2Q9BA 3DZDA 4WW0A 4QGHA 4C0LA 2GEDA 2GETA 2CL0X 2XB4A 4D25A 1R8QA 4AI6A 3GLIA 3VU9B 4JL8A 2WIBA 4M1OA 3LLUA 1VCMA 3A58B 2HCJB 3BBPA 1NY5A 4MKIA 4GFDA 2GNOA 1CTQA 3GEIA 2P3SA 2J0QA 1NN3A 4Q1CA 5EE5B 1R4AA 3FKSD 1XTKA 4U5XA 5F2EA 4DC9A 4TYNA 3ZVLA 2XSZD 2IYWA 1W2HA 4OI0A 1CJTC 1I4DD 1N6LA 1KKMA 3BB1A 3IGFA 4B48A 1CU1A 3LO5A 1T8UA 1GITA 1R0YA 4CRWB 2K5UA 4JT2A 3LX8A 1KO7A 1T9HA 3KX2A 1M6NA 3REFA 2A5FA 2Q9CA 4FWIB 4QC2A 2ZVPX 2A30A 2VA8A 4OHWA 1W0KA 1OV4A 5HCIA 1D2EA 1E9EA 4Q1BA 1TQ4A 2VBCA 4TMTA 2QG6A 1GNPA 2ODWA 4H1UA 5EP1A 3NWJA 4HAZA 1EFHA 3VQTA 1OW3B 1J7KA 4V0OA 1BS1A 3BH0A 2O8BB 2ZI9A 4Q4AA 1CJMA 1QHHB 2X2EA 3AUYA 4IOJA 3KQHA 2Y8EA 1HT2E 2J7PA 3QXHA 4Q4LA 1CF4A 4P32A 4ZV4A 3QVUA 1SVKA 2F9MA 3IQXA 1G6OA 3SYKA 4XVRA 2VTKA 1R2QA 1AKYA 1VCIA 3N5CA 3B8HA 2WWWA 4UNQA 3UG6A 2GXSA 3L82B 1C1YA 4AKHA 5DHAA 4GNKA 2QSZA 1NLZA 2OSBA 3FFBA 3AGPA 3ICQB 2TMKA 1HURA 3PUZA 3LDAA 2CE7A 4A0RA 1GKIA 2VSXA 4QHSA 2R6DA 3NEJA 2ANCA 3Q3JB 3DKPA 1BH2A 3KL4A 2PZFA 1ESMA 3NVAA 4TTPA 4A2QA 4AWXA 4BE7B 1DPFA 3N2IA 1YKSA 2BVNA 3R20A 1UEJA 2WBLC 2GRJA 1Z3IX 4QG7A 5KSOA 4LHWA 1VPLA 1WF3A 2I1QA 3CZPA 3ZJYA 3ZS8A 2BJWA 2EWVA 5L3SA 2W58A 3Q72A 3CR8A 4ITRC 1N0VC 4YXWA 3TLXA 1R0WA 3T61A 1Z0AA 2YINC 1IQPA 3RVBA 2H8KA 2A3RA 3WY9A 1AA9A 4QKQA 5FH9A 1IAQA 1VG0B 4Q9HA 2C8VA 2R62A 3RC3A 2BJVA 5C4MA 1RJ9B 3TNFA 5FPYA 3SFVA 1XD8A 1G21E 1VHLA 5B2ZA 1N5LA 1US8B 2QI9C 3NEYA 4JLMA 4YXWD 3TJZA 4F91B 3THYA 1D9XA 2CLDX 2HUPA 3EC1A 5BN4A 2BMEA 2XXAB 1RC8A 1Z2CA 1KI6B 1WMSA 1W4BA 3KFVA 3VTKA 2YHSA 4HB4A 2EFEB 1W1WA 1KZ7B 1N5IA 3DM9B 4MYUA 4Z54A 4C7OB 2DCUA 4DLVA 2CK3D 4TQ9A 3SHWA 2WOJA 3I4LA 5DSZA 3VX3A 2QN6A 4AC9A 5C18A 4M2LA 1XXHA 4LC1A 4ZI3A 3KXLA 5GJVC 2ZPTX 2AFHE 3KUDA 4QGGA 2VP2A 2FZLA 1IHUA 3TH5A 4RFVA 1F48A 3CB4A 1G7TA 2XTMA 4QNRA 1FL9A 2V9PA 2J0VA 1FOEB 1TTTA 2LWIA 1E2PA 1KDOA 4LV6A 5DI3A 1UBCA 3ZLJA 3AQ4A 2O8DB 1ZUNB 1A7JA 4V02A 3M1IA 3PXGA 1EWQA 2J9RA 1OFUX 3EG5A 2R6GA 5FOXA 5KSPA 2NMVA 2BMDA 2XZOA 2ZI4A 2F3RA 1IXRC 5JWHA 2AXNA 2CE2X 2WAYA 4KU4A 4B3FX 1CS4C 1ZM2A 4LHYA 1F6BA 4O25A 1GWNA 3LXRA 3T1TA 3OEED 3I61A 1DO0A 3GFTA 2GJ8A 2V3CC 3A1TA 1FMJA 4Q03A 4M1KA 2QTFA 1OKKA 2GZDA 2ZVQX 1G64A 4M53A 4BEJA 4D4KA 2WPDD 4PAQA 4EFMA 3BC1A 3P4XA 4ZIRA 2OESA 3VR2A 1Z08A 2G1KA 2L0XA 3SZRA 1GNQA 3NH6A 4TLCA 2IYVA 3SBEA 5E3HA 3DMNA 4HUQB 4BZQA 1PLJA 4DLZA 1E99A 1SZPA 2NO9A 3OIUA 1WQ1R 1Y63A 1M74A 4YONB 2FX3A 4RY2A 3ZH9B 1NRJB 2CXXA 4MYTA 4TYQA 2ZU0C 3A8TA 4A15A 1S96A 3BD9A 1B0UA 3B78A 2IYTA 2RGCA 4JVNA 4JSYA 2QL6A 3IHLA
chains in the Genus database with same CATH superfamily
4EJMA 1VE7A 3BWCA 5FFFA 4OH7A 4IIFA 1GZDA 4CR7A 1TT5A 1PSZA 3P0JA 4MRRA 3TNLA 2RHHA 2X42A 1YTLA 3LGAA 2O7SA 1AHPA 4O4IF 1Z2AA 2CBGA 3B1VA 5JS7A 3FOFC 4L15A 4US1R 1JU3A 3VOBA 2Y0EA 3GJ6A 1KHTA 1VFPA 2WF8A 4KGDA 2PMFA 1SU6A 3F74A 3I5MA 3F47A 4PFKA 5F7JA 1JQKA 2JGEA 5TMEA 2PGLA 2R25B 3TMKA 3QW4B 1X8XA 5DK4A 5AIAA 5BUQA 3H42B 5JROA 1EFVA 5GOTA 2R8PA 3OPXA 2Q1TA 4OLBA 1B1AA 2XLBA 3BWEA 4OHOA 4PE5B 1Q21A 1RDFA 1L4BA 4KYUA 3TLKA 6LDHA 2WWXA 3HNOA 4LZZA 4RDCA 4UW9A 4FGJA 3ZU6A 3EPHA 3FLAA 1FFWA 1BFUA 3OQIB 3U3JA 1Z2OX 2Z2YA 3FW1A 4REQB 1RRFA 3S0JA 4WXHA 1MC5A 1KEKA 4KWIA 3IMFA 4DR1B 3DZIA 4LBZA 4DL9A 3JALB 3U16A 2IYZA 4OFZA 4JVLA 2CVHA 3ABZA 3VGPA 1VPWA 3SJUA 4LHZA 4E15A 1P17A 4YP6A 2P62A 2FWAA 3NCTA 4I7EA 3MUNA 4Y1RA 5DM0A 3TCNA 1FB5A 1DG3A 2EQAA 1ZJZA 2CUNA 4MI6A 2J3IA 3F6SA 4EVQA 4IEEA 4Z1MD 2IIQA 1JEYA 3EVAA 3ND8A 3F2VA 4RU1A 3WNCA 3I9MA 3SQMA 1VLMA 4EJSC 5JECA 1JJBA 1P61B 1NM5A 2C99A 2V4ZA 4JYAB 2P6OA 2PSJA 4K86A 4KQKA 3QEAZ 3QRWA 5K0TA 5JEEA 1RT9A 1UDXA 2B94A 1C14A 1XZPA 3DC7A 4Y6RA 1IN1A 2JLAA 4K9SA 4LRSB 4IUDS 3M70A 2PYDA 3QOXA 2CL5A 4JC4A 3IB6A 4N65A 4QPPA 1JDZA 1LF0A 5EG5A 1CE8A 1GZSA 2B2XA 2AUMA 5EA2A 4ALJA 1UODA 1KPGA 2FI1A 3AF4A 3F6YA 3ORRA 4U00A 1Z0KA 1Z0UA 5AKIA 4FB4A 1KMHB 3GLKA 2DWOA 1FTWA 1NW8A 2PD4A 3P9IA 3WK6A 1GILA 2XDQA 4HAIA 3OOHA 2CC2A 3KOUA 3S8MA 2IUUA 2MSWA 4B9AA 2SECE 5DMXA 1PT7A 5IDXA 4FN4A 1DEKA 1VCOA 4LMRA 4DSUA 1N3IA 4XGNA 3INTA 4LYDA 3UCFA 2ONZA 4XASA 3DLBA 3FCAA 1EK1A 3IULA 4UE6A 5AXDA 4H60A 4R8RA 1NUPA 4Y30A 5KTOA 3GGJA 2HMTA 3FYUC 1NASA 3G0CA 1R74A 1DX9A 1RKXA 1I7PA 1YR9A 3TQSA 3PEFA 3WJ1A 4E5MA 1N9ZA 2JJQA 2QYHA 2CBXA 4UE2A 1U0BB 2VF8A 5CIWA 2VTDA 1P62B 2RHBA 1R4MB 4XDGA 4EPYA 1YR2A 3L0CA 5LOVB 1O8CA 3A3KA 3UJAA 1FNSA 2DG2A 1I14A 2A94A 1RZ3A 5IXSA 3ROTA 1ECJA 2VT6A 1OSNA 2F67A 4A2CA 1R1DA 4KB5A 4X6UA 2QTVB 3B3AA 4JQCA 2JANA 5DHRA 3H9CA 5FWAA 1QCYA 4PRLA 4YALA 3KETA 1SIWA 3EVBA 4ESHA 3RF6A 3L92A 2OFFA 1P19A 4DIMA 2C2GA 2II6A 3FCXA 5C7LO 4NRDA 2O2CA 3NJRA 3EAGA 2Q6LA 1RM3A 3VYWA 4ENUA 4EG0A 5BV1A 2HIAA 2Z2ZA 4NYMR 4N7RA 1Y8ZA 1NULA 3JQGB 3Q88A 4J1TC 2PX4A 1UOOA 4PLCA 1TPZA 4R3UC 4ZCMA 3GEDA 2JJ2A 5M5BA 3V6LA 4KAFA 4NBWA 5A5FA 4N4AA 1FFXB 4CKCA 4YQEA 2F2TA 2D2VA 4OK6A 4LTDA 1Q1GA 1GRCA 3BQ9A 2V74B 3ABIA 1C3XA 4W9NC 3KZKA 1ZO8A 2JHCA 1IVYA 4Q00A 4BATA 1ZVVA 1DJMA 1W0JA 4ARSA 1JZSA 3ESCA 2XV1A 2XQJA 3PX7A 2Y77A 2PKYX 3UMMA 1V7ZA 1STOA 3QBEA 3KJEA 4BLQA 3A06A 1CUEA 1YUBA 5F7XA 3MJRA 5FCDA 4ZQGA 4K88A 5BYAA 3OHSX 2JBAB 1OI3A 1JQ5A 2VPIA 2QUJA 4HUJA 4BNWA 2VHUA 3EGDA 2LVBA 4M0LA 1Z0SA 4E70A 3KYIB 4UUOA 4CM1A 3PFGA 1Z5VA 1OIVA 2VF5X 1HXHA 3FPKA 3LY8A 4CF3A 1ICIA 5JHHB 3KE9A 2XA9A 2QPLA 3K35A 3GFRA 3EPRA 3GQVA 1UBFA 2ZGVA 4UBLA 4W5RA 4C3UA 5B58T 5EZYA 1LZKA 2F4VB 2FSFA 4L9RA 2BRUC 2P9FA 2JKZA 1G8AA 2QMYA 3AH8A 3E1GA 5IH7A 3LX4A 1K5HA 4X24A 4FMPA 3C3MA 2GPSA 2I9KA 4FUTA 1TCBA 1V1RB 3QLVA 3FNBA 1DCTA 3UVEA 3QF4A 3EZXA 4HLUA 2D0IA 1CUFA 3LWNA 1OU4A 3GPBA 5DWVA 4B6EA 1X7HA 3L7AA 2O3TA 1KQOA 1I2ZA 3HHEA 4HK4A 1YHZA 1M5UA 1PZEA 1SOUA 2H1RA 2PBLA 1RADA 3PFCA 2YVLA 2HYIC 4GS5A 1WM1A 4RY8A 1JQDA 2OYCA 2XYGA 3BIWA 1LBSA 3DOCA 4LY0A 3PXDA 1CEYA 1H4VB 2ZRHA 5IG2A 4PG7A 1XJ0A 2GKSA 5JCOA 3IQIX 2I1VB 2FG5A 5J4VA 5JS6A 2IP4A 3AUXA 1YA6A 4G0NA 2OAP1 4GKAA 4CKCB 1KZ9A 3A26A 3TVTA 4BO2A 3B1KA 5JS2A 3ICVA 1MAAA 1YK0A 3R3ZA 5JJ5A 4AQYB 2FPXA 5E0KB 5I4KA 2D1YA 4JJIA 5IEJA 2X0KA 1D04A 4RGVA 1U8ZA 4C0HA 3ZWNA 3RC8A 1DBQA 3A14A 3Q3EA 1PR9A 3ROKA 221PA 2XEXA 4AJOA 3MWFA 3A11A 4ZAXA 2MHCA 1SA0A 4CF4A 3THWA 3OY2A 2GAAA 4KGVA 1EK0A 4RANA 4RMGA 3FOEC 3I5YA 1C0KA 2OCLA 1C81A 3W6OA 5EHXA 5I48A 1S4MA 5D00A 3DLTA 1VBNA 2IJGX 4URFA 3QVXA 3CGGA 2WTNA 1LDBA 2IYEA 2YR0A 4NY1A 2GCGA 3N3AC 1Y3BE 4L0CA 3CWZA 1DFGA 2DMRA 2EW8A 1JIJA 2ORVA 3ADBA 2QRGA 5EWJB 5LP6B 2IIBA 2IYLD 5DP1A 5IT9A 3JYHA 4CEHB 1F8FA 4EUNA 1KS9A 4IMRA 2VHYA 5ALEA 3QLUC 1X6VA 5AQ1A 1TA4A 2FLKA 2WJWA 3IV6A 1XO1A 3VTFA 1I3OA 4OSPA 3T1VA 1MP0A 3BD6A 1JHZA 4YAKA 1PNRA 2DE0X 3HR4A 5AJVB 1I1OA 1LBHA 1ACMA 1TK3A 2HV9A 3JYQA 1Q20A 2QW1A 4JI5B 3RVPA 2I7XA 4LXIA 2HOQA 4FQ8A 1QV7A 2YMLA 5FUMA 2QD1A 2C5LA 1QH1A 4MLCA 4Q0MA 4U63A 1LRLA 2DUNA 2CCJA 2D5LA 5HZMA 1WDKA 1O94A 2JCGA 3FYHA 2MSDB 4RIHA 1EK5A 1R10A 4ID3A 3BL8A 1E2MA 5E2IA 3AR7A 1USUA 4TSFD 1XX6A 4OMUA 5FTNA 4PC1A 5HM8A 1UZLA 1U8TA 4E1AA 2B99A 3EG9A 2P91A 1OLXA 2F1IA 1A4RA 1TTQB 2AOTB 2PBRA 1FQJA 4RKEA 3WGMA 3GT7A 4DXHA 5I7SA 3J81A 2CJPA 2BJHA 4CU2A 1X1RA 4QOIA 3NC4A 1JVNA 2ZR7A 3T0IA 4CLDA 2DSNA 4QBIA 4YDQA 1XZGA 1X1AA 5C4GB 1XVTA 2ID4A 4Y0VA 3VR4H 2VJQA 5BW8A 2P0AA 2G88A 2JCBA 2VHTA 3SLKA 1JFLA 5ITZA 4Q6BA 1F4VA 1KVSA 1FXWA 1WLYA 4UEWA 1ADGA 2FUEA 2GDZA 2H57A 2FX5A 2QP9X 2QXUA 3WGIA 1CEQA 2DQZA 2FPLA 3PRHA 1M5TA 3DTYA 3JD2A 1QVVA 3K9NA 1EJ0A 4G1FA 4UEKA 5LQCA 2QLBA 1Q15A 4UHCA 1N8TA 5LDHA 1Z13A 2FG6C 2VRNA 1E2JA 1IOZA 3B82A 1GPKA 1HH4A 4DMCA 3RIMA 3ZQJA 4NDNE 1SCAA 1VKNA 4LWQA 5K03A 2QY6A 2RIRA 2BM1A 3AMVA 1REQA 3CV3A 1XPUA 1F2TB 2XQIA 4ZZ0A 2W6CX 5FFMA 3WGNA 5IN4A 3R6TA 9LDBA 4EY6A 1UZAA 4LY6A 1F2TA 5DOVA 3L5KA 4EA7A 3RU9A 2EZ9A 2QI9F 1SCUB 3BREA 3D6FA 5DX1A 3VNRA 1FP6A 4G1VA 4TQGA 4BQEA 5LP6F 3L4BC 3PQ3A 2QKYA 1QP4A 2HA6A 1YBAA 1E9VA 3S2SA 4O3FA 5AUOB 2G71A 1F2UA 2GPNA 4F96A 3R44A 1LS1A 4Y3UA 4MVJE 2C1ZA 4S2UA 4RESA 4AKGA 4C6SA 4GP7A 2C03A 4FC6A 1A1VA 1MIOB 4G07A 2YRWA 1JU4A 2WJ3A 3WMRA 2AQ8A 3GFGA 2GYWA 5BSUA 4DB4A 4O4JB 2RAUA 1CUWA 5DCWA 4B4WA 3ZDRA 1ZSYA 1D7OA 2QVCA 3ITDA 1EDOA 2BFEA 2O2SA 3NHRA 3Q9LA 3B1XA 3O21A 3AVPA 3OD1A 4P31A 4AT1A 4IF4A 4IRMA 1WWKA 2PV7A 3TZ6A 1RYNA 3QXXA 3ZZTA 3DEZA 1BE0A 1KQPA 5EUCA 4BKPA 3QVGB 2VH1A 1GSIA 4NK4A 4R9NA 4DIOA 3K05A 4EF4A 3ES9A 3LUJA 1MFPA 1HNWB 1HEIA 1MDFA 1Y1SA 1N77A 3T94A 2BMWA 3ESXA 4LXTA 3QWHA 4GOXA 1NSYA 1ENYA 3JVDA 1Y81A 1YS9A 3ZE6A 5JR3A 3WADA 2D13A 4C2TA 5I8PA 2XB2A 1LV8A 4BTVA 4YDHB 1QIFA 3S5UA 3ZPXA 1WDTA 1I36A 4G1MB 1P31A 2IXDA 3HYSA 4P2GA 4PLFA 1NXVA 2EJCA 4HF7A 4BKMA 1F2DA 3OPMA 4A8TA 2QN7A 4WZZA 1NUHA 1VPVA 3RSQA 3L49A 4Z6KA 3QFHA 3O8QA 4QPZA 1C8LA 3EY4A 2X7JA 2JNWA 2XY4A 3UMCA 2FZ4A 4QARA 3VSBA 4DMGA 2WWIA 2O57A 3H3JA 5CX1B 2W2LA 4AYWA 2HXSA 3O8BA 4U2EA 1C9JA 3WHPA 4DUGA 4DY6A 3I28A 3ERCA 2YQZA 3L84A 4QGAA 3TL3A 1VSTA 1Z6TA 4J16C 1PV4A 1BJTA 4G8BA 3OAAD 3ZHYA 2IF2A 4AMVA 2BFEB 2PZMA 1PS8A 1FW6A 1NGSA 2I62A 3H6HA 1G2PA 1BDJA 1MA3A 2CXRA 3WIOA 1N0UA 1UJNA 3DCIA 2X14A 3WLFA 5EIXA 4UBMA 3KZVA 4BKQA 4NPAA 2Z4RA 3AETB 4FDVA 2JC3A 3N2KB 3GVCA 4LHXA 5FPHA 3WWYA 1RQ2A 3NYIA 3EEIA 4U3JA 4IIYA 4XVCA 5E9AA 1QPGA 3L7IA 3WDLA 4EHDA 3EEBA 3G23A 4F4IA 2PAAA 3ONFA 1SQFA 1T1RA 1XDDA 4S1PA 5HCUA 1YVPA 1E61A 3OIVA 2ZSEA 2Z8YM 3WKDA 2ZYSA 1V5GA 4CTJA 1RI4A 1EH5A 4NAHA 4YMLA 3BA6A 1HG0A 3LRXA 3GDGA 3BKXA 1WUTA 2VVTA 4N01A 5CB4F 1QM5A 4JOCA 1NQTA 1XAHA 2CYBA 2RFLA 4JI3B 1RHJA 2HPVA 4YX9A 4MVJA 3BERA 1YOVB 1R18A 1TO6A 2XYVA 1CDEA 1Y5NA 2V6IA 4P98A 4FGWA 2UYQA 1SUSA 5ER6A 3VZQA 2FN9A 5AW3A 4REMA 1CY6A 2WJYA 3G2QA 4PSKA 4JLPA 2FAXA 2FKAA 3VOAA 2RGNC 1KO4A 2Z3ZA 3D7LA 1N2CA 4RACA 2QAJA 3NLLA 2BH9A 2QRNA 3MMPA 2OHFA 5KDLA 2BFPA 3KEQA 5JCOC 2WWYA 3CCFA 1G7SA 1WDMA 1BX1A 2B7BA 2OBYA 3I3SR 4JLSA 4LY9A 1UBSB 2ZS7A 3TSWA 3AL0C 4RVHA 3NIBA 5AI5A 3HU3A 4O29A 2ZJ6A 4O1HA 3IBYA 4DDWA 3TDNA 2FZ5A 4MGIR 3DFUA 3PB3A 4TT3D 5BQPA 1HZJA 1SR8A 2OHXA 3RRBA 5FJJA 5HTOA 2HDOA 2C5FA 1HLPA 3EDQA 3ZJ4A 3AO0B 5J4YA 5JPCA 3R9XB 3VVLA 4IGEA 2NTJA 4UEQA 1H8HA 1I4WA 1PEYA 4IQ8A 3WBFA 4ZYWA 3CPJB 1VG9B 3WIUA 3VU9A 3K9CA 3MTDA 4FFPA 5IVIA 3O1HB 1XMSA 3IL2A 5KIAA 3L9WA 1MO5A 3H2IA 4ZO9A 2CNWA 4L5BA 5DNWA 4ZOBA 5CCEA 3CGWA 3RK1A 4FOSA 4L0MA 2JLZA 1W44A 3UJHA 2DOKA 3H9QA 4Q9KA 4E03A 2GRAA 1P0IA 2Z2XA 4MYDA 3K09A 1O95C 2GPTA 3UMFA 3NDIA 5AIBA 1PNTA 1NBOA 1TM5E 3HC7A 4GU5A 4EUSA 7AT1A 1YOVA 5L3ZA 2UUCB 3L0DA 2ZR0A 4I1SA 721PA 1TEZA 1W9MA 5K8LA 3H2KA 2JL1A 4PTZA 4FHCA 2X9LA 3Q2KA 2XVZA 3RRYA 2OBMA 4QFBA 3V1NA 1K3UB 2RK6A 2OCAA 2PLAA 2RAFA 3I5AA 2G0NA 4M8LA 4QVKA 1T3LA 5BWMA 3PFNA 4CV3A 2PPLA 5EKTA 1A0OA 2QR2A 3LTNC 3WRVA 3BKWA 1X80B 1T5TA 1D07A 3CKLA 3BMXA 3ICEA 1YB5A 2H9AA 2W2KB 5CA1B 4DFDA 1F8XA 1EE9A 4C6TA 2X7HA 3FTDA 4IHAA 1U5BB 2BDUA 1XKXA 1W0KD 3PXAA 3JZDA 3B3QA 3HCWA 2IX9A 1ZH2A 3FJ1A 1CUAA 1CHNA 5I7WA 3GH3A 2GZ2A 2DFVA 3T3GA 4WCFA 4HRXA 4TWBA 3DJYA 2PUCA 1NDUA 3N1UA 4E5VA 3IALA 5JMTA 4N9WA 4R8SA 4IWNA 4MR8A 2FQWA 4QICA 2HK7A 3MMZA 3PK0A 5K0CA 1R9NA 1EDZA 1ZGZA 1K75A 1O3YA 2QZ4A 2NO1A 4H35A 3X1WA 4UXIA 1N5JA 4PZEA 5EVCA 3TLEA 5IASA 4ZTUB 1QOPB 2CLMB 1KOFA 5FI1B 5CHYA 3CVVA 4ER3A 2VFAA 1P45A 1TUBB 2B9EA 4XB1A 3AWDA 5JQWA 2C7VA 2V8BA 4UHKA 1LFDB 2ZRQA 4X6XA 2VWQA 4DA8A 1LLQA 1U5CA 1NRWA 1UFVA 2CFOA 1FQOA 1UP4A 3DBHB 3EH2A 2JIMA 2QTLA 2IOHA 3LQQA 4FWBA 5IEBA 3IAS6 2INGX 4X1IA 1K3FA 2G7ZA 2FP4B 2BELA 1N9GA 1MHPA 3HL4A 4XB6B 1TTPB 1SKAA 1IRXA 1MO6A 5FPPA 3TI9A 2O6HA 3ZVMA 2QSUA 2C95A 3ELYA 4IDHA 5FPKA 2FCRA 5SYMA 3WX0A 2W6OA 5IULC 1H2YA 2Q1WA 5E3IA 2JLUA 3K15A 1UOQA 4G9BA 3KO8A 3RC7A 2Q2NA 4GI2A 2AG8A 3C4JA 3VVMA 4X71A 2HYDA 4NP6A 4NESA 4C1NA 4YECA 3EFBA 4YRDA 3HZZA 3ZWWA 1N8NA 1TPYA 3B1WA 4WKNA 3IESA 3PXXA 4YJGA 4N5HX 3GBSA 1MV5A 4FHDA 3CSUA 2LKCA 3OOJA 5AUNB 1Z6ZA 4Z9AA 4M6WA 3FNHA 1DSSG 1JR4A 2XTJA 3ROZA 5B2FA 1WCIB 5CVDA 1WQ3A 1J2TA 2PL1A 2BM9A 4OU4A 3I0NA 4J1SA 1ZGCA 3OA2A 4MEAA 3JVUA 3FX2A 1N1GA 1VMAA 2VYQA 4JDPA 3U1VA 1BX3A 5HTKA 1Q14A 2XZTA 4O59O 2QUZA 4E09A 4MW2A 3TUIC 5LOVF 1URPA 2A3NA 3E48A 4KTVE 4PX2A 1KK2A 4TXMA 1K98A 4DZTA 4I6GA 4HYYA 1BHQ1 1Z8FA 1OJLA 3EB9A 2YYAA 3D4BA 4FOPA 2FUG1 4DUZB 5EWLB 3DBLB 3N8HA 2Z58A 2VYVA 5F2KA 1NI5A 1ZP6A 4BFVA 3AEKB 1E8MA 4KIGA 2WD7A 1NBMD 3H3FA 1CR4A 1PGOA 3HABA 3O47A 2Z98A 1GA6A 2IYXA 4QECA 1QX4A 3QVGA 4ZMBA 1WXFA 5K0GA 5IVPA 2YL2A 4C4OA 2QUBA 3CTMA 1JDBB 4WBSA 4PZZA 2OP0A 2XXBA 2EW2A 2B6HA 5D7BA 3VR0A 4BNGA 4HB0A 2C42A 3EQ2A 2NVUB 5IKPA 3D6VA 2I66A 4ZT6A 1WBDA 2FUCA 3CRNA 3EISA 5FOSA 4KZPA 1N2ZA 2ZYTX 3B3FA 4EJ6A 2UZ1A 3FUXA 5AOCA 3R0IA 1EDDA 3LNCA 2CLSA 3NX4A 1YCHA 1RXYA 4Q3BA 4KWCA 4M0CA 2R1UA 1S1CA 5I8WA 5DIZA 5LMZA 1N2JA 4RF4A 2B92A 4HH1A 3GH1A 3PQEA 4ISCA 3TNYA 2AFHA 2BLLA 1S4QA 3GMIA 2H85A 3SX0A 3A3OA 2FJPA 3C3CA 3OETA 3RARA 5G0SA 5C1OA 4KHPB 1QYIA 4G0PA 3RSGA 2OORA 3QXSA 4KMOA 4KQ2A 2G1AA 1CUXA 4BRUA 1X38A 3FPFA 1A5TA 3W3AA 1FUEA 2COUA 4H1TA 3K0FA 1I1HA 3N0RA 4OJTA 1UKAA 4CMEC 5CT4A 2QNIA 1YGPA 2VP0A 3R3WA 1R6XA 2QRUA 3NOQA 4ZCQA 3ZVKA 3HO8A 3Q5GA 2BFWA 2MSKA 3O4JA 3KHSA 1WB9A 4NXMB 4CM9D 1FXSA 4BTEA 1A9PA 4Z0HO 3PQ6A 1MR3F 5FPTA 1XRMA 1B6GA 3VYVA 1Q1BA 4B3BA 1WL8A 2AQKA 2PS1A 4RMHA 4OMDA 2CV2A 1AKQA 1R6VA 4HNUA 1QF6A 2OZLA 1W6RA 1JE1A 3GJRA 2HBYA 3JY6A 2WJJA 1MRZA 4QEKA 3ZZ1A 1RZRA 3ZHCA 2CL7X 1SHUX 2FE4A 3A1DA 1NNEA 2XWQA 4RD3A 2H9IA 2PKQP 4QOJA 1IG3A 3FD8A 4INZA 4X92A 1I1NA 2CBZA 1ZRNA 3BHMA 4JMPA 5FYQA 1OV6A 1XLTC 2WA2A 4PZDA 3ZJVA 1ECBA 1ONBA 2J4CA 5FDFA 3NI2A 1OH8A 1E60A 2WD9A 2OE2A 4MV4A 3H5OA 2BIFA 4EYOA 4G4IA 1ZK0A 1H2ZA 1HOXA 4PNPA 4EH1A 4NYJQ 3T12A 3EFOA 1XKQA 4RAOA 3CN9A 4RHCA 1L5KA 2NU7A 1XZJA 4X94A 4BNXA 4EQ6B 1UBRS 4DRYA 2IEBA 2I7TA 2EX4A 1XSEA 2VBIA 3ZWOA 2P79A 5JQGA 5FPSA 4PRKA 1YB2A 3B6IA 2A9RA 1TJYA 5ES4B 3LUKA 1ESEA 2HSZA 1P18A 3E7FA 1OZAA 1CVLA 4CLEA 3LQ2A 2CJXA 5K0BA 1N32B 2H08A 3DL7A 3AM5A 4IFBA 3I6IA 1CPYA 4R1LA 4CLOA 1V0JA 1WMAA 1SKYE 3CVYA 4F3NA 1VJ1A 5B3LA 3F71A 5A5DA 1Y9JA 1YDFA 2IV7A 1J6UA 1WXXA 2R7AA 1ZD2P 4EUKA 2ORIA 3EIFA 1EHCA 4R69A 3HFRA 5CU7A 4PHCA 4QVIA 3LAWA 2W7TA 4R41A 1K6XA 2FOXA 4RZUA 1V8ZA 1W7AA 2J87A 2WVAA 2ANBA 3TRIA 3Q7TA 4ITVA 4GL4A 2ZQ5A 3DEHA 5TQVA 1U99A 5JBIA 3IP6A 1B73A 1XTSA 2P9GA 4X3CA 5C80A 4CG2A 2DQ4A 4QG3A 4WJZA 3M1AA 3MCAA 1UPXA 1T6YA 2B25A 4MQ6A 4HQ6A 1JTFA 3Q2OA 3ZGOA 5FOQA 1U0TA 1BGVA 2E3JA 3NTQA 3VI4B 4QJ5A 3BTVA 4DIKA 1EUYA 5CYGA 1FNMA 1DDOA 2P9ZA 3OZRA 1X1SA 4FGUA 4N0EA 3HU1A 4YV0A 1UBJS 4P6VF 2D2XA 4OHVA 1UINA 3ZIUA 2DXIA 1XIVA 4NOKA 3A6EA 4YREA 1X3SA 1PJ3A 5BT9A 2P11A 1L5HB 5TEVA 4CBVA 1WOMA 4YRTA 2VNSA 1R6BX 4KACA 4LW8A 2RG7A 3DLIA 4GLBA 4D92A 4I50F 4AO7A 3FMGA 4MWOA 2RARA 4DYVA 3ESYA 1I6MA 5D01A 2V7GA 4B0PA 3SNHA 4C3VA 3M8KA 2X1LA 1JJ7A 3BGDA 3NFRA 2HNKA 2PWBA 1E79D 1YOBA 4O63O 4ER5A 2IUYA 2Z9CA 2P5YA 1AN9A 4NEQA 1NQOA 3ETEA 5EQTA 3NIGB 3TCKA 2W43A 5J59A 4OLFA 3IPRA 1AJEA 2LIPA 5CVUA 4X1OA 5TLSA 4GMHA 2XBMA 1QAMA 3V4RA 2BH2A 3AVUA 3BK2A 4NL4H 4ZKEA 1VDZA 4JP8A 2XQGA 4DCNA 2WHPA 2MU1A 1YR6A 2NG1A 1Z74A 2FR8C 3ZXSA 1NJ2A 4KUHA 2B7CA 1ESNA 3M9LA 2OPHA 3ZCPA 3ZE2B 4LVCA 2YX1A 1Q2XA 4DM4A 1NI3A 3N2GA 4BMNA 5IAEA 5IYZF 1CX9B 3GDWA 4FQ5A 4EABA 2UVPA 3BSWA 1UPBA 3U19A 5CTJA 1RYBA 1NF8A 3GRKA 3LMKA 4FFWA 1GZ4A 4X84A 4RW0A 2IXEA 4DS3A 3RSHA 5LUAA 1FFCA 4AWAA 1SHLA 2PM8A 4IZHA 4S0XA 4WH0A 3V97A 4F97A 5LZ2A 3T38A 1UAGA 1QGOA 3K20A 3L7OA 1RWXA 1Y89A 2X9VA 3NT2A 4C30A 5KMGB 5T7BA 4YRKA 3MXTA 4BO8A 5IT4A 4Z4FA 5DCLA 3R7FA 1DIBA 6ADHA 3GLIB 2A84A 5LL6P 3FTFA 1DAGA 1NUAA 4A3SA 2G72A 2ONJA 1EAMA 3PPWA 4OXNA 4L8GA 5EZ6B 2EZTA 2FRXA 3VHRA 4EGJA 4R84A 3HTXA 1H65A 4J0CA 3KDSE 3SX4A 3ACDA 4AWBA 3BH7A 2CXHA 3DCNA 4YP5A 1OAAA 1FBTA 2X5KO 2JI9A 3E9ZA 4KKVA 4ZARA 5TQ2A 2ZYIA 3RPEA 3SIWA 3S2YA 5BMOA 5KQLA 1NJ1A 1NDHA 1LDGA 3DE7X 4NABA 4BNDA 2BMVA 4L07A 5E7JA 1QE0A 3MK31 1Z6GA 1JDNA 1XBTA 3WWOA 3C4QA 3HDYA 1OF1A 1C2YA 5CA0A 1WXHA 3AY3A 2HCFA 1CUZA 4C05A 3O91A 1RXIA 1G59A 1NE7A 1WV1A 1EX1A 1GZHB 4A23A 4D7AA 1F0NA 1Q57A 5ENVA 4X20B 4MWSA 4U7HA 4DJEC 1ZL0A 5ALLA 5LQNA 3DWEX 1N1MA 5AVXA 3CMCO 1DQYA 3EDRA 1VBKA 4PZ0A 2RGAA 3B53X 4WOPA 3T99A 1JIKA 3FZQA 4B84A 4HZUB 1KPHA 2IHTA 5HBGA 3GHHA 2QR5A 1Q5PA 1E3MA 4PWZA 1E7RA 3GRVA 4CV0A 2OA0A 2PWPA 5U9CA 4CNQA 3E8MA 3IVXA 3ONDA 1GFZA 1E2EA 1MJGM 3KJGA 1HV8A 2FWJA 2GBLA 1P4AA 1X0VA 4G97A 1GARA 2AMFA 4WGFA 3SN6A 2C0PA 1P0CA 5GGXA 2VJMA 1UEIA 5FV7A 1DXQA 2ODNA 3IIMA 2B4YA 4KUGA 1W36C 2Z0MA 4OA8A 1OZHA 2P9BA 3C7DB 4COOA 2NT3A 2O23A 4F8JA 2UXCB 2CFRA 1TZMA 5BNZA 3DAHA 5KTTA 3UMBA 2WT8A 4GWLA 3PHJA 3BVPA 1L6IA 4M9XA 1TXGA 5DGXA 1J39A 2QM7A 3G0GA 1O97D 3IT3A 4WXRA 4UAJA 4UFOA 1MG0A 1XTUA 1RCFA 1EZ1A 1RPTA 2ATVA 4ZIRB 4HH3C 4U6QA 2H1FA 2PGXA 3EXIA 1ZC4A 2MT9A 1HMYA 4GX5A 5JCJD 2QROA 3C3PA 2I1WA 3W2HA 3U7GA 2DVMA 3AZPA 3PPYA 4JA0A 4NYIQ 1AKVA 4UVEA 4B85A 1KZYC 4D99A 3ROFA 3RU2A 4XJSA 4BWVA 1GG8A 1QNLA 3GD7A 1L7MA 3KUCA 3OUUA 2E0IA 4HGOA 3LPMA 3OLZA 4IZ6A 3H16A 4XFKA 3ZYCA 3OIFA 3RODA 2Q5FA 1RM0A 1XT6A 2W6JD 3AXTA 1IYZA 1ORRA 4TL8A 2E4ZA 5CDSA 2PEZA 1A95A 5FBVB 2R7KA 3OOEA 4MARA 4NBLA 1KVQA 4P4UA 2JAXA 4RD6A 4C4ZA 1NVBA 1R9JA 4C21A 2CLIB 2OLEA 4E3ZA 2C92A 1PJCA 3FZGA 3S2FA 4GMDA 4YLGA 2GEVA 2GF9A 4EKEA 1RXCA 2FF7A 2YIDA 3UMGA 2E49A 2HFKA 1BWSA 5JXJA 1OWMA 2XGGA 1NVTA 2Q0SA 2R00C 3NHJA 1KRWA 3OT5A 4NARA 1I3CA 1P2SA 4OTZA 2B8EA 3JRXA 1OYVA 2VH2A 3LPLA 1CP3A 3JQAD 5F9MA 3UA3A 4B6PA 2FZEA 1ID1A 3DGFC 2D54A 1MQ9A 3F4BA 3PCRB 1GIAA 3IO3A 4AJPA 3NDBB 3JYLA 1N34B 2QYSA 1SUDA 3I9V1 3ADDA 4Z1MA 1NKVA 1A97A 2OPBA 5EE0A 1G18A 3JQBA 1GQQA 1B6TA 4LC0A 1E62A 2PU5A 4BFLA 3QYPA 1Q2UA 3CEAA 1HRKA 4WI1A 3RC1A 5KOIA 4KI7A 3FPHA 3ESAA 4PAOA 4PPNA 5DTQA 1SXQA 1N6HA 1N8KA 2R4UA 4INPA 2B78A 2IPAB 4HH0A 5K2OA 1NC1A 1E2IA 3OTQA 5CLLA 4RENA 4G85A 5DBEX 5FTKA 2V9ZA 3O38A 1KSGA 4TMWA 2DPGA 2W71A 3I58A 1SXHA 3A4YA 2PH3A 1N3LA 4HWGA 2O0MA 2AXQA 4E2XA 1TB4A 2I3GA 2QD4A 1TW3A 3M34A 4KRYA 4BNLA 2D06A 4FGZA 1TNDA 5G02A 5D86A 2J0UB 4F9FA 5LMUB 2LR0A 1X3LA 3AUAA 4L5JA 4BMPB 4UULA 5FTMA 1TMGE 2EQ5A 4IXTA 4BP1A 2R5NA 4W8HA 4W7SA 1C2TA 1WF6A 3P2MA 5KWVA 1O9GA 2Q45A 4JJ4A 2BCGY 1L5MA 2NT4A 3OUZA 4BUCA 1GDTA 1K4KA 2HHCA 1E6UA 2BI8A 1X19A 2BHNA 3X1MA 2IHYA 2YXDA 3I3OA 1O2DA 4GGOA 4ZC8A 3KQLA 4AJNA 1JG3A 1V8BA 3PE6A 5KCMA 4B75A 5I7EA 2W0SA 1XZQA 5EJIA 1YR3A 1N2OA 3CRRA 3GNSA 1OAKA 2G5GX 3VKWA 4EI7A 5L45A 4D6PA 3KEGA 1NBHA 1UBLS 4RORA 4A91A 3O3NB 1I6LA 2WD8A 3HMKA 4JYBA 4OVKA 3UFXA 4EI8A 2JLYA 2RSLA 4JP5A 3GBPA 4DT1A 2A78A 1HE1C 2FWNA 1P2VA 2PGJA 3EXFA 2BGKA 5LUBA 3BE4A 1YMVA 1YUNA 4FHZA 1DO2A 2B1JA 1EVJA 3AU8A 2P2SA 3Q7EA 4FNOA 5J5AA 1FYXA 3KQMA 4C0KA 1BKSB 1QHHA 2RGGA 1U63A 1DX6A 1QIGA 1DTSA 1TA0A 4QM6A 2FUG6 1UBUS 3V8RA 1RVV1 3BXZA 4ZVRA 1OBVA 2Z9BA 3B51X 3DKRA 3QHPA 3LHSA 3NMUF 2Y1GA 4MW4A 1JG4A 1DKOA 5B30A 1QP7A 1DAOA 1ZSVA 2OK8A 3KOZA 2G4LA 4YRCA 3T1OA 4CEHA 2NU6A 1YS4A 3AJEA 1JGTA 4LVNA 2ECPA 3KV3O 3EQZA 1VHTA 3VPDA 1XVIA 1DAIA 1ORTA 1U0JA 4E2ZA 4KDRA 3PNKA 1M73E 3SDBA 5L3RA 3UT5B 4Q7EA 3ORQA 3ZXXA 3MWDB 4YV2A 2PYZA 4LRTB 3DMTA 4C0QC 4NF2A 3LQRA 1PG5A 1I2DA 3UAWA 1QH0A 1KWGA 4DSOA 4KHZA 3HHPA 2NZJA 2VXOA 3FTPA 3KFXA 4Q4DA 3N2EA 3DMRA 1Q7EA 3S1AB 4U9IS 4R8MA 1Y4UA 1Y8CA 3EAQA 1E58A 3ZHTA 1QYCA 2F1JA 3OLVA 3AR4A 4FWTA 2VEDA 3O83A 2I2FA 4WASA 1PWXA 1T4DA 3LDGA 3UXYA 2QXYA 4ARZA 3BGOS 2X0JA 4IWYA 4E88A 4EHJA 3KWFA 2ZM5A 2VH5R 2DKNA 2EL7A 3SMQA 4D0SA 4BFTA 3KZ1E 1B76A 2GILA 3NRBA 3R76A 4FEAA 2OZPA 2ZRNA 4EYKA 4XYLA 2ZS8A 2FWRA 4XX1A 3M3DA 2WTUA 4UTOA 4G8DA 5I4CA 3H19A 4TVSA 2BGIA 4AO6A 2HEIA 1LBEA 1EVEA 1LQTA 3IP5A 1Z37A 3QJYA 2XVYA 4RVUA 1CERA 3X3HA 5KTKA 1GN8A 1J5PA 5BMVB 2YMPA 4DYHA 1GFIA 2EGUA 1SCBA 3DR5A 5JVDF 2WP0A 3E2PA 1PQWA 5T6MA 4X00A 2KX7A 3AV3A 5H0IA 5DEIA 4B81A 1KBZA 2F7SA 1QTNA 4PLVA 5HGXA 3ENNA 1PZHA 5ALZA 1ZNZA 3UW3A 1IIBA 2KJQA 4YJ3F 2UVPB 4D9MA 3DNMA 3GJXC 2Z57A 4P3NA 1ZL2A 3PQ7A 1IWBB 4HHEA 3LIIA 2DHEA 1H3EA 2ZBFA 2GSWA 3A9CA 4O0LA 1GTZA 3WGJA 3RYFA 4LJAA 2KBEA 3AKEA 4NH0A 4RCVA 3AU9A 4RHTA 3MRSA 2PJZA 5DYNA 4M1MA 3SZMA 3ZHXA 5IJ0A 3HCFA 2WAOA 1V48A 2PPVA 4ZQFA 1AK9A 3GGDA 1EXNA 2WJAA 4KL8S 4A1FA 1G3QA 1QNFA 1F4LA 3F1LA 3HLKA 5MGBA 1GRQA 3AL3A 2EWWA 4FVTA 4CJXA 4H7KA 2V7QA 5DWDA 2A1UA 3IDQA 4TGLA 1W5AA 3NTLA 2EC5A 2P3LA 2VRCA 4OHZA 4XVUA 4TM8A 4LI3X 3GEPA 4YMHA 4BVBA 4IIHA 1NZDA 4Y6PA 3BZUA 5KKAA 4C2AA 3P5SA 4IIBA 4J4BA 1P2UA 1PBNA 5BN3B 3EIUA 1GU7A 3A2MA 4G8CA 4QBGB 3HJHA 3OT1A 5CCBA 3L7MA 3GMDA 3O2SB 3PR3A 4DMKA 5AVYA 2NU7B 3CG0A 5HDBB 2HI0A 3KZXA 4Q7KA 1XAIA 3ANMA 4KR0A 2AI2A 4WNIA 3JQ8A 4L57A 1IAVA 2KMLA 4CMHA 2IYSA 3LQYA 2H51A 1KE1A 1TLL