4ETIA

Crystal structure of ywle from bacillus subtilis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
150
structure length
150
Chain Sequence
MDIIFVCTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase ywlE
publication title Crystal Structure of YwlE from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 61
structure length 150
sequence length 150
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etiA00
1HEYA 5DKFA 1YMUA 3OMWA 4H60A 2FN9A 3IDOA 3JS5A 2KYRA 2JVKA 3O75A 5IULC 1YS6A 4DN6A 2FSPA 3ILHA 3M9WA 2WRZA 1DJMA 2PMCA 2GI4A 2LIVA 5DTEA 1YIOA 4KK3A 3F7NA 4GPAA 4NQRA 2HPHA 1DZ3A 3IPCA 3BRSA 3LUFA 2A9OA 3LOPA 4HNRA 1VRVA 3HM9A 4S04A 4G0ZA 4KVFA 3DLBA 4E7PA 1OXKB 1URPA 3Q9SA 3GYBA 4ZMSA 3E61A 4N47A 9ABPA 3CG0A 4G0PA 2A9PA 3GBPA 2FEWB 4RK5A 5CNMA 2YHBA 4W5TA 2QXYA 1M2FA 2CD7A 3C3MA 4MPTA 1JYEA 2E4UA 3H5WA 5IC5A 3KYJB 1PEAA 1A2OA 3NBMA 4W5NA 2MSKA 3O2QB 3Q7SA 3CLKA 4Z9BA 1ZHHA 1ZN2A 4MS4A 4N0QA 1K68A 1W9HA 4Z4HA 2FQXA 4RS3A 5KQPA 3F73A 2WMYA 1USIA 3T95A 1TMYA 3GL9A 4KRFA 4JOQA 4WWHA 1EHCA 3H1FA 4HNSA 5TQ2A 2R48A 4EGSA 1E2BA 4LDZA 3O2JA 4YV7A 3F6PA 1DC7A 5BRJA 2FEPA 3L6UA 1TJYA 2LP4Y 3CNBA 2R47A 2VUHB 3H5IA 4MLDA 1JFTA 2P4UA 3RVKA 1A04A 4MLCA 1GCAA 3HUUA 3LUGA 1E6LA 3MM4A 1USGA 4G86A 4TLMB 2JVIA 3T38A 1NXXA 1NXOA 3D8UA 4LDAA 4TN5A 5JNTA 5KI6A 4RXMA 5EWLB 5EWMB 4MAAA 4Z4EA 3C6QA 1NXPA 5KWSA 2L19A 4PICA 2O20A 3TX6A 3LUJA 4NICA 4NV3A 2RJOA 4G0MA 2QVGA 1S8NA 1DBQA 3Q15C 1EWVA 4RWEA 1NXTA 4XXHA 4HYEA 3SAJA 3Q41A 2IPLA 3DZDA 1NXWA 3LUAA 5TQ0B 1JBEA 5IEBA 1AB5A 4Y9TA 3UUGA 2QSJA 3EQ2A 3QLUA 1ABEA 3NHMA 3RVPA 1KGSA 2JBAA 3CTPA 3I42A 3IPAA 4JASB 1JH9A 3HVRA 3HZHA 4RKQA 2PAFA 3FFTA 2QVCA 5TPWB 2PUCA 4F8JA 5JS1A 2NZVG 1PUXA 4PEVA 5EWLA 1D5WA 4YO7A 5F64A 4ETNA 1QQAA 5GOTA 4DQDA 4NCBA 4Z9AA 1GCGA 2AYXA 4MS3A 4RY0A 1XHEA 4RK7A 1PEYA 3A0RB 2OENG 2WY2D 3MQ4A 5IUKC 3H6GA 3RH0A 3GBVA 5JNRA 1MAVA 2L2QA 4PZ0A 3SQNA 5TPZD 2NUBA 3N0WA 4LE0A 4QYWA 2E4ZA 1JDNA 1QO0A 4Z4CA 3MMNA 3RVQA 3IP7A 3KJXA 3N0XA 1LK0A 4Q6BA 1QPZA 1BDJA 4XARA 3BBLA 1U04A 1Z25A 3EODA 3N8IA 4KV7A 5FWYA 1APBA 1WETA 3O2SB 4N41A 3DGEC 3HDGA 4MR8B 3RVNA 4Z4GA 1AB6A 1NY5A 3UK0A 4EYOA 4O5AA 4LE1A 4KPYA 4OLBA 4FB4A 1RPJA 5IEJA 2PL9A 5KQMA 4MYRA 4QPJC 2MYTA 4ZPJA 3RVSA 2H3HA 1W25A 4LZLA 3OM0A 3H6HA 3JY6A 2WJAA 4EVSA 6CHYA 5B3JC 5E3JA 4IGAA 4KQ9A 1TLFA 3O21A 5DLEA 5BQ3A 2PJUA 2FMHA 3TO5A 1ZH4A 2W42A 1R8JA 2FEKA 3FFXA 1ZH2A 4PE5B 4OBBA 2GKGA 1A0OA 4IF4A 4S05A 4JB2A 4LE2A 2RDMA 1QQBA 5ED4A 4RDCA 1FFGA 4OG2A 2WJWA 2HQRA 3OQOA 2FN8A 4MR9A 3GRCA 5IUJC 3HK2A 2HQBA 4WXMA 2ZAYA 3VNBA 1H9CA 1CYEA 1L5ZA 2VUIB 1P8AA 2ID7A 1Z13A 3HDVA 3LKVA 1JFVA 4JAVC 4TMYA 3QLVA 3HS3A 4IMJB 3RVLA 3CKMA 2HJ9A 4L85A 1PNRA 4MR8A 3DGFC 1UDRA 4N0PA 2A9RA 3Q7RA 4N76A 1USKA 1MB3A 2FMKA 3SY8A 3QX8A 3RVMA 2M98A 1QP7A 1U2PA 1SXGA 2CHFA 3GV0A 3KS9A 4ETIA 1ZY2A 3R0JA 4G0QA 1FSPA 4MR7B 1YK0A 4Z0NA 4CBVA 3S99A 3LFTA 1SD5A 4G0XA 1IIBA 2WB4A 2VYCA 4YR7A 1I3CA 1GUDA 3ROFA 4HNQA 3QK7A 3GWGA 2PE5A 1YMVA 3HO1A 2PLNA 1DCKA 3T6KA 3NHZA 1QNLA 1CEYA 2YHAA 1Z12A 1QP4A 3KLOA 5GQSA 3OQNA 3QEMB 4EVRA 4KK4A 2IKSA 2R25B 2IPNA 2DRIA 3A3KA 3SM9A 3QLUC 1KRWA 1F4VA 2XDYA 2J48A 5EWJB 1DG9A 5I4CA 3I09A 3JPWA 3TD9A 4IMIB 3O74A 4YLEA 2JBAB 3K4HA 5C5EA 4RK0A 1JDPA 5EWJA 4RXUA 1FFSA 3CZ5A 1MB0A 4LX8A 3KLNA 2I6FA 4OATA 3KKEA 3LUDA 1Z17A 3RVJA 4FE7A 3IP5A 4W5OA 2IPAB 3OMXA 2FMFA 5KC8A 1NXVA 4E7OA 2HQOA 3JPYA 4XASA 5KQGA 1Z15A 2JB9A 1ZAYA 2LUOA 1M2EA 2E4VA 2FLWA 3HCWA 4MQFA 1OXBB 4JA2A 2OQRA 1LJLA 1EWKA 1ZGGA 3H1EA 3QX9A 4EY3A 4KNYA 5CNKA 3HUTA 5KC9A 1DRJA 5KQLA 3JTEA 3OM1A 1LBIA 1SXIA 4XAQA 1BDIA 4Z4IA 1DP4A 4YWHA 8ABPA 1JWLA 2NT4A 4M88A 1CHNA 3O1JC 4RXTA 2QW1A 3LUCA 2F8TA 4JB0A 1C0EA 4H3KB 1D2AA 2IDMA 1Z18A 1QKKA 1NATA 2JCGA 4MQEB 1PNTA 3QLTA 1QP0A 5B3JA 3OLWA 4O1HA 2MYUA 5FBKA 2FTKE 3H75A 2ZWMA 5FWYB 5ABPA 3N53A 1MIHA 1QMPA 2L17A 2A9QA 3H5VA 2FQYA 3BILA 3N6VA 1EAYA 3IP9A 4RY8A 3HJFA 7ABPA 3LUKA 1VPWA 3H5LA 5JNSA 3FFWA 3CS3A 2FMIA 2JK1A 1Z2DA 2NZUG 3OLZA 1P2FA 4RK4A 4F3TA 3CU5A 5HKOA 3M9XA 2E4WA 4RK6A 4WUTA 3RQIA 5T7BA 2N9UA 4ZMRA 4EYQA 2FLKA 3HSYA 5HM6A 1JX6A 1DCMA 3EGCA 4UHKA 2PKXA 5EWMA 5FBHA 5IX8A 1JL3A 4RSMA 1ZVVA 1KRXA 2B4AA 3Q7TA 1U2QA 4LRQA 4XFKA 6ABPA 1JFSA 2LPMA 1JYFA 4MRMA 4PYRA 1BAPA 3GT7A 3OLXA 4GNRA 4O1IA 5IBQA 1GUBA 3CFYA 5FWXB 3B2NA 3CRNA 2CHEA 3LMKA 3MA0A 1YS7A 3UKJA 2PUAA 3RVRA 1DC8A 4RU1A 4G0OA 3JVIA 1EFAA 2E4YA 2FQWA 1BA2A 1ZITA 1FQWA 4MGEA 3D02A 3KTOA 3F6CA 4MR9B 4WT7A 4RZSA 5CNIA 5JNUA 4D6XA 2PUDA 2X7XA 3HEBA 5JNWA 2JVJA 3DLHA 3CHYA 3DBIA 4Z99A 3C97A 2AYZA 5DCLA 1ISRA 2GBPA 1VLZA 3I5AA 1D1PA 1L5YA 2FW0A 5HSGA 4OLAA 4MS3B 3G85A 3MYYA 3SG0A 4WXEA 4DADA 1YVUA 2PUFA 1DBWA 3KCNA 1JF8A 1LBHA 2FVYA 4YGXB 4Q7EA 1RXEA 4KQCA 3OO0A 3MF4A 5TPWA 4FE4A 2RJNA 1P6QA 2F8SA 3HV2A 4JP1A 4TLLB 4QYMA 2LBPA 4D6YA 1RNLA 3IP6A 5JNVA 4F06A 5JS2A 3KG2A 3FGZA 3NNNA 4W5QA 3A0UA 1U0SY 1E6KA 2JRLA 2H0AA 2PL1A 5PNTA 2WWVD 3L49A 4IRXA 1XHFA 4ZJPA 4MQFB 4F11A 1PHRA 1YK1A 4L4UA 4RY9A 2MYNA 3JVDA 5CHYA 1E6MA 1JLKA 2R4QA 4MS1A 3W9SA 1JHZA 5TPZA 3O1IC 3KYIB 5BR1A 4KMRA 3OLVA 3MIZA 3QELB 3P9YA 4ML3A 1Y1LA 5FWXA 1Z2EA 4H3HB 3KSMA 3OO1A 3E3MA 1ABFA 2IPMA 3BRQA 4EVQA 5BRAA 3ILYA 2B1JA 1DBPA 3QELA 3I45A 3ROTA 1T34A 2PUEA 3N0RA 4MS4B 2QZJA 1DRKA 1SRRA 2TMYA 3QLVC 1RZRD 4MQEA 3TB6A 3N75A 3M6MD 5CNJA 1D4ZA 3EDCA 3QEMA 3EJWA 3A10A 1BDHA 2FXIA 3K9CA 2MYPA 1MVOA 3LKBA 1M5TA 1XWWA 2HSGA 3C3KA 3EULA 4N03A 3CZCA 5D2CA 1K66A 3EQZA 4IILA 4RKRA 2V0NA 5DGCA 1ZDMA 3FDFA 3T8YA 4W5RA 2BGGA 1YTUA 2M1ZA 3C3WA 5HQJA 4EYKA 3URMA 2PUBA 2RGYA 4MR7A 2L18A 3KHTA 4ETMA 3H5TA 4MS1B 1QO0D 5TQ0A 4EUKA 4YS6A 2NT3A 3OQMA 1EWTA 2E4XA 1ZGZA 1LJUA 5C5CA 1RZRA 1FFWA 1GLGA 3OLYA 3HXMA 1ZESA 2CWDA 4KREA 2GX6A 3GA5A 1Z26A 4OTZA 4QICA 4D74A 2MSLA 1B00A 1NTRA 2FKAA 2P9HA 3EAFA 4MRMB 3H5OA 5TE9A 4P1ZA 4WZZA 3CG4A 3VNAA 4KFCA 4ZYLA 2QU7A 1KMIY 1TM2A 4G0YA 3SNKA 5IUNC 1J56A 2QV0A 3G1WA 4G97A 1U8TA 2IYNA 1M5UA 1P6UA 1F51E 2Q5CA 3H1GA 3O1HB 4P98A 4XLTA 2PUGA 4UHJA 3LTEA 1RXIA 1ISSA 3FMVA 1NXSA 4EYGA 3QEKA 4B09A 1Z16A 2ID9A 3BREA 1SXHA 4RK1A 4YCSA 3TMYA 4RV5A 1DCFA 2IOYA 3RVOA 2VK2A 3LUHA 5TQJA 2MSWA 4NCAA 1TVMA 1D1QA 4Q6WA 4Z4FA 5T3YA 4YRZA 1BVHA 1C4WA 5TQ2B 4KZKA 2GWRA 1VKRA 3NNDA 4YP9A 4F12A 3NNSA 2QR3A
chains in the Genus database with same CATH superfamily
1QCYA 5EZYB 4KNYA 2JCSA 3N7TA 3SYLA 1BZYA 3CUUA 3K5WA 1HQKA 3T3DA 5LXTB 4JR2A 1XZIA 4OX9B 1Y6QA 3QNWA 4L08A 3TKLA 3UMGA 5H59A 1KS9A 3GJ0A 5JXJA 2HWKA 2GLXA 5ARBA 1RHQA 2P9CA 1WB4A 2Y0DA 1R88A 4RVDA 3ZWVA 4H2DA 5LOVA 4WRRA 5FLKA 3FSGA 3TDKA 3W79A 2CJFA 3U1VA 1RRFA 4A27A 3F7NA 2C61A 2I03A 3LH5A 4M2LA 5K3BA 3ZY3A 4B82A 2W00A 1EX7A 3INNA 2J9XB 3ZEIA 1XTPA 2FPPA 2Z8YA 3NJ4A 3BKWA 2QI9C 4G36A 3QFTA 4Q9AA 1FNNA 1SC9A 3Q40A 5G4KA 4E7PA 5ULLA 2EFHB 3V34A 4UKDA 5JZMA 3FSEA 3AHIA 1USUA 4I50F 1F9AA 3OQVA 4TYMA 4TYQA 4U2FA 4YO8A 5CA0A 4A10A 3K72B 4DPLA 3IE1A 1RZUA 2A86A 3PBKA 1CZRA 1DXYA 5EC8A 2DFLA 2HCRA 4KOAA 1QHIA 3HN6A 2X9VA 2SICE 1Z6AA 2RGNA 1E79A 3F0TA 3H5WA 4Q4LA 2VYFA 4IDCA 3L8HA 1QHEA 2HHLA 2XUJA 3NBMA 1O94D 5CH8A 3CGGA 2Q5HA 2LXNA 3DONA 1EDBA 2JZNA 3ESZA 4JB3A 5IKMA 5JAUA 4BLWA 4N48A 1U1IA 5IM5A 2W6JA 1NA5A 1UBHS 1ZJYA 3MCWA 3STTA 2HT6A 1DPGA 1MRNA 4PO3X 2V96A 5EQDA 3F47A 1DEKA 1EESA 1TMYA 5E6UA 5KVSA 4F8EA 1NUUA 1XRQA 2J07A 4U00A 3L0CA 3P0JA 1B3RA 3U4QA 3BTSA 2ID8A 4N6OA 5LLSA 1LQUA 3N0VA 4FGLA 3VHRA 5D84A 4V1CB 4D9JA 1E7MA 5A6SA 1F14A 5A5VA 3H05A 3NCHA 3OJXA 5BRJA 3O73A 1FFYA 5EUMA 1O0CA 2P9YA 4BB6A 5CYGA 3IUQA 3DBOB 4JOCA 3A31A 2F1JA 4KNWA 4OYLA 4B75A 5IN4A 2BZ0A 4KFUA 3MWDB 1U7WA 1JMYA 3MW8A 1QE5A 5BPHA 2I87A 5E0KB 2XW6A 4AL4A 5A04A 4PPFA 2DPXA 3ZV6A 1EE2A 1SBYA 5H02A 2B3TA 421PA 3GFGA 4GX2A 5GINE 1KMHB 2QQ5A 2OVBA 2R11A 4Z4EA 1MO6A 1YKFA 1PV1A 1XZHA 2NO9A 5EINA 2WIGA 3A1CA 1TK3A 3H3JA 3B3FA 1ANKA 3IJRA 5U4QA 4BJHB 2XX3A 2QVGA 4MVJP 1KORA 4AFNA 5HKAA 1ZKDA 1ZOIA 1UIRA 2UUOA 5TMDA 4TT3D 3T5PA 1O08A 1PZHA 2AFIE 3PHIA 3CE9A 2FRXA 1IN5A 4FR2A 2DSTA 1T4MA 2ZSDA 3DHWC 3NTQA 3AHDA 1G98A 3F3SA 5DX0A 3SLKA 4CMBA 5HJEA 1UC5B 3PEEA 2WSSD 3GCGA 1ABEA 3CSDA 4PO9A 2O1XA 4C0BA 2WJHA 4FYIA 4O3MA 2ORVA 3WQBA 3V9PA 1UK9A 1JHOA 1S4QA 3I42A 4TRNA 4MQUA 4WFQA 1YQWA 5EOVA 1KDTA 1Z0IA 1ZMTA 1XP5A 2CNNA 3DCNA 3HU2A 2HA7A 4X97A 4ZI7F 5BW8A 1BJKA 2JFUA 4P3YA 2EJCA 5GWXA 3ONEA 1QYIA 4C22A 3CH5A 1MF7A 1P9NA 2O57A 3KQNA 2EF0A 3FF4A 1A5BB 4PYLA 4Y2TA 3OJOA 2QL9A 3WNBA 2P2GA 4ETNA 4GE3A 4J8PA 4R8KA 4NEHB 5GOTA 2DQ4A 1W52X 4Z9AA 5ALGA 1GCGA 1GQRA 2AYXA 2XMPA 3C87A 4DQ0A 1MO4A 4MV7A 2VT7A 2F3QA 5IZCA 4NY1A 5B2FA 3S1SA 2VT2A 4R2WA 5C46F 2WWTA 2K87A 3PSAA 1FYVA 1G8KA 4JK3A 3FWYA 4EG8A 2VEDA 4I9NA 2QZ4A 2P68A 4MQMA 5ALWA 3CJQA 3IP7A 4GBMA 3SMQA 1UKVY 3X1ZA 2Q4TA 2J9FB 3N8IA 3U0BA 1GTVA 4IIFA 4EJ0A 4EVIA 1HETA 1SD2A 3ADOA 3DAHA 5CX4A 2QBYB 1NW6A 3ZIUA 5DXJA 4I5FA 3C6BA 4EPYA 4WKPA 5AKIA 1T9BA 2EL9A 4M0DA 2BSXA 2CZCA 4JYCA 1Z7YA 4FYWA 1NV9A 1MEOA 3KTAB 2RE8A 3H6HA 1Z83A 3PXAA 4Y0VA 4YCLA 3KVVA 2RG1A 4GVLA 1C3EA 1J6UA 3E2MA 3HGTA 1XVLA 3GLQA 4P7JA 4EPVA 1U0NA 2OCXA 3GEDA 1AZWA 2CNOA 3QMWA 3PPIA 3WLKX 2FSVA 1KRHA 3RC3A 5L3QA 4HSEA 3U3KA 4X65B 2FZEA 4ESVA 2GKGA 4S05A 3BXGA 3OPVA 2JRCA 1UIMA 3UYKA 5K0SA 2GM3A 2YV1A 3JYHA 4P4SA 3QE9Y 1GZSA 1JJFA 1LPPA 2CNLA 2GN6A 3GRKA 4Q4JA 4GICA 1G1MA 4RNCA 3RUDA 1GTZA 4WXMA 1ZNQO 2OGWA 2X0JA 4PZCA 1ZH0A 1DZIA 3H1BA 4G65A 3UWSA 2B35A 1MDFA 3JQ9A 2QQGA 3W2EA 3HDVA 1XVTA 2HA4A 4EUNA 4CLXA 2VPWA 2QRQA 4ED9A 1Q84A 1RWBA 2W6ZA 1MCZA 2P75A 3ENKA 4B48A 1IEWA 2XZTA 2ATIA 1X1DA 4TSFD 1MB3A 5AOAA 1PFGA 1NU6A 4BRZA 1PCXA 1H1TA 5E9JA 1E0AA 1VYUA 5EE0A 4AKSA 7MDHA 3EIWA 3A9UA 2TSYB 2W9XA 2PX8A 4RZ2A 2GFQA 2I78A 4QUEA 3HFGA 5HZGA 4MEAA 3GZJA 6REQB 3LBHA 5AVXA 3OZEA 1PDVA 3TLEA 5I7FA 3K20A 5EIOA 3UB3A 1PJ2A 4JUFA 4Y18A 3UXMA 2ZIGA 3HL0A 3CVJA 3TE6A 4JZKA 2MR6A 2RBEA 3NRCA 5CFMA 1PQUA 2QP3A 4J7CA 4Q00A 5BURA 1FFEA 2H65A 4H4EA 2F6RA 4I2VA 1FS6A 3ETJA 4DR1B 2NW6A 3N6RA 3UKOA 2FPOA 2IEGA 3PJFA 1XZAA 1Q0LA 1SELA 4YAKA 2YHAA 4J1NA 4CI9A 4DNPA 3QTLA 1UZAA 1PT9A 2BMFA 3BIXA 3DP9A 4EB3A 2PUJA 4DGQA 1X38A 1E1LA 5EE3A 4F21A 1B4DA 3HMKA 1YD7A 3ZXXA 2XDYA 3EXEA 3UANA 3NIDB 3MT8A 3ANXA 3DBLB 4H7FA 1M2NA 3TBHA 4ABYA 2O0LA 3B38A 2RFLA 3WMGA 1ULSA 3EYWA 2GRAA 3R5HA 3IBFA 2PTGA 1SKYE 3CRW1 1OC2A 3FGNA 1PJ8A 1GRVA 5I7AA 3SYNA 2I2AA 4AWAA 1EUZA 3VR6D 3GLGB 2ZXFA 1VSUA 5B58T 3IT0A 1NMQA 1JE1A 4OHMA 2XDAA 5I7RA 5KC8A 3DZCA 1NSYA 3JPYA 2OHJA 5KQGA 1G8MA 1NI4A 2GRJA 1XDSA 3JYNA 3OCWA 3WLHA 2XXAB 3QBDA 1Q92A 1TYDE 3STUA 1G8GA 2J67A 4Q48A 1KVUA 2F43A 4ZQFA 2HD4A 3FYUC 4W8GA 5I3CA 1OT3A 2YN4A 3LQ2A 4UREA 2X42A 3CRMA 3VNRA 1DEAA 5DW3A 5BVGA 4AY6A 1Y42X 3IUEA 1J2EA 4Q12A 5DNVA 2H4WA 4FMDF 4A0FA 1XYYA 2FPLA 1AS3A 3C5EA 5G41A 4D9EA 4B4WA 2FPPB 1ZU4A 2BFCB 4KDFA 4BNFA 3K0FB 4RLFA 5JSYA 1J1UA 1JFFB 1R12A 1CUSA 1UUFA 2CVOA 2QUBA 1BROA 1C9NA 3KV3O 1C0EA 2V55B 2D5CA 2F67A 1RJEA 3WGNA 4A8TA 5IAGA 4BGUA 1U11A 5T41A 2HLDD 5L3VA 1Y9DA 5AM4A 1NVVQ 1MU0A 1NURA 1Y5LA 5FOXA 3CRZA 3C6KA 3H2KA 2DTXA 4GRAA 4Y8VA 4LJ9A 2BH9A 2QLMA 4B3XA 1D2HA 4XJVA 1T8UA 3L7MA 3N6VA 1VJTA 4FJ2A 1ESDA 1CLUA 4ZREA 4ZQBA 5JAIA 2R62A 3BD6A 4RELA 5KHOC 5ELXA 1LLCA 4CT5A 2NG1A 5GJBA 2FMIA 4Q16A 5FLYA 4JLJA 1J8QA 2FETA 4L3OA 5ILGA 5IT4A 1FYFA 1YCDA 3DLAA 1Z73A 3AVXA 1GUZA 3Q3IA 2XJ9A 4JP2A 2X6TA 4QU0A 1NAHA 1YDMA 4UM5A 4C7MA 4DFDA 2CYCA 1M2KA 2Y4NA 4UUAA 1KY2A 2DFTA 2ZVQX 1C7FA 1KSHA 3FTQA 3GPBA 3TW6A 2I3BA 3E9NA 1QCCA 2A9FA 1E58A 3GLHA 2X40A 1BGWA 1VPEA 3T4PA 3PDIB 3C15C 3GW8A 3Q3CA 5AVSA 2LGJA 2VP2A 2W2OA 2FF7A 1L5OA 1I5EA 3LXUX 3QTBA 4FIDA 4NR0A 5GAJA 5CFZA 3P2KA 1E5VA 4EY6A 4QREA 4HZIA 3COPA 3DV0B 4GGPA 2VQDA 1GUBA 2AOTB 4BIMA 5C3MA 3DQPA 5GTDA 3WOVA 3LHSA 2DHDA 4FX5A 1CUEA 4ZC1A 2CDAA 5TF0A 3ZJ4A 3ZWDA 4EEKA 4RU1A 2GK4A 1DUSA 4YHHB 1M66A 4CKYA 2GHRA 5DB4A 2P11A 3D6TB 4HH4A 1QHHB 1KQOA 2PGIA 3LWDA 4RPKA 3FSRA 3WBJA 3ZWOA 5JASA 5JH7B 2RHDA 4UE6A 4PNHA 2Q1XA 4EJSA 4L78A 1ODCA 1FU8A 3AI2A 2I7DA 2COUA 3ACCA 2Z4SA 3UWKA 2VBIA 3AUYA 1LPMA 5HBGA 3RIHA 2PWPA 2D1TA 1SK9A 5HSGA 5IXSA 4MS3B 2BGWA 2Z3ZA 3RKRA 2L42A 4UUPA 4WHMA 2AV6A 1QO7A 1IY8A 3JRXA 5DGXA 5L4SA 3DDCA 1AKUA 1ZUWA 2I3DA 4KAFA 2OUIA 2YDXA 4Q7EA 1YI0A 1TU4A 1B0PA 4XGNA 4QTTB 1SU7A 4CM8B 3A70A 4DC9A 2P0EA 1NSTA 2F8SA 2JBWA 2V7XA 3BGVA 3BIWA 3PUWA 4ZO9A 3VYRB 5J4KA 1H66A 3VTKA 2NU6B 1QF9A 4MVWA 4BNJA 3KYCA 3A0UA 2D2EA 1MXFA 4DA4A 3SQOA 1G4HA 4YREA 1HLFA 2HNAA 2XY4A 1JMKC 5GP1A 2BDEA 5GZ3A 1CR6A 4YJ2A 1D0VA 2VJBA 4CKBB 1FNMA 4XB2A 5BN3B 2IOFA 2VXYA 3TCXB 4G07A 5CHYA 1GGMA 3IQWA 2BRUA 1SB8A 4J0FA 5CLJA 3DHYA 4TRJA 1JEJA 1EA5A 2NU9A 1ETHA 4KO2S 1CE8A 4X3PA 1H4VB 4P4SB 1OF1A 2HA0A 1OI4A 1VBMA 3AEYA 3HPQA 1X77A 3THYB 5DK4A 2VRNA 3H3XA 5BY2A 1T34A 1IUOA 4MS4B 2AHOA 2QZJA 4OJYA 3S2YA 2OESA 1P80A 1W1UA 2EQAA 3HBLA 3WNCA 1J25A 3TB6A 2WABA 2R8XA 1K8QA 1ODIA 1QJ4A 5JPIA 3RU2A 5KX5F 3OJLA 3HBNA 4ZPXA 2ZQ5A 1AQ6A 2D59A 3Q1KA 1XFAA 2NZYA 1BHSA 1VIMA 2CL5A 3PIDA 4ZTZB 3VU1A 3FKJA 3E53A 4KX3A 4IAOA 3JD4A 3LO8A 4GD3Q 1SB9A 1VM6A 3N3AC 3PXGA 5BQFA 3M81A 4RQBA 2QT9A 4YRLA 4ENRA 3QV1A 3REOA 4HPXB 4CT4B 2EHJA 1QR2A 2DCUA 2RKOA 1TD1A 4Q66C 5H0IA 3URMA 2CZGA 2IW3A 4TTSA 5DOVA 3WISA 2H31A 4CF4A 1T8SA 2FNAA 4ETMA 4BLRA 2QZ9A 3QKTA 4C2BA 2BKEA 2FI1A 4MTCA 4OMFG 4R6XA 3Q6IA 5B7NA 1HE1C 5DHRA 2Q45A 4KUGA 3ZCQA 5DO9A 4MARA 4YRJA 5DP1A 1YIDA 1XXHE 1QGAA 2OXEA 5C8ZA 2C96A 2B8WA 2JASA 2JLCA 3O84A 3PCRB 5COBA 5TVKA 2ZEJA 1RWVA 5LKRA 2CLDX 3BQ9A 1R0XA 3BWCA 4OMCA 1Z0FA 4UAJA 1UR5A 3EY4A 3UCXA 4Z86A 2AL7A 3IE2A 4F4CA 3HXOA 2HCFA 2ZR7A 4BFYA 1JVBA 4TV9B 4G0WA 2VP9A 2PXCA 3H5OA 2ZSBA 2J0QA 1PHPA 5TF4A 4A36A 1R4NB 2VJOA 4WK0B 4EUFA 2R8YA 4BLOA 1UBEA 3HVUA 3IOYA 1VCHA 3U13A 3U31A 1SU8A 3NAMA 5JDIC 2JEOA 1XRMA 1LUAA 1WXDA 3FNHA 4HTAA 4ZOBA 2ZBFA 2ZUTA 1G64A 2XD4A 4JNCA 2YY7A 1TX4B 3DL7A 1N1MA 2W90A 3E3LA 3BREA 1O96A 4AJLA 2W37A 3ZV5A 4OUDB 4ID3A 1DV1A 5DT9A 5IVPA 1RD4A 2I6UA 4FGWA 4QOHA 2NQ2C 4U2BA 5JSQA 3IVGA 5K3AA 1TVMA 1DIGA 2XLBA 3CA8A 1LI7A 4DHEA 1ESEA 1XVIA 3DSRA 1GQQA 4FCWA 5KCMA 1E9BA 3K5IA 3NPAA 2C5SA 3UOWA 1NKSA 3OVMA 4LRYA 1WWKA 2ODEA 5DKFA 1TYBE 4FT4A 3RJ9A 1LXCA 3MIIA 3EOAI 3IELA 4Q3KA 4TKVB 3RUHA 1YU9A 1YS6A 5LR6A 3CM0A 1XDDA 4XUEA 1YZKA 1I36A 2JW5A 3PDWA 1HE3A 4DLSA 3AUAA 4ZIRB 3A6HA 1R0SA 5KYYB 5CDUA 1DJMA 1KARA 3S27A 3TLXA 9GPBA 3NWBA 1AQNA 4OQPA 2VTBA 5CA1B 2DR3A 2QG4A 2C7PA 1TD9A 3WWOA 4NK4A 2QX8A 4YRAA 3HM9A 1EXWA 3R77A 1SQFA 2P8SA 4EHIA 2BBOA 5AESA 1XPRA 3DLBA 2AJBA 4LJRA 3T1VA 4D7AA 3O3NB 1IBRA 3D6JA 1JDZA 4ZMSA 5IXJA 1WBBA 4ZYUA 1ZVKA 2BPOA 1BMFA 2UUCB 3GA7A 1FXWA 4QFBA 2YZ7A 3X1KA 5A3JA 2M6SA 2E0IA 4GEKA 4MTLA 5ALEA 2DF8A 5ALSA 3UENA 2OGZA 4LXYA 3VYVA 4CNQA 2QXYA 2PS3A 3MJSA 3PQFA 4QOIA 1CJSA 1QFSA 1MX3A 1X7DA 1SC3A 3HVJA 1U8YA 4PLVA 1KH3A 2IODA 2QU8A 4FFDA 4OHPA 1V1RB 3BHIA 3VPBA 4PLCA 4C14A 1P0FA 2NZ2A 4RHXA 5K09A 4UM9D 4L8LA 2F43B 4FOSA 1DINA 3T9FA 1RMTA 3AGPA 4KQIA 3M6VA 3PICA 3PYXA 3FG9A 4QPCA 4QX6A 1SHZA 4CLRB 5KQPA 3QUCA 3ZGLA 3AERA 5AMXA 3ZLUA 3H8WA 2AXQA 1KKMA 3N28A 3NS7A 4D8TA 3G7NA 3AXSA 4FC7A 3CY6A 1E0JA 5AKJA 3R5TA 1SKQA 3ES9A 1X7HA 3N2KB 4G84A 4GPTA 4TV8A 3LVRE 1CG6A 3GOHA 4UULA 3KQLA 4BNHA 4FJ0A 4AS1A 2O54A 2HI0A 2HPZA 3I76A 3CURA 4MSUA 3LPNA 4G6ZA 5CA0F 2LD4A 3OPYB 5JY6A 1H2YA 2WTXA 1JHRA 3RVKA 3W0LB 2E21A 521PA 4CLHA 5FCDA 1NZFA 3HUUA 1COWA 3VR4H 1YAJA 1FS4A 2QMUA 4A7PA 2X0RA 5IRCD 1GPKA 1MIOB 1R10A 1XAJA 1XLVA 1Z6GA 4HXGA 2PUCA 5EWLB 5U9CA 4LDJA 3HYLA 4FQ5A 2YWEA 3PZRA 4F04A 4DEVA 3KKLA 3PHLA 4M1SA 1CUWA 5EERA 4AQ7A 1WXHA 1OH8A 3FR7A 2JHCA 3HXPA 2Y8EA 3AI1A 3PUXA 4JLUA 5IARA 5UKDA 1J09A 2VK1A 2ZW9A 1ONNA 1I30A 4N5DA 5FXMA 3ROMA 4FGZA 4BZXA 3RYCA 3ZDAA 3GHHA 3LPCA 1AZSC 3HL4A 4UTVA 2OOKA 4I2NA 3DFZA 2QM7A 1Q0UA 4WV3A 3RFXA 4F9EA 4P53A 2PGOA 2XKBA 3DOEA 3VVCA 2KLHA 3BXXA 1Z4MA 3WFIA 3I1JA 3LNTA 4L5JA 1KO7A 3B8HA 3FPHA 2H92A 4XIIA 1EM8B 4ZO6A 1NFRA 1BH6A 3HZHA 2EL7A 3HY6A 4OGKA 2PAFA 4ZGBA 2WTNA 3G1UA 1HGXA 3G9TA 2ZUVA 1DT5A 2YDYA 3DB2A 1LX6A 3WBFA 4V24A 821PA 3RBXA 4QECA 1ZOOA 2PKEA 4N6GA 4D46A 3LAWA 1P33A 3TVYA 4HGYA 4MS3A 1WTAA 3WGMA 4YRNA 5IM4F 4AW9A 4ZOCA 4BMDA 1V6SA 4DR7B 2Q21A 3D7KA 3MQ4A 3N2LA 3DZFA 4BVHA 2WWIA 4RMNA 4FQ7A 3EE6A 3WK9A 2L2QA 3BM5A 1Z4OA 5IPFA 1XCPA 1P7WA 1JHVA 1MZPA 2I2DA 4RYDA 3CT4A 5C8YF 2H5IA 1IRXA 1B8PA 3D4IA 3I9V1 4HVTA 3NBKA 2NU7B 1PR9A 4EF6A 3UPUA 1QH9A 3G5TA 4DYVA 3EODA 2J5RA 2PRYA 3I2GA 3O2SB 4NFLA 5JBQA 4KWEA 2QX9A 1VHTA 5AFSA 4E0BA 2P9GA 3JZIA 3L6CA 4FDLA 1TQ6A 3QOXA 4KPYA 1L5HA 2YJTD 2Q41A 4AJKA 4ROTA 5FBZA 1I7QB 5FJIA 6CHYA 2QGNA 1V39A 4V1CI 3P45A 3VYWA 1EP3B 1U8CB 5J59A 4PXSA 2VF2A 4ZHQB 1ZOSA 5BWBA 3DT9A 5DLEA 2JAUA 1TM7E 4A0SA 3UBMA 3ONFA 5HBRA 3TO5A 4QLOA 3CISA 2XRMA 3E27A 2I7XA 1QLJA 2QR5A 2QTLA 2Y4OA 5AVJA 4NBLA 2MSCB 1N7HA 4L6IA 4IHJA 4PLYA 1J8VA 3CZ9A 4AY3A 4IYRA 2QQ0A 3GQVA 4NTZA 4DQLA 1PBTA 3HR7A 4WSOA 1PR6A 3SIPA 1G16A 1FFHA 1FA9A 2QTVB 5EUCA 1IOZA 1UOEA 5BN5B 1IJKA 5CVVA 3GRCA 1K8RA 4MQ4A 3VNBA 2AFIA 3SF8A 1Z5OA 4YMIA 3DCIA 1YJAA 1JEAA 3OH8A 5KMGB 1Z0UA 2CYBA 2GXQA 3LYAA 4YDRA 2Y9PB 2BDUA 3QVMA 4BP9A 2NP7A 1XZGA 3DTVD 1OY1A 2VYVD 3LW7A 4L85A 4X66B 4OQZA 5BQ5A 3BGSA 3HKCB 2H17A 4HQRA 3AR7A 3WGKA 4Z7JA 1PAUA 1XLUA 2QI9F 3ELWA 4FLFA 1QGOA 1E69A 2W11A 1W5FA 2Q2OA 2P6OA 3NBQA 5KNCD 3BBPA 3IMKA 2QPTA 3T3HA 3ICVA 1KZ1A 4Q82A 3FPLA 4L5BA 1TVKA 1U8FO 4CRWB 4QJ3A 1O8CA 3REFA 5JH7F 2W2LD 3LWBA 2Z83A 4AO7A 2B8NA 2PX0A 1WMEA 3IVAA 4GXNA 3EIHA 1ZJWA 2G08A 3MYRA 1L7RA 4MV1A 1KMHA 2OV2A 2O2SA 1QZUA 4DNQA 1Z8DA 1I5OA 2FW6A 4EKNB 2OVFA 1SIWA 2XNCA 3L04A 3OSUA 4GBGA 4KTVE 4U9UA 1N57A 4PPQA 3BB3A 3ZD6A 1C8BA 1EJBA 1V45E 3QEMB 2C9CA 1P19A 4UHDA 5AI5A 4YYZA 5MFPA 1WU7A 3U56A 2ZDGA 1OR8A 3X2FA 2CXPA 3EQ6A 4NQZA 1JFLA 3TG2A 2A7XA 3ZS8A 1SBQA 2ILTA 5HQ3A 1N3IA 3AT1A 3BJMA 3MERA 3AEKA 4J0IA 4CTNA 3K4HA 1U63A 1Q0QA 4K9DA 4REOA 5FV7A 5DNWA 2W4QA 3V33A 4CR7A 2ZTHA 4CUJA 4EH1A 2PWYA 1TF7A 3HKDB 1WF3A 1NBHA 3SIRA 5BR8B 3RSSA 4E5VA 4EATA 2WD8A 5GJWC 5IVHA 4O2RA 4ALIA 1PGJA 1WPGA 4LJ7A 1N5MA 2D0PB 1OWMA 2LUOA 2XVAA 4OK6A 3VC3A 1W88B 4EKEA 1WD5A 1K7FB 4C0LA 2OQRA 1OTHA 1WXWA 2BGLA 2ODWA 4WA8A 4PO1A 5COQA 3NTXA 3KELA 2COEA 1G3IA 2XUOA 4HYTA 2ZI7A 3OQHA 2GUGA 2II6A 3EZGA 5H4HA 5HEKA 1MAWA 1NP3A 3TJRA 4JH0A 2HM7A 4LQ4A 5L7YA 5D7NA 2I65A 2HYDA 3T4XA 4QLBA 4TWZA 5J23A 3G2PA 3TK1A 1CFZA 2AR0A 5B1HA 4DWWA 4E1VA 2PFSA 3N5KA 1WPRA 4AQDA 3LX4A 2HRDA 3MJHA 3RREA 3WLOA 1RBYA 2CMFA 4CFYA 2NTEA 2FKNA 1PJTA 1JW9B 5WRFA 2NXEA 2EFEB 1EA7A 4CKEA 5AW4A 1QMPA 1JKFA 5CU7A 2Z8ZA 1PLJA 3PD1A 4QOSA 4R5MA 4XD2A 2I8AA 3OZBA 3R3VA 2HKIA 1O4VA 1W94A 3D5EA 3FPSA 4CEIA 3P19A 3W5IA 3TEFA 1HE8B 3O83A 4XE5A 1JQEA 1N2CB 3AZOA 4O08A 1Z4IA 3DE0X 4X6LA 2P1DA 2CXXA 2HC9A 5E7MA 1BG6A 1GZ7A 4RV4A 1CJTC 2FUG1 2JLYA 3DF9A 5LXTA 5HKOA 1T15A 1T2EA 4K7JA 4Q3EA 2B3DA 4RK6A 4S1NA 5I9IA 1E7SA 4Z8XA 1VCMA 4GO1A 2WDPA 3EK2A 1SAYA 3WKDA 1BFDA 1XTZA 3AMVA 4UM7A 5EPUA 1PTJC 4Q1EA 1D2CA 5EESA 4KE7A 4KWTA 5LM3A 2FLKA 3HSYA 3H7IA 4OXRA 5C8YA 2V1XA 3D4NA 3VZRA 1YR1A 2Q0SA 1IBLB 5MFZA 4NU0A 4PAMA 3TG8A 3L8EA 1X74A 5CMLA 3OHMA 2XZPA 3UO8B 2JLSA 2QRMA 5ESWA 1ZD3A 3O4JA 3QFHA 3RD5A 5L95A 3UJNA 2AFRA 4K46A 3GDFA 4IDGA 3R3JA 4WESB 1GD1O 3MC1A 1SXJD 4FNOA 5K3SA 3WRWA 5IJ0A 3MT7A 1OFTA 4HDKB 4QEKA 4ESOA 4ADSG 2I99A 1Z3IX 1CULC 1E99A 1L4YA 5JTUA 1PWXA 2DUJA 5JAQA 3U44A 1Y3AA 5T57A 5M2QA 3OLQA 3VNQA 5EIBC 5AW5A 4G0OA 3W2HA 4E5MA 5JFOA 5K8IA 3TUZC 3ZJ5A 1TU0A 1VG9B 1NL3A 4KRXA 2ZUEA 3W90A 2XAAA 4PSKA 2EFDB 1K4KA 1U94A 1BFUA 1EFVA 2DTDA 3B1JA 3U9SA 3EXG2 3GI1A 3NAGA 4I4CA 4E22A 3EIFA 5ALMA 3AGQA 4XEHA 1XZEA 1T2NA 2RGUA 4HLNA 1ZC3A 3NHAA 4N1AA 2O8FA 3I5AA 3DW3X 4HNAA 2FWRA 2NWQA 4NL4H 4ZOAA 2R6R1 1TMKA 3MYYA 1ZS9A 2VAWA 4ABTA 4D9BA 1ZJ6A 4L16A 1GEGA 3JRNA 2XNDD 3O38A 1TE2A 1U8EA 5IF3A 1XB2A 2O2XA 5AVZA 4EI7A 2VLBA 3COWA 4AI6A 4D0GA 1N7GA 2Q1YA 2AQHA 4LDPA 1E32A 1LC3A 4O0MA 2HIHA 1DWUA 2PLWA 2WG1A 3JQQA 2ZJ2A 3BJZA 1KEPA 2PX2A 1UT6A 3FGZA 1WLSA 4JQSA 4YWJA 3PGJA 1ENZA 4ZDIA 2PL1A 2VYVA 2G1KA 5FI5A 1CR4A 3QU4A 4IIXA 5K8JB 3K0AB 3KJZA 2X5KO 1Q16A 2IV7A 1AHIA 3KAPA 2HUPA 2REOA 2QKYA 5CJ2A 3SSMA 1SQGA 1NX6A 4IXMA 1PFQA 2I7CA 5HUJA 1XCOA 3OCVA 1JHZA 3KWFA 5DGHA 4HX2A 3O1IC 5B53A 4PIPA 3HP1A 1OLXB 4MVJA 3L4BA 2ZUFA 2ZIWB 2OO5A 5F73A 3PNVA 4TSFA 4EJ2A 3OU7A 3CH4B 3I6IA 4ON9A 1BOFA 2FLVA 5H9WA 4L5YA 2PGNA 4B81A 1A69A 3TSZA 4Y7DA 1A82A 2QJTA 2IZ5A 3AOEC 4DV5B 1QLHA 3FFAA 3QFFA 3FHCB 1M2VA 2F59A 5FPTA 2UUBB 1D4ZA 3EDCA 4J29A 1XPOA 1DKNA 3E4DA 4WGGA 5A2GA 3ESYA 2FVXA 2PZAA 1AK9A 1Y37A 2I1QA 5JZ9A 2HW8A 2W8BA 4CZ2A 1OWLA 2B25A 3PLNA 4M0UA 4BQQA 2JFHA 5GVSA 4ZN6A 5F77A 5LZ7A 3FDFA 3PNLA 4AF8A 4V1CA 3TTVA 5HHTA 2RB5A 3TN7A 3WLSA 4F86A 3IDSA 1ULUA 3U48A 1HDXA 1I9GA 5M04A 4B5KA 1X7GA 4GKJB 2DHRA 1XKXA 4PC1A 1AUOA 2IYQA 4EABA 2GKSA 2M9MA 3C0KA 3W5HA 3F4KA 4CU5A 1SUSA 4RY2A 5C5CA 4RH1A 3RIEA 2CLFB 5AHXA 1NLFA 2QIOA 2CWDA 3CVXA 3E7DA 5CJJA 3ZR4B 1YE5A 3WBBA 5CX1A 1Y81A 4S1WA 5CEJA 2X0DA 2D1RA 4WDQA 4GMXA 2FKAA 4HEQA 1E2LA 2VJMB 5H8WA 1BDMA 2W6OA 3IO3A 1F6BA 1WM1A 3CG4A 4MKXA 4J90A 3VNAA 4AO6A 4BVAA 2J3QA 2R1VA 1DPFA 2RGGA 3F97A 2ODTX 3K0BA 1IYZA 3NYWA 1Z33A 1LI5A 3JALA 4ND1A 1FIUA 3H1GA 4XLTA 1UBMS 1E1NA 4KLZA 3WWEA 5B7PA 5BSGA 4PG6A 4REQB 4TS3A 4YCBA 3CH6A 5JVDA 4AKGA 5FOWA 3MLBA 1UBTS 4EYGA 4PLWA 1O54A 4UMEA 2C1ZA 2O2ZA 2OCAA 3LPAA 4BAZA 1KE2A 1IJFA 4MV8A 1WBJB 4RV5A 1K0UA 3ZJVA 3RVOA 3FNIA 1N0VC 2GJAA 2QG9A 4X1YA 3AUTA 2AMJA 5AHWA 16PKA 1JKIA 2V7GA 5CM8B 1ZEMA 5CVCA 2IHYA 4Z7QB 5BNWA 3MUFA 1VI6A 1Y8RA 2VHEA 3W5CA 2YCLA 4EYSA 1NV8A 2FFAA 4U3JB 5D01A 4MEBA 1GG9A 2BFEB 3K8OE 3E84A 4O25A 2QE6A 4QHYA 4BLQA 3R9XB 4IS2A 3GLHE 1P2UA 1M0WA 1YMUA 3E18A 2A5JA 4H60A 2CFCA 3LFHA 4XGIA 3WB0A 2XYHA 1P4AA 3EG9A 1ZUD1 3PE3A 3BVPA 1P4GA 4I5GA 4IJQA 5EHIA 2D2FA 3TW0A 1UJMA 1G20A 3QXHA 5JFGA 4OHWA 4TYWA 2PMCA 4K9PA 1X0VA 2ZK7A 3MINB 3PKIA 3TIFA 1ZH8A 5LD2B 2JIDA 2R6ZA 4GYYA 5CXQA 5C8DA 5JV5A 1DGQA 4C6TB 3WGTA 1MNAA 4MK4A 4QGAA 2PZLA 4KVFA 4YEDA 4O6VA 1PGOA 1YL5A 4OMDA 1YR7A 3NVKI 3HI6A 4ALLA 2BCGY 1B26A 3ZHXA 1AQLA 3E61A 3HJNA 5LFAA 2H16A 2XVYA 3BD7A 3NOQA 3ED1A 1CS4C 4QUJA 2WICA 1BVYF 5HA5A 2WTUA 3P2YA 2QJFA 3KU4A 3UUWA 2IEIA 2WD7A 3REGA 5JD4A 2I7TA 3OPXA 3LNCA 4NYIR 1WE2A 3SC2A 4OQMA 4DG9A 1U6JA 1UC4B 1N6NA 3ESBA 3H18A 5A5FA 5FTKA 1A2OA 3THYA 3EVEA 1S3IA 5JHHB 2A84A 2GTPA 2ZUUA 1RP1A 2QLFA 3CLKA 2I4LA 1XAGA 3LZCA 3Q7SA 4FN5A 4Z9BA 1G4AE 2PA3A 2J41A 1IEVA 1T3HA 3ENZA 5J47A 2CF6A 2C7QA 1U2GA 5J1SB 1AO3A 2AFIB 4MRVA 3K9LA 3RIYA 3I6ZA 3QW4B 3LHKA 1E7QA 4Y1EA 2ZZNA 2YC4C 1AGRA 3DBRB 4HNSA 1I2BA 1L1QA 1Y4UA 3AKDA 3IDQA 1HT3A 2H7VA 4F7DA 2NUTB 4YV7A 5KBYA 4Y6OA 3PGMA 4OI1A 3SK0A 2CCJA 3VYSB 4FHZA 3RANA 5EIFA 4AWBA 3D2AA 3L8ZA 1KZ7B 4EECA 1QHYA 4D4MA 4DF3A 1IZ7A 4ZQEA 3OZTA 2QL5A 4RMHA 3VAYA 3PF8A 4Z3DA 2R47A 1KWGA 1QK4A 2GZ2A 2HADA 5JDIA 5E1OA 2NGRA 2VUTA 3QP9A 5EIWA 1DMRA 3GFSA 1JQ5A 4HWSA 5EMKA 4YYEA 3I05A 4FR0A 5EHNA 1BX1A 3FOWA 2IBMA 1C3VA 3LUGA 1USGA 4IDPA 4TLMB 3R7BA 4WXRA 3H8SA 3TEMA 1OLOA 3ZYCA 4C7KA 3E5MA 5C4IA 2VHVA 2Z9BA 3G2OA 3FBTA 5JYEA 4D1YA 3PYLA 1UBLS 1QONA 4TT8A 4IQ8A 4MRRA 1J8MF 4IUDS 4DSNA 2P9BA 2HCJB 2XA1A 2WUWE 4TZKA 1W1IA 2DQSA 3DO5A 2ZRPA 1YA4A 1K1EA 3B7PA 4WQMA 5JH7A 3THRA 3SAJA 1XEFA 3NALA 4Q19A 1US8A 2FXVA 3MFYA 5AWFC 2C84A 1JB9A 5CAEB 1VECA 3BSWA 3OC0A 5CT8A 3NCTA 1JQJC 1X7WA 1SKUA 1SURA 3VDRA 4OJTA 1P3Y1 2G9RA 4BQEA 1EGQA 2J32A 2VQ6A 3K30A 3LKDA 3EX7C 5AI4A 3K15A 1Z56C 3CT6A 4P92A 5DI9A 3HBFA 5AJYA 4M7RA 2EQBA 4HDNA 2QK4A 2VNKA 2TMDA 4JWKA 4D79A 4Z3OA 5EIAA 3RCBA 3L01A 2WUEA 3EDOA 4X7RA 3CXUA 5KTTA 4M9CA 1SOVA 2WVAA 4JEIA 4AP9A 1D09A 2FEOA 2NZVG 1WXFA 2AD1A 3HB5X 3MSXA 4RGQA 4YJ3B 3R7AA 3R5JA 3TTUA 1C1XA 2H5JA 1PD1A 1E59A 2XTNA 3MD0A 3NXSA 4K40A 4NCBA 2XDWA 5K99A 4MJLA 5CRIA 3ORYA 3ZG6A 4JI6B 3NP7A 2VF8A 4DJJA 3GJQA 4P4NA 3FPAA 1CR1A 4TVOA 3ECAA 3PHGA 4FMPA 3KJGA 1Z2PX 2A88A 5JNRA 2FRDC 4ZYWA 2X1MA 5TPZD 4L7QA 4ER6A 1MXHA 3MTIA 4M7WA 3N0WA 1H6CA 4WBSA 5LNK6 2E4ZA 1HZZC 2H63A 3G0GA 4QXMA 4A91A 3ROZA 1PK8A 3TLGA 1FLVA 4K9LA 4RPJA 2C97A 1QPZA 1Z74A 1BDJA 5P8WA 2BFFA 2PZFA 4HGQA 3BBLA 2WNSA 2WZDA 4LFBB 1C30B 1OYYA 1RIIA 2LCIA 1PT5A 2Y1GA 3DT8A 2AG1A 4KHZA 1H2BA 3IT3A 3SP1A 1P2VA 3PUHA 4BNGA 5K9ZA 3ESAA 4HDMA 4XD7D 1AN9A 4OA8A 5KWVA 2EGHA 4U7JA 1Q7EA 5DBEX 2PL9A 3MAGA 4RGYA 1BYUA 1FRQA 3PCXA 4LZLA 4OB6A 2H5EA 3S4YA 3OQ1A 1WULS 1J00A 5AM0A 5FX2A 4FM9A 4IGAA 3U3ZA 3Q87B 5CYPA 5JAZA 4II2A 1IY0A 4WXPA 1HL7A 2W2PA 3W3ZB 1M1XB 4FNAA 5I4IA 1KO8A 2J9RA 5D85A 4X7MA 1CQIB 3Q6MA 2VDQB 4MDYA 3VR4D 1J0CA 1PS9A 4OKSA 1VCIA 4RVUA 1A3CA 3SFZA 4C0XA 4BS9A 3HYRA 4TM8A 3MJRA 1GPDG 2Q2NA 3UT5B 3SDBA 3G5MA 4FTWA 4RDCA 5ED4A 1ZM3A 2CY0A 2E5WA 3DE4X 3CLRD 3G5AA 3KOWA 4GPIB 4TKLA 5IAEA 1XELA 2M6KA 4DCTA 4F6RB 2AXEA 1UFQA 1G3UA 2WKPA 3D81A 3QVSA 4QOGA 3R75A 4WZBB 3V2HA 1Z13A 1XQXA 2YYSA 3B48A 2MCFA 4HN9A 3EPPA 5I01A 4UDXX 3D5TA 5KX5B 3I9NA 4HZGA 1K86A 4DLPA 2P9QA 2ABWA 2IYTA 2V45A 3EGXA 2PBRA 2V7QA 1V1RA 4LYDA 3AEQB 5F4BA 2RKBA 3HCDA 1D1TA 2ZU6A 3CNEA 4JITA 2QAJA 4J0HA 5ALJA 5HJ5A 4BO3A 4KXUA 3E9MA 3STWA 3GB9A 2H85A 3GPDG 4XX0A 4C21A 3WLIA 4G0QA 3VSEA 4ZAZA 1KAQA 1WZNA 3TSWA 1IU9A 3L3BA 5FD8A 5DBGA 1SY7A 3CUTA 4Q9KA 1RM0A 4CHTA 1CIPA 2P5SA 4MPJA 1A7JA 5AHOA 1SEVA 4KPUA 1BVRA 3DMDA 3RYFA 1JDSA 1ZU5A 2C8JA 3COSA 3JD1A 2PLNA 3KQMA 4BNWA 5BMVB 5AUOB 4WCVA 1DCKA 1CEYA 3L1IA 3DKPA 3HCNA 3QYAA 3WMEA 1QP4A 2K5UA 1U0GA 3M6FA 3PV0A 1NBOA 4M49A 4XB6B 3WNVA 5CDTA 2R5WA 1QAOA 4DHWA 5A0TA 1CFJA 2O0JA 3LVBA 4ASUA 4CDMA 2IPNA 3RE1A 1ZHFA 1JA9A 1NQ5A 2W6JD 3LX6A 4L3WA 4P32A 4A2CA 1TT5A 1DG9A 1Z6QA 4R05A 1PV2A 1XZQA 2V3CC 1P1FA 1U3CA 2AGVA 5EWJA 3PC7A 4PXYA 4GX1A 4RXUA 4DE5A 2AW5A 5JEEA 4EDHA 4BCDA 2YNMA 3J81k 4GI7A 4P80A 1NQWA 2QRJA 4HQKA 4M9UA 3X1DA 1V7ZA 4M1TA 2I4MA 4WASA 3WWZA 3IP5A 3A6GA 1BVUA 3TX2A 2WAXA 2HQOA 4PIMA 3AILA 1WD7A 2X8LA 3LSYA 3X0DA 5ITZB 2XH8A 1ZR4A 1J42A 2YVUA 4RMJA 4YNBA 3QVJA 2XR1A 1Y1SA 1E2JA 3JWJA 4PS1A 4LGVA 3TZLA 4XIFA 4P81A 2JD1A 4UDYX 4COKA 1YA6A 4HXFB 5AKLA 1J1ZA 2VUSA 2GDJA 3KTDA 3KXDA 3M2TA 3ZU5A 1SVWA 1MA0A 1ZVJA 2W6NA 2FW1A 2HIMA 4MKHA 3NGLA 1P77A 5I7WA 2DERA 1HLPA 3MOIA 1B8NA 3LUCA 1OHHA 2UYGA 2AF3C 5IT0A 1D2AA 2Q62A 2BTQB 4Q1BA 2PZ8A 3HRIA 1RQGA 3A05A 1L4NA 2VYQA 4OGFA 5EZ5A 2ZJ6A 2IEYA 1R8QA 4KQWA 1WS6A 1E5DA 1GQOA 4OXIA 4F5WA 2DTEA 4G5FA 4O1HA 5DNAA 2B1QA 1UBOS 2VXOA 4K03A 4N8EA 2PX5A 1Z2CA 2FPSA 2FCAA 3N53A 2W2QA 3KAKA 1R6BX 5LMCA 2PA0A 2FQYA 4J7XA 1TZKA 3IRVA 3T5BA 3DFFA 1E0SA 2I8LA 1GY8A 1LLDA 2QZZA 2W2MA 3OZIA 2QN1A 4KH0A 3H5LA 1DKRA 3CS3A 4OM7A 4GLFA 4MQLA 2O5VA 3DKRA 3WZLA 2XUKA 1CF4A 1O95D 4IDBA 5DISB 4LBYA 4N3CA 4UATA 2QJWA 4RLQA 1U3WA 5KTSA 1O87A 1G17A 2W4MA 5T7BA 1WZ2A 4HXEB 3M4JA 3KO8A 4DIFA 1X13A 1ESCA 2DFPA 2EZ4A 3ELDA 3GH3A 4H77A 3W4JA 2X3UA 5FQOA 4DJDC 1ML3A 3S81A 3W9UA 1X7YA 5HM6A 4QZVA 3CUEF 1RJGA 3IQIX 4LWOA 1QIMA 3L7OA 3VYUB 4GT1A 3HN7A 3ZE8A 5JHGB 3AJDA 4NATA 1LFAA 1FVOA 4WGFA 3EWAA 3W2TA 4CQNA 2PZMA 2Q5OA 4LC0A 4OYYA 3Q7TA 4DKXA 2E6KA 4M36A 2NV6A 3D3NA 4LRQA 5AKYA 5JFTA 2CLIB 2I8CA 5CH5A 4WNIA 4UOZA 1MC1A 1H8EA 3DDSA 1HA3A 1N25A 2HHCA 4QC2A 1B42A 1E3IA 5T67A 1V1MB 3C7TA 2YRWA 2JNWA 5HIAA 3VKHA 4P35A 3A4NA 3Q0IA 4DPMA 3DZHA 3A1DA 3HFSA 2ZJ3A 1UT5A 3S3TA 5BUZA 4LWPA 3D6FA 1OZAA 5KNDD 2Z4TA 3VFDA 4JELA 4RVCA 4CDRA 2LKCA 3A9RA 3OFSA 1CRZA 1SC1A 1U8AA 1Z5GA 5JCOA 2INGX 3OF2A 1GFWA 4FMCB 1VL2A 2C29D 4B8WA 1JWBB 5DBFA 4CHGA 2H1IA 1BEUB 2HIAA 1ORIA 2OZKA 4NG5A 2JVJA 5EGNA 3FTNA 1YSCA 3OE7D 4B0OA 5MN6A 5DCLA 3RU9A 5FTJA 1VLZA 4EFMA 5D5HA 4EUSA 4OLAA 1EFCA 4XR9A 1X8XA 3BIJA 4ZQCB 4BNLA 5LA6A 1A88A 1L4GA 1XCJA 4Q39A 3F1KA 4ZARA 1I4TD 4JX8A 4YMVA 3BXOA 3KCNA 1RRVA 3BMNB 2RH4A 1VJ1A 1P2GA 2ZREA 3DXYA 3HFJA 1UPCA 1FXUA 1WXXA 4MQ6A 1DAGA 3K1TA 3WY9A 4FE4A 1Y34E 1N0IA 3HV2A 4FPXA 1O57A 3BFKA 3D0QA 4P6VF 5H9VA 2DBQA 3B51X 4IJVA 1DEHA 2A0KA 2D1YA 1SUWA 5KHAA 2JRLA 4OA5A 4GOXA 2DKNA 4IIGA 2WWVD 2VEOA 1WKBA 1K97A 2G82A 2JAQA 3U4QB 1YOBA 3H2ZA 4MW5A 4DZTA 4JI0B 4NMHA 1L5WA 4WK2B 4L4UA 2VSFA 3KWLA 3Q0TA 1B8VA 1VE6A 2DWUA 4MW1A 2CVPA 3NHPA 2GJ9A 3OMLA 4KO4S 3PHHA 1GPJA 1MP0A 3LDAA 5A5EA 1Y1LA 3BEDA 3JCZA 1JXAA 4Y2UA 2X58A 2YYYA 4BNXA 2VJYA 3IQDB 2GN2A 4K88A 4OJMX 4TZTA 4QUKA 4MPPA 1AKYA 3AVVA 2GM4A 2D0DA 3AP3A 1WHTA 2EGUA 4V0NA 1RHJA 5B57C 3M3PA 4PZYA 3JAMA 3KD2A 4DG8A 4KBYA 2HWWA 1JRLA 1DIHA 1MVLA 3CMCO 4ZQGA 4YN3A 1TMGE 1P62B 3CF6R 4X93A 5CNJA 5IAAA 3JSAA 4ZVVA 3E9ZA 1BDHA 2AT1A 1XJCA 2LIPA 2XMSA 3AR8A 1VCOA 3MS7A 3LKBA 3MUOA 3IMEA 1KEEA 4RULA 1CF2O 1LU9A 3T3NA 2HN9A 3SX0A 2WIDA 1KU6A 1Z0SA 4YBRA 2GK6A 3UV6A 4N5MA 5GJCA 3TLMA 4CFSA 2O5CA 2QYSA 3WHLA 2O7SA 4I0WB 2ZSEA 1EI9A 2GPYA 2Z43A 1OBHA 3N0TA 4JL8A 5BUQA 2FR1A 1NM5A 1JWAB 3L2OB 3VOAA 3VVMA 3MTAA 5LWHA 1SUBA 1EFVB 3H17A 3B89A 2L18A 5TVGA 2W2LA 3KHTA 5B1EA 3OTHA 3QHAA 2HBQA 1Q7TA 3KWMA 3D7RA 4OUKX 1N4AA 2XSZD 3LZDA 1RC0A 1G8FA 3ZWNA 1SC6A 3AB8A 2YUTA 3H99A 4HJRA 3AR2A 4NOLA 2IXTA 2VHWA 1FDSA 4LXUA 3ZZMA 2BFDA 1UC8A 3HJCA 3N8NA 4ENVA 5C1PA 4QICA 2WT8A 4I19A 2QD2A 3BRWA 2V5AA 1OAAA 2VK8A 3DNPA 4FFOA 1YKSA 2FWPA 4RIEA 2BFEA 4JJ7A 4O2BF 3PFCA 1A5AB 1G0NA 1JFFA 1PJQA 3GRVA 3QPAA 4ENUA 1M1YE 2Y1XA 3GARA 1HYHA 2LCQA 5IS2A 3E8MA 2H11A 1O97D 3ITNA 1J56A 2GFIA 1I6LA 1VG0B 1YZTA 1V7PC 3G1WA 3L7NA 4HB3A 3RGGA 2GR9A 3KQPA 3NIGB 2JDIA 1F3LA 4NONA 5FEMA 2UZ1B 3AEXA 4DRXB 5C18A 5DNCA 1OFGA 4P7BA 5IC4A 2XOXA 2ZYDA 1NXSA 4XI9A 1N2OA 1AKNA 2AOVA 3C4JA 1CWUA 2JF0A 4MUEA 2EBWA 1ZL0A 5F5NA 3ZX5A 1M6VB 1XMXA 3I9MA 1STOA 1DCFA 4XDHA 1NF8A 5JPDA 1NI4B 4A82A 1CUUA 1DU4A 2IZ0A 1Z8NA 2WIJA 4G09A 4Q6WA 4US1R 3RRNA 3TRFA 2D1QA 2ZU0C 3GD5A 4AD8A 3UHFA 4HYYA 4RZQA 3OIGA 4R3UC 3ESDA 2PCJA 1E9CA 2JGFA 2R1VB 2Z2IA 4KFTA 3MCVA 4MHOA 4CEIB 5K0EA 2PT5A 4RL4A 1U99A 3RWMB 3WP0A 1UJCA 5DCYA 2C5LA 2O3SA 8ATCA 3VH4A 2FQ1A 1IHPA 2X4DA 3JZFA 2QYTA 3JS5A 4TUYA 4KLAA 5J2UB 10MHA 1P9LA 3KZKA 3D3JA 3PVZA 2Z2ZA 2C2BA 4PAOA 2FSPA 3ZCUA 1OB5A 4UM8B 5A2QA 4G23A 2RONA 3QKIA 3OEWA 4BVJA 1QG4A 1KVRA 4HT3B 5U4XA 4AKIA 4B71A 1HEIA 3IPCA 6Q21A 2FP4A 5HMMA 5C53B 3R2JA 4UD6A 5THQA 3TLBA 1H8HD 1X70A 1SEPA 3DMFA 3VR4A 2IC5A 1DEOA 1QZTA 2FMTA 5C8XA 2OGTA 4CL3A 4TL9A 1DKMA 4J3JA 1VLLA 2PKRA 3GBPA 3AIOA 2IHNA 3OKFA 1W2WB 2HUNA 1PT7A 4TSRA 4WOKA 2X2OA 1XFDA 4HRYA 1YB6A 4G4GA 4HVAA 4IDAA 4DW8A 2E4UA 3OG9A 3RIGA 3BZUA 5BSFA 1PJSA 4KLRA 3K9HA 1AH2A 1U7DA 2XYPA 2EV9A 3MEQA 4IICA 4OAOA 1YS2X 4REMA 5KJFA 3FTFA 5JJIA 1TCUA 4BRUA 1KOFA 1GSHA 1XZBA 1KERA 2XUPA 4TUYB 1K06A 5EQFA 3VR3A 3PP8A 5E7QA 4B8YA 1O94A 1PKXA 3LT0A 4RHYA 3Q7QA 4BFVA 2G8NA 1XA4A 4KIFA 4Y6RA 3CKLA 1ZSNA 1OLXA 3GL9A 2Q2VA 3UN1A 4GX0A 2PL5A 4LNAA 4YAOA 4C1BA 1SVMA 5H3CA 1EHCA 2XBUA 3AJ9A 4UVDA 3ZNNA 2EXXA 1NJ8A 1FVHA 1XKLA 4QOJA 3HBAA 5H16A 3SEZA 4ILEA 4TUYF 3FPEA 4LF6B 1ZXLA 3MK31 3LSTA 3ZK9A 4OXQA 1O2DA 3TJZA 4YP6A 4R81A 1GOTA 1U2RA 4C89A 4ITVA 3ZE7A 1Y3CE 1QGUA 4K0KB 1BA3A 1AKRA 4JP5A 5IT5A 3OQ6A 3BXHA 4FFVA 3EGIA 3TTWA 3J7AC 1W2GA 4ZC8A 4HFMA 4OPMA 3KLBA 5BSVA 2QMQA 3PGLA 2EARA 3CR7A 2YXBA 4HYQA 1EMDA 1FBTA 4ROSA 5EYPA 2XDQB 1ZI6A 2HSZA 2UVPB 2OCLA 4NMXB 3ZCSA 5JNTA 4DV6B 2IGBA 3GLRA 1JQAA 2X9NA 5T6BA 5F35A 4KYTA 4LJSA 4GH5A 3K9FC 1DHRA 1V1JA 2ID4A 3TL6A 5CG1A 1V71A 3C7KA 1NFFA 3G2MA 4FKZA 4KDRA 3RNLA 1YZLA 2RI0A 3X1XA 1TJNA 4N0MA 4PPYA 1RYNA 5HF5A 4D92A 5JEDA 5EHGA 1F60A 1EWVA 2GA8A 3KALA 3LC2O 4JMPA 1NXTA 2RBKA 1T8PA 4PFJA 3CLTD 1KJWA 5I7OA 2NXJA 2AJDA 5KKNB 1RRGA 4GR9A 4D0SA 4G8DA 3S1AA 3ZDBA 2VDLB 1PS8A 2VPIA 3CNHA 3ZU4A 3QX3A 4U6SA 4IJUA 4KVAA 1GL9B 3T7RA 2QSJA 1RE1A 3WIBA 5LUAA 5E6SB 1AQJA 2UYQA 2CLCX 3P9CA 3S44A 4KSBA 2H9IA 3FGOA 4MUYA 2H1SA 3IPAA 4OKNA 4TLBA 3R76A 3RUFA 3SM3A 5HK9A 1T6YA 2C03A 1R8XA 4P4GA 4P9NA 3DE7X 3AY6A 2WTEA 7REQA 1Z6YA 3GLUA 1F8FA 1U02A 1XMPA 1YTLA 1Z5NA 1ZI8A 3G9XA 3KZNA 3R1IA 3IQGX 4G5RA 4IR7A 3AVYA 4F84A 2VQEB 2OQ2A 4EG1A 9MHTA 1PIWA 3LDUA 3BN3A 5BVHA 1XU7A 1JA0A 4XOIA 1HNZB 3MJCA 4XWOA 2CL7X 3BRCA 4ZU1X 1DXHA 1YT5A 2B6HA 4MP8A 3QXCA 4YPFA 1K7YA 5KVQA 3U39A 5IUKC 3VOBA 4F4IA 1M2JA 3C8ZA 1OZ0A 4Y6SA 3JYQA 4LRXA 3K7EA 4JU8A 4R1TA 2H1OA 3L0SA 1G59A 1K3UB 2OZEA 5BP7A 2J9GA 2I6GA 4UM9B 3ZH2A 1VRWA 1AQIA 4HPJB 3D1VA 3OEYA 1T3ZA 3U5ZB 1XAIA 3AR9A 3RAJA 4B17A 1VPDA 1LFDB 1MAAA 2XQFA 1VLVA 3BMCB 4KO8A 3UMBA 2IU6A 2H1WA 4EYOA 2PY6A 2ZULA 4M1MA 4ENTA 4IJ5A 2BFOA 2PUHA 3D2LA 4V3CA 4F5ZA 2G1JA 5CHEA 1NPDA 4ZPJA 3JD3A 5ALVA 1CYDA 2WJAA 4FDMA 1V9SA 1NPYA 3IBGA 4ND4A 5HDQA 2ZBQA 2BKAA 5BQ3A 2HO5A 4M46A 3I6QA 1A9XA 2W42A 4M8NE 2G4CA 4G9BA 4R1UA 2GMWA 4L4SA 3NBFA 3GVXA 3OX4A 2H4FA 3UH1A 1W5BA 2OA0A 4JJ4A 2DX7A 3HRKA 3T1TA 4FYKA 1RHKA 3TMKA 4F6CA 1E4EB 4RIIA 3ORRA 1IHDA 4ECAA 2SCUB 1M1UA 1SUAA 4PLPA 5JD3A 2ZE7A 5FOUA 3TQCA 1W7AA 4B9EA 1IOVA 3AUXA 4NJOA 3WHIA 4DWVA 3LHIA 5AI8A 1F8XA 2LCFA 4BFTA 2OQIA 4D9KA 3MT9A 1MOPA 3B1VA 1VYTA 1WLYA 1WF6A 3RVLA 2O8DB 2CLHB 1V5IA 3ISTA 1KVTA 2JKYA 1CUJA 2BKUA 2PRZA 4JLWA 2F8LA 4A8JC 2H59A 3A4TA 2RGXA 2UAGA 3BGOS 2RHRA 2V5UA 3ZZ1A 4R4JA 3CNLA 4AUNA 2XNKA 1EZZA 1T0UA 1U2PA 4R2KA 4CIWA 1V3TA 3EVFA 2AF4C 4QTXA 1MIOA 4A6PA 1FPQA 1AKMA 1UPUA 4XUCA 4AN4A 4ZGWA 2YR0A 1FDWA 3M6LA 4RL6A 3KAQA 1XROA 1G7CA 4WCFC 2PGAA 2I33A 3LFTA 1D1SA 1LDBA 2ZZKA 3L82B 3JQCA 3CLRC 3H4TA 4I8XA 2EYQA 2GAFA 2WVJA 4LNUA 5JDCC 2PE5A 1E0KA 2V5VA 4WMLA 2WFLA 3IP8A 4CM1A 2XB2A 1YL7A 4M9SA 4R69A 1QNLA 3PI7A 3FYHA 4P34A 3EEOA 2AMVA 2HL6A 3U9LA 4B80A 3OQNA 4O4JF 4RF5A 3KFLA 4KK4A 1KZ9A 1YOVA 2VZ9A 3QLUC 2P5YA 2B7LA 1F4VA 4EFNA 4UUMA 1LLFA 2VWPA 1FMFA 2BMDA 1IZ0A 2GO1A 2LWIA 5DYTA 1NYTA 2XMCA 2A0FA 1XK6A 5EI5A 2ZYUX 3N8GA 2VSNA 4WPGA 2M6LA 2IUUA 3FOEC 4C4TA 4EHAA 1NDHA 3HRHA 4Q3LA 3VZSA 3KKEA 1JIKA 4EO7A 1IEXA 1N5JA 3H11B 4E7OA 1H1DA 5ALYA 3WYFA 2P62A 1MA3A 5G02A 4BC0A 1TXGA 2X0KA 2WKWA 1YJ5A 3HCWA 4BNDB 3SLGA 1XEWY 3UHPA 4QA9A 4CKCA 2DE0X 1DTEA 3PGA1 2Q3FA 3GF4A 1KAGA 4OBXA 1DRJA 2KB0A 4AG6A 4II3A 1BDIA 4EAAA 2WM3A 5JAHA 2FFHA 1VIAA 1R6XA 2WHEA 4PY2A 3RBVA 3K96A 4UEWA 4QUAA 1L8QA 1QGYA 2V98A 4X9XA 3V6MA 2EX4A 1WHSB 1P5JA 3I92A 1UMCB 2WIKA 1ONPA 1XVUA 4FE3A 3SDZA 4BVGA 3OPQA 4H3KB 5IKOA 4WIAA 3Q3GE 3A14A 4L22A 5ENZA 4HAYA 2KWIA 1SUPA 4WEOA 2DEUA 1MRSA 3KOXA 1K6IA 2IYVA 3NWJA 4K5QA 2VDWA 5CBPA 2GH1A 3SVZA 2PG3A 2FTKE 1GTJ1 2ZTSA 2GEJA 4YAIA 3JQGB 1ADYA 1XPJA 4KYUA 2YQZA 4EB6B 3PITA 4Y2YA 1N8TA 2DPMA 2VS1A 3IP9A 4O4JA 5E8JA 4KR6A 2PUTA 1JHYA 3DAYA 2QAGB 1C41A 1VPWA 2QWXA 4LHWA 1E8MA 1R4MA 3NR2A 1E9RA 5B5SA 4BN0A 5HKKD 2QTHA 3BSFA 3KKMA 5JCXA 1AS0A 1P2FA 4HATA 1T1GA 4DARA 4F3TA 4Z0HO 4WADA 4NBRA 3KUDA 1IB6A 4JYMA 2B69A 3IB3A 3WYNA 4QGSA 1XNHA 4RD3A 5KOYA 4CIXA 3JATA 2ZB2A 1XXLA 3RS4A 2QSYA 2YJNA 3JRWA 3JU3A 4Q03A 3V4PB 1BWQA 1L4KA 1RKXA 1WL8A 2Z95A 3CZPA 1NW8A 2Y93A 2CVFA 1F2DA 4B40A 4XFDA 1A9PA 4IMRA 1G5FA 4G5YA 1UEXC 1YCHA 3MRXA 2ZS8A 1CQZA 4IW3B 2ZWVA 5CYFA 3IB6A 3TQIA 3ZWMA 1EIWA 4NU6A 1UMKA 2X6QA 3GHYA 4V0SA 2DB3A 2GXAA 4RVGA 1SG0A 1SXJE 2R96A 4LXXA 3G7UA 1AKWA 1Q57A 1II8B 1N8KA 1W36D 2Q3BA 1KNQA 1Z0ZA 1U2TA 1D03A 3MLAA 1NUPA 5FWXB 3CRNA 3UKJA 2PUAA 1CQXA 2NO5A 4I36A 3RVRA 1GITA 4BVLA 3FRHA 4ZCSA 3D1LA 3JVIA 3PC8A 1RBQA 1WCIB 5IVKA 2MT9A 4ZO8A 1EFAA 1DJLA 2WNIA 2XUGA 4XJTA 3ZU2A 2XKKA 3L6OO 3D02A 1VE7A 1Q17A 4FJ1A 3DLTA 3KTOA 5BSWA 4W6QA 4D4JA 3BXEA 2A1UB 3I61A 1FEZA 4BLSA 2X7XA 3DT6A 1TB4A 3C3EA 4CV0A 5T4BA 2P67A 4V0KA 1JILA 3K09A 3R44A 1TUGA 2DBVO 4EW3A 3M82A 5FWNA 2C8LA 3C43A 4E30A 1PRYA 5JXIA 4G5HA 5FBLB 3OCJA 1YVUA 3QF4B 4V3BA 1QOPB 3VH1A 4DADA 2G7MC 4NOMA 4D8VA 2BSQA 2W22A 2JGIA 2Q0QA 3IL2A 1XF9A 5DTIA 1JE0A 4IQ4A 2BMJA 3OX1A 1G8JA 5F12A 4A0GA 2RJNA 2ZYHA 5EIXA 1FDIA 3CNOA 4Y2QA 1AOXA 2O0MA 1D6MA 1E4YA 1ORTA 2VF7A 2YWRA 4G3XA 4D6YA 4OQ4A 1W4RA 3G13A 4IGIA 5BXQC 2ZRGA 1XLTA 2YJZA 1U9ZA 5SY9A 5I48A 1N6IA 2H4JA 3GRFA 4MB2A 3OPYA 1I2ZA 2IXBA 1HXHA 4FDVA 3C6YA 5PNTA 2BD0A 3H6KA 3RNOA 4IRXA 3VBCA 2G36A 4I5EA 4CMHA 2M6RA 3TOVA 3DKIA 5K0TA 1W0KD 1T5TA 2R68A 1O1YA 2DQKA 3ANYB 2JLVA 3AC0A 2XYQA 1C1YA 2HK7A 3TLGB 4CMAA 3Q8MA 2VRCA 5EP1A 3EFEA 4L8YA 1TCVA 2BEJA 1WY7A 4MV5A 1FVXA 2ODQA 2Q4OA 2RK4A 3C6ZA 1N8NA 4HQ6A 1VE1A 2CHQA 5HOQA 4H7JA 4MIKA 1OH7A 2BF4A 1M1NA 1HQYE 1WA5A 2GHIA 5BWOA 1XCGB 3ZTTA 3LQFA 5FIUA 4GDFA 4WOPA 4BO0A 5CBPB 1RQRA 3AF1A 3DQQA 4Y67A 2GYVA 1SGWA 3N75A 4LXHA 3WLMA 3W8NA 2BLLA 2F9MA 4S1OA 1ZNWA 5L3SA 2W58A 3Q8LA 1ZGCA 4DCPA 1W4AA 3ZQ6A 4B4DA 1O6BA 1GG8A 1P9OA 2X8JB 2JS7A 1WG8A 3EULA 4PBSA 2YQ4A 1KBZA 3P8ZA 5CT5A 3EQZA 2DBRA 4DG5A 4DR5B 1N1EA 2NTYC 3OOYA 1VHQA 3BHMA 1RM4A 1RAEA 1SNYA 5HQJA 3VZDA 4LTDA 3JD2A 3CR3C 3N07A 5BMVF 4LXIA 1RLUA 4D3YA 1E1MA 2Z56A 5CA1A 4ZT2A 1JDTA 5CAEA 5HR5A 3R6TA 2DP4E 2OOSA 1RFLA 3IBCA 2Q7DA 3HB4X 1YZ3A 3G2LA 3RT7A 1QGED 3PX3A 5AVRA 3FTPA 3FPCA 5EJAA 2RGEA 3RIXA 4BEBA 4ZIRA 5CVTA 1ZESA 4B3RB 1NGSA 3L1HA 1KC1A 5EPEA 4CL2A 1XD2B 5J1TB 4IM7A 3K6SA 1KEVA 1Q7RA 2MSLA 4D74A 1VMAA 1QVVA 1Z8HA 4J0QA 4L02A 3C2QA 3M1AA 4Q02A 5HIMA 1RYYA 4WZZA 2CHVA 3H9QA 1JKMA 3FBGA 5DHAA 1OAOC 3ROQA 4AB1A 2GXSA 4YAFA 3E7PA 1IBKB 3GLHB 5GM2A 2ZJ5A 5IUNC 1U8TA 2HF9A 2Y99A 1OAKA 4ZYYA 5LQCA 1G8YA 5E6RB 4UHJA 1F2TA 1KO4A 5T4HA 3SYKA 1NQVA 1XKTA 1XZLA 3D3WA 1K5HA 2ZDHA 4ZYVA 4QRIA 4COOA 3WB9A 4DLWA 1KEKA 4GL4A 5T4EA 4Z4FA 1OJLA 1GPUA 1YR8A 4EOGA 4QARA 4RF2A 4KP7A 4PSCA 3FDZB 1J39A 3SQXA 3H0EA 3OZSA 1Y5RA 2G0AA 4WNYA 1R5OA 3OT1A 3HU1A 3F5MA 2IFTA 1FFBA 4FEEA 3RTBA 3PR2B 1X19A 1E3JA 4QATA 1KYIA 3N2IA 2F17A 3VNUA 4X63A 1CKEA 1U9YA 1CDOA 1UFOA 1WIWA 1W35A 1L1EA 2YJGA 3Q7EA 3GFPA 4M1QA 5LQAA 5TX7A 3FNBA 1XG5A 2P79A 2YWJA 4TKUB 5SYAA 3COZA 3M4ZA 4JLVA 3ZWXA 4WZBA 3T0FA 1U0LA 4M9QA 1J24A 3I39X 2HPHA 1OPXA 2QMHA 3ANMA 1X1QA 2Y1KA 4P7KA 3WR5A 2O8DA 5A4AA 1H42A 2NO6A 3V1MA 3OSZA 1DELA 4TS9A 1E64A 4HMPA 4PXAA 4S04A 4ARZA 1B93A 3QZUA 3T7CA 3DXZA 4K28A 2F1KA 1RWNA 3A1TA 3CXRA 3FAKA 2ZTLA 3P71T 4O59O 1ND6A 4Z1MA 3KOUA 5LMNB 1PP4A 1GKLA 1U3DA 5J3JA 1MQ9A 1S3GA 5C52B 3AW9A 4YUVA 1L5SA 4Q3AA 3M8KA 5ICSA 3UF0A 3CINA 4EJFA 3L43A 4LHZA 3E7WA 5ALQA 1ZLXA 4CEHA 3ZI4A 4IWXA 4EMSA 2AN3A 3DEZA 4WN9B 4W5NA 3S8EA 2H3EA 3O2QB 1HE4A 1P91A 3KQOA 1ZN2A 3AESA 2Y0PA 4ZEVA 4Z4HA 1QG6A 3ZH9B 3GEBA 3I4CA 2Q2QA 1WAMA 2I2CA 4BFCA 2FW8A 2Y71A 1N9ZA 3FD8A 1U1EA 1USIA 1PEDA 3TIIA 2QD1A 4D5GA 1EK2A 4TTJA 2GDZA 1B0AA 2JI6A 3FUTA 4PN3A 2Q0HA 2C3YA 1J70A 4YBZA 4EGSA 4E5YA 2G4LA 1XRRA 4AICA 1RXUA 3NBZC 2CJWB 2GAJA 1PF7E 3QVLA 1P6XA 3HY4A 4AP5A 1Y6GA 1JHMA 2ZRDA 2H07A 2VQSA 2FOXA 1JLLB 2PKCA 4JJ8A 5HNKA 2JHGA 4YP1A 1E3MA 1I3NA 4YRRA 2ODAA 5DM0A 2VUHB 1Y48E 3H5AA 4QPNA 4EP1A 1XUOA 4RBNA 2ZB3A 3GGDA 4F1KA 4J4BA 1JFTA 3LCMA 4ZAVA 4ZZIA 1QLWA 1IMOA 1JAZA 3HWX1 1UDAA 1U3TA 5HRUA 3EGOA 4FUTA 1U3GA 1Y1TA 2I3GA 2G4VA 4YJGA 1ZL2A 5KVAA 3LU1A 1FTSA 4MAAA 2NSJA 3C6QA 3L1KA 5G0UA 4CPDA 3FSJX 4TKZA 4E6EA 2L19A 3IR5A 2BR3A 4DCGA 1D2RA 1G5HA 3R3XA 4TTAA 5C8YB 2B2XA 4AJEA 1B76A 4PYMA 1C9KA 1J8YF 2VTEA 4AZ0A 1KYXA 4KL8S 2CLLB 2IYUA 1S8NA 4Q4HA 2DWPA 4C30A 1V7CA 1V9CA 3SR4A 3ZE1B 4HP8A 4C4PA 3U4MA 1J5PA 1ZGBA 3LY9A 2PH7A 1R37A 4HYEA 2CNWA 3X1MA 5SZKB 1Q1QA 2PKQO 4OJKA 1E7WA 2FSIA 2PSDA 2ZP1A 4GSKA 5J40A 1KMNA 2O5EA 5CK4A 4EJSC 3T3IA 2NYVA 4NHEA 4Z51A 2F9LA 1X2BA 2XBLA 1EVZA 4S0ZA 4UHFA 1Z4JA 2E18A 1QOQB 2B78A 1KJNA 2Y1EA 2B30A 2P4HX 2R6HA 4N7MA 4P5DA 4PNZA 4B2IA 5AXAA 3CO0S 1X39A 3TNFA 3PZBA 4AZ3B 4YJGB 4N8SA 3RYHB 2DUMA 2FFJA 4A73A 1CJVC 3ZIDA 4UNIA 1CU1A 4L76A 2EIXA 2C42A 3EYAA 5AK4A 2IXEA 4RANA 5FP0A 3IEVA 3I37X 1PUIA 1U1DA 1BWRA 2VCEA 1C4XA 3LJKA 4J03A 4EJMA 2WM8A 3A6EA 3GLGE 1ULHA 2HZ7A 4GRDA 4WDRA 2RHJA 3HN2A 4F3RA 2XMRA 2DT8A 4MRAA 2L69A 1M1ZA 3THWA 4BO9A 2W6CX 5BMOA 1WKVA 1H1LA 1Z5VA 1ZK3A 5IAOA 1FP1D 1WDLA 3ILVA 2W0SA 4GBJA 2Y2UA 2EWMA 5A9SA 1UINA 3E22B 1FTWA 4ZFNA 1NFQA 1W2HA 5K6AC 2ATCA 1II9A 1CQJB 1LK0A 2WJGA 2DQYA 3GDOA 3KXPA 1QJCA 2NNWB 3VHLB 2IXGA 4UHEA 1LNZA 1UJNA 3UWMA 4CKWA 1NSFA 1U8XX 3SI7A 4Z4GA 3GVHA 2AMFA 3RFUA 1WXGA 2XUQA 2IH2A 2QMEA 2GLTA 2VC2B 3GUUA 4X84A 4Y9RA 3UK2A 4QPJC 4RJKA 3QMPA 4WBNB 4CETA 5B58C 1PK9A 3GDGA 3WSWA 3K4PA 1GRCA 1L3CA 3WXMA 1BE6A 4XSGA 3SC2B 3AIKA 4KQ9A 2IYYA 5BN4A 1CDEA 1H8HA 1QQ6A 3F4LA 2PJUA 5L51A 2AHRA 4ESEA 3MJVA 1YZUA 2GZAA 1PYOA 2P3LA 3V7YA 4G37A 2PQ0A 3V4VB 1D0IA 2A30A 2TRSB 3R3ZA 3OE1A 2Z3WA 2P0AA 1U7PA 1MB4A 1PR3A 1P1IA 1ZPDA 2ALJA 4KMOA 4LSZA 5DSXA 3SLRA 2M2IA 2WU0A 1EU1A 1Y1KE 2PIDA 3F9RA 1QHSA 3K8ZA 4BTVA 1AO0A 4XYEA 1TC1A 4I4NA 3C3DA 3KRTA 2V58A 3BL6A 3M1LA 3SFVA 1H9CA 3CX4A 3EFBA 4YP0A 1G6HA 4F9GA 1GGEA 2A0UA 3SX4A 1JFVA 3T5CA 4EPWA 3QLVA 5KVVA 1TVCA 4U9IS 3A9WA 4FBGA 4TQ9A 3CEJA 2Y0CA 3WV5A 4LZWA 4U8GA 1ISPA 1USKA 3AWIA 3EIQA 4KE9A 3UFXB 1T1RA 3FVRA 3GT0A 4QUBA 1HI9A 1UWVA 3VR2D 1JJBA 2XTZA 2OYRA 4FD3A 3FFBA 1NOKA 3Q3JB 2GKOA 1Y8RB 2HCTA 4GC9A 4D26A 2P4QA 2RBGA 3G8YA 2NSLA 4H4DA 2P9EA 5I3ZA 3U7FB 4X1YB 1XRPA 1XNGA 1X7XB 5BSHA 1DX9A 2ZIXA 1KMCA 3KFXA 1QRUA 3NUZA 5CD9A 1G1AA 3SSAA 2HQSA 1UC9A 2QXTA 4G2TA 1ODSA 3B7GA 1ZMRA 2J08A 2Q9UA 5IJ9B 3MQ2A 2AKYA 2WSSA 1A8SA 1QXSA 3C1AA