4EUHA

Crystal structure of clostridium acetobutulicum trans-2-enoyl-coa reductase apo form
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
399
structure length
397
Chain Sequence
HMIVKAKFVKGFIRDVHPYGCRREVLNQIDYCKKAIGFRGPKKVLIVGASSGFGLATRISVAFGGPEAHTIGVSYETGATDRRIGTAGWYNNIFFKEFAKKKGLVAKNFIEDAFSNETKDKVIKYIKDEFGKIDLFVYSLAAPRRKDTGNVYTSRIKTILGDFEGPTIDVERDEITLKKVSSASIEEIEETRKVMGGEDWQEWCEELLYEDCFSDKATTIAYSYIGSPRTYKIYREGTIGIAKKDLEDKAKLINEKLNRVIGGRAFVSVNKALVTKASAYIPTFPLYAAILYKVMKEKNIHENCIMQIERMFSEKIYSNEKIQFDDKGRLRMDDLELRKDVQDEVDRIWSNITPENFKELSDYKGYKKEFMNLNGFDLDGVDYSKDLDIELLRKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative reductase CA_C0462
publication title Structures of trans-2-enoyl-CoA reductases from Clostridium acetobutylicum and Treponema denticola: insights into the substrate specificity and the catalytic mechanism
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
total genus 140
structure length 397
sequence length 399
ec nomenclature ec 1.3.1.44: Trans-2-enoyl-CoA reductase (NAD(+)).
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4euhA00
2WE8A 3DTYA 4XB2A 3PRJA 2EEZA 4KTVE 2GRAA 1X15A 2AQIA 4HXYA 2DM6A 3VZQA 2EGGA 4RL6A 1MLDA 5FEUA 1V8BA 2J3JA 2AEJA 2W2KB 2YJZA 1QYDA 2ZB4A 2Y0CA 4BB6A 3OH8A 2XF8A 1I0ZA 1A72A 4BQPA 2Q4BA 2BFMA 4WK6A 2JCVA 5JAZA 3PZRA 4E2ZA 3KEQA 3QVXA 4CMIB 2XXJA 3QW2A 1R4MA 1Q0HA 5DP1A 3LC1O 3WLEA 1LRKA 3KV3O 2BFPA 1A4UA 1M6HA 2P9GA 5JYDA 1E7MA 1D1SA 2VYND 3ZWWA 2NLOA 4I9HA 3IL2A 4BO2A 1T2CA 4J1QA 1PIWA 1DDOA 3VAZA 4J49A 4B8ZA 3E9QA 2W4QA 1FMCA 4Q39A 2GR9A 1G0NA 3OQ1A 4TRJA 3SJ7A 4MJLA 1HE5A 4WNIA 5B37A 2CF5A 4XYEA 5GZ1A 1MP0A 4BKQA 5FI3A 4WCFA 3ORFA 3B70A 3H2SA 4QFCA 2OP1A 2CUKA 5GZ3A 1ADFA 2P9EA 1E7RA 1JKFA 5L4NA 3ICPA 3UCEA 5EJ2A 3BMOB 4BO7A 3T7EA 1EBUA 1C1XB 4YBZA 1P1FA 2BKAA 3GDGA 4JGBA 4W4TA 3ZU2A 4AG3A 3RUDA 1PR3A 4L4RA 3GEDA 3QVTA 1DFIA 2VYNA 4JX8A 4INAA 3JQDA 4CM6A 5LDHA 3BTUA 4IQ0A 1QR6A 3ROMA 3I4CA 4GLOA 3GRKA 4PG8A 1J6UA 4CMGA 1O0SA 3DC2A 2VHVA 3JQ8B 2J3KA 2IYPA 2VOJA 3E6AA 5HA5A 3KSUA 4J43A 2IRWA 1EE2A 2I3AA 2BGLA 3WIDA 4ZQHA 4RDHA 4FQ8A 5ITWA 4YJHA 5EN4A 1UXHA 1X7GA 4OYRA 4KZPA 1X13A 4BKRA 3HN7A 2ZCUA 2QYSA 1HXHA 4XR4A 1SB8A 5KKAA 5L51A 4FJ1A 1IPEA 1LNQA 1T1SA 5TF4A 2EKQA 4NK4A 1H6BA 2PZMA 1Q7GA 4BO8A 3WSVA 4DL9A 3GZNA 4LCJA 3VZPA 3HB5X 5H81A 1QYVA 3AW9A 1HYEA 3CUKA 3NTQA 3HJAA 5ITVA 2TMDA 1WLYA 3H5RA 3RWBA 4RF4A 4KQXA 5CDGA 1YQGA 3KLMX 3PHGA 2X5KO 4FPXA 1U2DA 4F6CA 1IHXA 4M8SA 5HWSA 3GH3A 3OEYA 2ET6A 4R1NA 4EJ0A 1Y9AA 5EQFA 3PTZA 3UCFA 1XA0A 1IB6A 5DBGA 1V35A 2VRBA 4LK3A 3D64A 3BTVA 1YVEI 3GVIA 1YL7A 1XR3A 2J5RA 2B37A 3AUSA 1FDTA 4XGIA 1PJLA 3S2FA 4YYZA 4YT2A 5TJHA 1ZXBA 5A5EA 2BF7A 3GN1A 3GFGA 1K89A 4UUNA 3BA1A 3PPIA 1K6IA 2Y05A 1OZAA 1OC2A 2IXAA 2I5PO 4J9UE 3WIEA 2HLPA 4TZKA 1EMDA 3ANNA 1LXCA 3KYDA 1E7YA 2OMEA 2FWMX 3Q9NA 4GX2A 4NZ9A 2VCYA 4KQWA 4OQYA 3HFSA 5FYDA 3PWSA 4ZD6A 3WGIA 2HU2A 4TROA 3KM0A 3WMXA 1TT5B 2AXQA 3RUHA 1P1IA 4XEHA 1NAIA 2B0JA 3QV1A 4J7CA 1ZH8A 3NUGA 1HDGO 2D0IA 4BNXA 1XIVA 4EUHA 1ZVMA 3AFNA 2JFFA 3VC7A 3H65A 3TJRA 4HV4A 1UDBA 1ADBA 3EY4A 4MVJM 2GN6A 1TA4A 4D3SA 5A05A 2P68A 2VRCD 4BO5A 3Q1LA 4PLZA 1EQ2A 5CEJA 1U5AA 4K1LA 1IUKA 1E3IA 4R54A 2DTEA 1NVMB 4RV9A 4O6VA 1D7OA 2X6TA 4LRSB 1EK5A 3I52A 3NJ8A 3TZQA 3UCXA 4WLVA 4BGVA 4RVUA 2D3TA 2C5AA 3D3EA 4MKXA 2V6BA 5EL0A 2VTDA 4MVJF 1EVIA 2NVBA 3RU7A 3HDJA 2C59A 2GN9A 3MJTA 4BNYA 2C5EA 3KSDO 1ISMA 4EGFA 4DC1A 4B4UA 3LF1A 1I30A 1R0SA 5F5NA 2I99A 4IDEA 1NQTA 1M67A 1ONNA 1E6UA 3GOHA 4AJOA 3E1KA 5COQA 3F5QA 3PZBA 2PZLA 3UF0A 3OA0A 1TXGA 2E49A 3KYCA 1WW8A 1YGYA 3E9NA 1ADCA 4MP8A 4NIMA 1H9AA 1PR9A 2X5OA 1FDUA 4E5KA 1QXSA 2QIOA 2HJSA 2BLLA 2YY7A 3QIVA 3VHRA 1AUPA 3LC2O 4FCCA 3U62A 4N5LA 5HRUA 4ALJA 3AI2A 4DLAA 2HMUA 1HDXA 3LVFO 3JD3A 4RF2A 3X2EA 4CM3A 4UVEA 4MOWA 4DIBA 1EE9A 5CFZA 4X54A 3EMKA 3IP3A 3WTBA 4YT4A 2C2XA 1WZIA 1PZHA 3HUDA 2DBQA 3PGJA 2OHXA 3F4LA 3KHUA 5U4QA 3TPCA 2R6JA 1DC3A 5JMWA 2JFGA 3QVOA 4MVJA 2JAPA 4G81A 1U9JA 3ENNA 5BNIA 3CTMA 3DBHB 4K26A 4EI2A 3IIEA 4BNJA 5KJCA 4BGEA 3CZMA 5BSEA 3GA0A 3D5TA 3DTTA 5HS4A 1B8PA 3OEWA 2NV6A 2LDXA 2OP0A 4Z3DA 4OQZA 1E3JA 1KETA 4A2CA 4D42A 2Q50A 4DYDA 1ISJA 1VJ1A 1N7GA 4R16A 1RJWA 1Y8QB 2C07A 3IKTA 4Y6RA 2GZ1A 3VPSA 1KYQA 4MKRA 4HKTA 4E31A 2DUWA 4I8XA 2GDZA 1YDWA 2NU7A 3H9GA 2FZWA 2DQ4A 4FFRA 4E2XA 4RZIA 4YACA 1IYZA 1DIRA 1U4SA 2A35A 4GBJA 5I7SA 1B8VA 1LSJA 3DAPA 3UUWA 3VH1A 1NVTA 4HBGA 1UAYA 1PU2A 3NDJA 1NHGA 2Q1UA 1PZEA 3QWHA 4A27A 3M6IA 5JO9A 3OJEA 3LZ6A 4BNZA 3DZKA 3ZH2A 3G3EA 2X1HA 3OSUA 3OBBA 1MC4A 5ILGA 3CPSA 5G4KA 3SLKA 4ZRMA 2X8LA 1VRWA 1SOWA 3BZUA 3JYQA 3RJ9A 4NQZA 3AWDA 4D3DA 4CM9D 5F1OA 1H9BA 4S3MA 2PZKA 1F17A 4CMJA 4FS3A 3ZV4A 1Q7BA 4CL8A 1HF3A 3CMMA 5MDHA 4W7HA 2X7HA 3DBRB 4OO3A 1QYXA 4RQTA 1ZSYA 5IAAA 4XA8A 3K30A 4XYLA 4EJMA 2CZCA 5A02A 3I9MA 3BMQB 3CMCO 4CR8A 3PWZA 4CR6A 4O63O 4PG6A 3CE6A 3JQ9C 3H8VA 4NJOA 1KERA 1U28A 3ETEA 2FPGA 4HWKA 2VHXA 1Y7TA 5F21A 5CEEA 3GVXA 2YW9A 1GL3A 1Z45A 2Y67A 5I8ZA 1PGJA 4CMKA 4CQMB 3DEYX 1L7DA 2ZB8A 2Y68A 1X1TA 3H9JA 2GO1A 3PYMA 3GVHA 2WMDA 3H9QA 1S7CA 4XRRA 3S2EA 2V65A 4E30A 1DHTA 3COSA 1MFPA 3HE3A 4NMHA 2V6GA 4ND5A 2IZZA 1H2HA 4WCFB 4IDDA 5L40A 5CDUA 3ST7A 1SB9A 3DFUA 4UUPA 4KUEA 4BNKA 1DSSG 3B6ZA 3WNQA 4WOJA 1AHIA 1N7HA 2WDZA 1Q7CA 4GAEA 4Q3NA 3ETDA 3I4FA 3OIDA 5BNTA 1L7EA 1R37A 4B7CA 3ZNOA 3WWZA 1SEVA 2VUUA 5CDSA 1CIVA 4CQMA 3TF5A 2YDYA 4TQGA 2XXBA 1UJMA 1AXGA 2WD7A 3I1JA 4B79A 1VPDA 4JBHA 2FR1A 1VKNA 2X4GA 5L4SA 3D4NA 5K6AC 1ML3A 3E5RA 1B16A 3DR3A 4E6PA 3MTJA 2BI7A 2JCXA 1RWBA 2FSVA 3ZWCA 4DTIA 1O5IA 1UXJA 3DBRA 3MEQA 3ZN2A 4CMIA 4FFOA 4BNHA 2RBEA 3H3FA 1P33A 1SO8A 4N54A 2EXXA 2H1SA 2IXBA 3ITKA 4IDCA 1C1XA 4CQMD 4GSLA 1JDJA 2H6EA 3GAZA 1F8FA 4J16A 1DRUA 1Y8RB 2DPHA 3A9WA 1I33A 3AUAA 4BMSA 2JHGA 2RH8A 3INGA 4FB5A 4PFJA 4AFNA 1OFGA 3JD2A 5IG2A 3BAZA 4PG5A 2EF1A 2D5CA 3NT2A 4ZICA 3DWFA 5KKCA 1Z7EA 4RVFA 4YAGA 3WGHA 5L45A 5CDYA 1IOLA 1A71A 3V5NA 3IDSA 5JXWA 3GUYA 4BUCA 1PGOA 1P0FA 4LMPA 4AJJA 2X58A 3OFSA 2Q2WA 5IDQA 1YQXA 5AXAA 2HSDA 2ZCVA 1JN0A 4KWHA 2JHFA 1X0VA 4JK3A 1T1RA 4DYVA 1P45A 3X2FA 1PJ2A 5F1PA 1NYTA 4PZDA 3RC9A 4J4BA 3T4EA 1LLCA 1P1JA 1LJ8A 3UKOA 4II3A 2PFGA 2W2KA 3DXFA 4ND1A 3ZNPA 3FBTA 3KOUA 7MDHA 4CM4B 1E0DA 1RPNA 2EJWA 1U1IA 3OECA 2YV1A 1DC5A 1VE9A 4IM7A 3R3SA 2QRKA 4OKNA 1E3WA 3ULKA 1I3KA 3RUAA 1WPQA 3GDOA 4M89A 3O26A 2O3SA 4R41A 2VWQA 1R15A 4OSPA 1JU9A 4QO7A 4DC0A 4OKIA 1AXEA 4UEOA 4N18A 1T2EA 5JLAA 5A5FA 4TVBA 2JJYA 1KEWA 4IQ8A 1MV8A 1CEQA 1F06A 2GCGA 3LLSA 4BO9A 4JJGA 1XELA 1SZJG 4DLBA 4CLHA 2E37A 4Y6PA 3C7AA 3IKVA 4IMRA 4QECA 3RBVA 3V1TC 4WJZA 1MB4A 3TZCA 4IZIA 4YT8A 5IXYA 3C8MA 2HMTA 1O6ZA 3ZWPA 1I3LA 3OJ0A 3ON5A 1M6WA 4C7KA 2IEDA 2E4AA 4DGSA 3DO5A 2FRDA 3TOZA 1PJCA 1YKFA 3TL3A 2HJRA 4DWVA 3U09A 1JWBB 3TRIA 1ULSA 2NSDA 4OHUA 3K31A 4YJGA 2EV9A 4J90A 3ZV5A 1IPFA 3DBLB 3Q3CA 3ZWVA 2UYYA 4YRDA 1VSUA 3I83A 1CERA 1ZK2A 2NQ8A 3AK4A 3STHA 4GMGA 2GGSA 2W90A 1E1MA 3ZDFA 1KEUA 2JAHA 1B0AA 4EUEA 3H7AA 2X0JA 4XX0A 1P31A 4DQXA 1D1TA 4W6ZA 4PLFA 3IS3A 5I9NA 1X7DA 2G0TA 4Y67A 1KS9A 3ZHYA 2NM0A 2Z1NA 4WCFC 3HB4X 4WLOA 4BV8A 1YRLA 4J7UA 4EUFA 4RVGA 3A14A 5BSHA 4WLUA 1NPYA 4AJIA 5CG1A 1GFSA 4E5NA 3GAFA 1U7HA 2GSDA 3QJ5A 5TRTA 2YQ4A 1N2SA 3INRA 4MVJE 1GEGA 3L9XA 5COAA 2CF6A 3DFZA 4N7RA 4ND2A 1ZUD1 4DA9A 3IC5A 2VT2A 1Q0LA 3OA2A 1GTMA 1OAAA 2AE2A 4PZCA 1BRMA 2TMGA 4FGSA 3O4RA 4J4HA 2VZ0A 4LSMA 2ZB7A 1F14A 4YTEA 4B4WA 1AE1A 3QY9A 4NPCA 2Y93A 3D4PA 2IZ0A 3FR7A 4ZHSA 2D59A 1XU7A 2B83A 2VN8A 3FTPA 5JAIA 3GK3A 1XQ6A 1GQYA 1DIHA 3ZCXA 3L07A 1FDSA 5ER6A 1ID1A 2VT3A 5JC8A 2BFOA 4NHEA 4WE3A 3JQAD 3AI1A 3VPFA 1NQOA 1I5RA 4UULA 3SXPA 1UZMA 1ZJZA 1ZSVA 3ZW8A 4B3HA 5ES3A 3DBVO 3IJRA 1R6DA 3PWKA 4PCVA 5I7EA 4F46A 1L1FA 1LU9A 5G4KB 1NR1A 3JQCA 5I7FA 3PLRA 1V6AA 3EGOA 1UZLA 3QSGA 4NBWA 3BIOA 2BMAA 3P2OA 1O95A 3S8MA 1W4ZA 1XEAA 4FFLA 4EZBA 3OMLA 4RDIA 2B5WA 3WR5A 4E32A 2WYWA 4P4GA 2P91A 2P5YA 3I5MA 5JDCC 4ROSA 3ZWMA 2GPTA 4G5HA 4R1UA 1LTHR 2AQ8A 4IS2A 1FF9A 4MIEA 1PQPA 2PLAA 4IDGA 4DPLA 2CDAA 3WJAA 3U9LA 3S55A 5JPIA 4QXMA 4BHTA 3JQEA 4CMEC 1UH5A 1NP3A 2W2LD 5IF3A 1GZ6A 1NPTO 1PL6A 3JQ8A 3DOJA 4B3JA 5L95A 4YRBA 5IDYA 3C3XA 4FGWA 1WZEA 3UW3A 4CMHA 3PFFA 2PKRA 1KOLA 3LK7A 3WDSA 4CV1A 5I7VA 4BO0A 4PLWA 2WEKA 3GNTA 2WYVA 4YJGB 1DLIA 4ZQBA 4CM1A 4Z9YA 3W6ZA 4UEJA 3V2UA 4WOKA 4BL5A 4JJIA 4EJ6A 1LSSA 3SLGA 2NWQA 1ZMOA 3ZU4A 2YHUA 4AJEA 4WEQA 2EWMA 3EYWA 1DJQA 2VQ3A 1I3NA 3H5AA 1B15A 3OQBA 3HDQA 3Q9UA 3DMTA 3VH4A 1MX3A 1O94A 1P9LA 5JSFA 4YJDA 2PTGA 1HLDA 1GU7A 1E7SA 2HK9A 3MJEA 4U5QA 3T7CA 3R0IA 1PJ3A 4D79A 4FR5A 4W9NA 1NAHA 2QG4A 4XZ3A 3H9UA 1ZEJA 4TKMA 3WG9A 3W6UA 1E1NA 4TSKA 2X0NA 4GX0A 1PJ4A 4NFHA 3SJUA 2BGKA 3GGOA 2VZ9A 1K3TA 1GZ3A 2AQHA 2ZATA 3RUCA 1A7KA 5A3JA 2EKLA 3JCZA 1BW9A 2Y0EA 3BMOA 2Q99A 3RC7A 2JL1A 3FNEA 1P0CA 1PS8A 2OFPA 2J5QA 2YDXA 1C0LA 2FR0A 4E2WA 4GGPA 1HDYA 3JQGA 3ADOA 3TSCA 2AW5A 1VJTA 2ZK7A 1R16A 3RCBA 4DMLA 3T4XA 1V3TA 3OJFA 5I8WA 4HFRA 4BKOA 4KUGA 1XHLA 3BXXA 3PHHA 1C1DA 4YEDA 5KVCA 4XR9A 2WD8A 4CUJA 3I9KA 4H16A 2PD6A 1QP8A 3WBFA 2DKNA 5KCZA 4FSHA 2NU6A 4DXHA 4BNFA 3LT4A 4E2YA 4QX6A 1M66A 2NU8A 2VTEA 4MINA 5DBFA 3AFMA 4LVUA 1U3VA 2FZEA 2RAFA 1F12A 1VSVA 2JD2A 4P38A 4CM9A 4KTTE 3W8DA 4DVJA 4PLTA 1YDEA 2Y1EA 4ALIA 1P74A 4CMCA 2WTBA 3KVOA 1JAYA 5JY1A 1HSOA 2PH3A 1U8FO 1XYGA 3FRJA 3KLPX 1JQBA 4ALMA 2IODA 1MG5A 2PY6A 4Y9DA 3DHEA 1R66A 3DZGA 3ETGA 1GQ2A 2D1YA 2H63A 3UN1A 3VPXA 2B5VA 3FR8A 1UUFA 1HL3A 2NQTA 5L7YA 4AICA 4R5MA 4UUMA 3K8ZA 1ENZA 1LDYA 3VKUA 1J49A 1BW9B 2W2LA 3EW7A 4GLLA 2C54A 3NKLA 3NJ4A 4JCOA 4W99A 2PV7A 4KUHA 5TX7A 3CEAA 3GG2A 1LC3A 1GDHA 1LBEA 3WWYA 4JJFA 4Y8VA 5C5IA 1JKIA 1YOVA 1FDVA 1YL5A 3WQSB 1BMDA 1XSEA 4R68A 2ZTMA 3IQDB 3ZNQA 1HDOA 2EP7A 4HP8A 2VUSA 3B1JA 3H3JA 3PI7A 3U49A 4UUOA 3VZRA 4BIIA 2E82A 3I9OA 1EBFA 1DIAA 1HE3A 1EQUA 2WJPA 1PWZA 3WFJA 3Q11A 3WICA 4Y6SA 3Q2IA 1JA9A 2IDZA 2GYYA 3D5QA 2XAAA 5BNFA 1FJHA 1FXSA 4CLRB 1QSGA 2QRLA 1DJNA 1ZSNA 4ZQFA 3IOYA 4YB8A 1GADO 2HUNA 1VL0A 1B3RA 4YR9A 2RIRA 4JXKA 4R4JA 3WYBA 1PWXA 4CM4A 4F3YA 3ZHZA 4IIUA 4AJ1A 5IZCC 3TOXA 4BKUA 1JKJA 1IE3A 1D4FA 5FF9A 1P1RA 1PQWA 4AJNA 5T57A 4GSKA 1QORA 3WGQA 3LF2A 4RVDA 5AXBA 1PX0A 3QHAA 3RAJA 2UVDA 3GNQA 3PFWO 3VDQA 1A27A 2AE1A 1RM3A 8LDHA 3PVZA 3DZFA 4R3NA 1FK8A 3EVTA 1LSOA 3PJEA 1ONOA 5EQDA 4J6FA 5L4LA 2DTXA 1SMKA 3R1IA 4TKLA 3WYCA 1YXMA 5HM8A 4M87A 4OL9A 3VOSA 3RI3A 5DNAA 2Y1FA 1GAEO 2HDHA 5FWNA 4BMNA 1DRWA 1YOVB 4RQUA 5GY7A 4IY1A 1CRWG 1ADGA 5T64A 1Z73A 3W4KA 4E5MA 1J0XO 3JQFA 3TQHA 2Y1GA 4FD3A 3WGTA 3SC6A 2VUTA 2DAPA 3KYCB 4Z3KA 5ICSA 1NPDA 3VDRA 3IUPA 3WQQA 2WSBA 3JQBC 4J0FA 3PYLA 3K2EA 4MVJD 1M2WA 5JCJA 3JQ7B 4CM7A 2FY8A 4M55A 1BVRA 3OICA 4YT5A 1FDWA 1HZZA 3LLVA 1IZ9A 3C1TA 1P44A 1WDKA 4JP3A 2Y1OA 4MVJP 4QQRA 3S2GA 1G1AA 1Q0QA 1QMGA 2CNBA 3BMCB 5LDGA 3W4JA 3N58A 5T8KC 1N92A 1G0OA 2J3HA 3W8FA 2EP5A 1EEHA 4KWIA 2CDBA 5CEFA 3NT4A 1EK6A 1TI7A 4Z6KA 5I9LA 2X5JO 3LDHA 4ND3A 2NVWA 4XCVA 1DIBA 2I76A 4J3FA 5JCJD 4H7PA 1VM6A 4D45A 2Y66A 5LC1A 2FR8A 3GMSA 1T25A 4IDBA 3H4VA 1ZK3A 3HWRA 1PSDA 5DCYA 2X23A 3ANLA 1WAMA 4ZRNA 1BDBA 4ILKA 1NVGA 5IFLA 1O9BA 3C85A 4J0EA 1ZZEA 3FNFA 3K73O 3RROA 1PJSA 3ADPA 3RFTA 1M75A 1DFHA 3NTRA 2FP4A 2Y99A 1GYQA 4P4NA 3F6YA 1KVTA 4NG5A 1BXGA 2VHWA 2ILTA 1T26A 3KYBA 3RSHA 1QLHA 4L75A 4MIYA 4IJKA 3FBGA 3RC1A 1AN9A 3UH1A 4UVIA 4D44A 4U6QA 3DAGA 5CP8A 3L6OO 2C7GA 3MZ0A 4U7WA 1R4NA 3QWBA 2Q46A 3RUIA 3PQDA 4K28A 3L4BC 1YQDA 2X0RA 3DZJA 5B1YA 4I5DA 4RZHA 4E21A 2E6UX 5G0SA 1MC5A 1EVZA 2FPIA 3O03A 5TGDA 1YB1A 1QYCA 1CETA 4LN1A 2HO5A 1LDEA 1NFQA 3ONFA 3MJVA 3N7UA 2Q45A 4I5EA 1KVQA 3GZ4A 5KOIA 5K0ZA 1ZJYA 1SNYA 3NTOA 3ICCA 4RORA 5IDWA 1U3WA 4C7JA 1K5HA 2ZKLA 1PZGA 1LDNA 5COBA 1OBFO 2O7SA 1GZ4A 3V1UA 1YB5A 1PGNA 3BHJA 2G1UA 2B36A 3U4HA 4PZEA 4RF5A 1TT7A 5G0VA 4UEKA 4ZU3A 2GZ3A 3V1YA 1BG6A 3PHLA 4IDAA 4ALLA 5KTKA 3GPIA 4Y98A 1DXYA 2I6TA 4PGFA 3DMTC 3OIGA 3RFVA 3A4VA 3HSKA 4MP3A 4Z0PA 1KY5A 4OOFA 1PJQA 1K6XA 3L77A 4PIVA 3FI9A 5JS6A 5KJ1A 3O8QB 1F8GA 1UXKA 4PRLA 4J7XA 3AM5A 1N1EA 4MIOA 4D41A 2QZ9A 4GX5A 1QYWA 4YCAA 4D7AA 3P7MA 1E5QA 1BWSA 1Y1PA 1ZIDA 5KWEA 2ZTLA 3KUXA 1BXKA 3JYOA 5HTOA 1RYEA 3ZU5A 2J5KA 2O2SA 4DRYA 2ZYGA 1F0YA 2AG8A 3RASA 2NU9A 4NBVA 5DF1A 1E6WA 2F1KA 2Z1MA 4O5OA 1WWKA 1A7AA 3FSRA 3GDFA 3KEOA 4IUYA 4MVJG 3TNLA 3JQAA 3ZV6A 3HDYA 2JCYA 4A7PA 5GZ6A 2GF2A 4U0KA 1MXHA 1GCUA 1I2CA 3GRPA 2HRZA 4CV0A 2GLXA 4FIZA 1QV6A 2YQ5A 2QRJA 3JQAB 3OF2A 3SC4A 5G0TA 3L4BA 3HG7A 1ZK4A 1E5LA 2R2GA 5KVVA 1VLLA 1SC6A 2O3TA 4D3FA 4IJUA 3DOOA 3C7CB 1C3VA 1EDZA 3F46A 3GGPA 4CV2A 1YS4A 3ANMA 4EEZA 3LU1A 4J1TA 4JLWA 2BGMA 2CY0A 4NK5A 4EEXA 4BNIA 1I8TA 3I9JA 1E92A 5L3ZA 1B3BA 3W8EA 5T8KA 3PIDA 1MA0A 4R9RA 2O2YA 3GHHA 4FC6A 2O23A 1W8DA 3JD1A 5KVSA 5A9RA 5GMOA 1IULA 4XYGA 1U7TA 4IXWA 3L6DA 3UGKA 3ZZNA 4GVLA 1LDMA 1TLTA 3ASVA 4M1QA 1C1DB 3TL2A 1Q2XA 4U8GA 1PS9A 1SOVA 4MVJI 1PGQA 4DLLA 4NDNE 3HZZA 4UVHA 2FMUA 4L8VA 4OMUA 4EW6A 5AXCA 4E13A 2I3GA 2UUPA 3RD5A 4D0RA 2VHYA 1NWCA 1K2WA 3D0OA 1IL0A 5TJ9A 4BKPA 3L6EA 2UAGA 4JNKA 1LLDA 3GVCA 3NDRA 2YHIA 2BD0A 4PVCA 3AOEC 4QEDA 2Q4EA 3BMNB 3EDMA 4GWGA 4XYMA 2VNAA 1E3WB 1BHSA 2WYUA 5B12A 3WS7A 1GCOA 2XPCA 2DTDA 3K2BA 1QV7A 1UDCA 4QSMA 2J6IA 1G6KA 1R0LA 1XGKA 2D5AA 1Z6ZA 3JQGB 4LW8A 1NR7A 3GLQA 1B14A 2WWRA 5JE8A 1KC1A 1HRDA 1I10A 1NX6A 3FD8A 1C14A 1I24A 3OETA 2J8ZA 3VPGA 4DIOA 4YRAA 4WGGA 2PNFA 4J4TA 1YBVA 4ZQEA 4WLEA 3VH3A 1C0IA 4XDZA 1XU9A 5C3MA 5A1TA 4WLNA 3AU8A 1H0KA 1O8CA 1UAGA 3OM9A 4FOSA 4WKGA 4ALNA 2NVUB 2VNSA 1P1KA 3V2GA 1HWYA 3PHIA 4K9DA 3M2TA 4PG7A 5KJ6A 4GQAA 2D2IA 4Z0HO 1ARZA 4CM8A 5KIAA 4CLRA 1PGPA 2YFQA 2PR2A 1XLTA 3NAQA 2JD1A 1T2DA 2GNAA 1B8UA 1LLQA 3G17A 4E5YA 2GZ2A 3KSZO 1JAXA 4A26A 3KETA 3G1TA 4RLSA 3ZWAA 2EJVA 4FFPA 1E7WA 1Z7BA 1PTJA 2YYYA 4Q3BA 4WCDA 2OBYA 1EVYA 5IN5A 5C37A 2WM3A 1UDAA 4YAEA 4RPHA 9LDBA 1I01A 4LMRA 3JQ9A 1YWGO 2HQ1A 2D8AA 3LQFA 3PJDA 5L53A 3WJ7A 5A9SA 1SBYA 3D4OA 1I2ZA 4CLDA 3NDIA 1DBVO 3BHMA 4GWKA 4I5GA 3QQPA 5EPOA 5DCUA 4A5OA 1SAYA 4NR0A 1E1LA 3AJRA 3D3WB 4CLOB 4E0BA 3QVWA 4TWRA 1R4NB 4TVOA 2V6MA 3FNHA 1EVJA 4I08A 3JD4A 2NTJA 3AM3A 1U2GA 3EHEA 4YJFB 4BO6A 3MWDB 4KDEA 3HQ4O 2AEFA 4G65A 5DDIP 2BHLA 2OL4A 4YQZA 1LSUA 3TWOA 3FNGA 1IZ0A 1X1EA 2GN4A 2PA3A 3NT5A 4IINA 4NJMA 4WEOA 5H82A 3OJLA 2C20A 5DT9A 5G4LA 1Z82A 3BTSA 3WYEA 2SCUA 2OOSA 2R00A 5K9ZA 2VZ8A 1VL6A 1B26A 4FOOA 1JVBA 1AGNA 4YVFA 2G82A 2PGLA 4BNMA 3OJOA 5U9CA 3PYXA 1GD1O 1GY8A 4DPMA 1YB4A 2CFCA 1GYRA 2B4QA 4Z0TA 2PGDA 4DBVO 4CJXA 2YV3A 2AMFA 3QWIA 3WB9A 4BNWA 4XWYA 4NBUA 1E3LA 1E3SA 4LVCA 3KRTA 1HDCA 3DZIA 4XIYA 5JC1A 4PLGA 3FWZA 4UVGA 4BOYA 3BMQA 2HK7A 2VOEA 1PL7A 1ZCJA 3GMDA 2B4RO 3KB6A 4B7XA 3C1AA 3F4BA 4IS3A 7ADHA 2HKIA 3WGGA 4FDAA 4NH4A 4XJSA 5J23A 2Q2QA 3CKYA 4FFMA 3INTA 3AUTA 2EW8A 4M49A 1GYPA 3U5TA 4R51A 2X0IA 2O4UX 2V6FA 3AOGA 3ENKA 1BSVA 1GUYA 4K6CA 4LGVA 4PLHA 2HRBA 2ZB3A 3Q2KA 5T67A 3GZNB 3KXDA 2Q1SA 4IIVA 3WSWA 2B69A 4CUZA 3RBZA 3GQVA 1NBOA 1PL8A 1SCUA 3LSYA 4EYEA 1LQUA 2H9IA 2OZPA 4WUVA 4BGUA 4L4SA 5IJZA 4CPDA 1ISGA 3GR6A 3MTGA 3LC7O 4NBTA 5JDCA 1GQQA 4I5FA 3FPLA 1CYDA 1EUCA 4II2A 3JYPA 4F45A 1ZO8A 3D1LA 1EFKA 1UR5A 1W0CA 1WXDA 3E03A 1LA2A 2HAEA 5BQFA 2XOXA 3PHJA 4FJ0A 1KVUA 2OO5A 4MPDA 4MVJH 5JCXA 2BELA 4CL3A 1BXZA 3P2YA 2JFHA 3O8QA 5IZ4A 4D43A 4YAIA 2DVMA 1NASA 4NI5A 1NWHA 3I6IA 2ZTVA 1JVSA 3WGYA 3K5PA 4XD2A 1XDWA 1N9GA 4Q3DA 5DULA 4XKJA 3OIFA 3D3WA 3L9WA 3SVTA 1GPDG 4LSWA 1U3UA 4GGOA 4EITA 3S1LA 5A03A 1ISIA 1DOHA 3U4CA 3O38A 2YZ7A 4IGEA 4ZN6A 1T4DA 3NYWA 3VPHA 4DUPA 1NHWA 1T24A 2O3QA 1D3AA 5JY6A 5BT9A 3JSAA 3ZNNA 3EUWA 1PJBA 1R0KA 4ZQGA 3UOGA 2A4KA 1WMAA 2CDCA 3DAFA 3TZ6A 2EKPA 3UICA 5ILOA 4UVDA 4D46A 3EC7A 3JYLA 4HNHA 4AJHA 4PLYA 1EZ4A 1JW9B 4N5NA 4Q3AA 3QWFA 5EERA 4J2HA 3VVBA 2O48X 4QFDA 4XDYA 4DPKA 5A06A 2ZTUA 1ISFA 2DPGA 3EZLA 4AJ2A 2PD4A 2DFDA 1NFFA 2DLDA 5AOVA 5TSDA 4FFNA 1J5PA 3QWAA 4BGIA 1H6AA 4NU5A 1PEDA 3HHPA 3LT2A 3TFOA 1QRRA 2FPPA 4BNUA 1OOEA 1VKOA 2YV2A 1E3EA 3AI3A 1ZK0A 2I66A 1RKXA 4CLEA 2ZJ0A 4HX5A 4M54A 4NU6A 1ZBQA 1GUZA 4XJTA 3DONA 3DBHA 3KZVA 5TC4A 2HK8A 1YJQA 4J1SA 5DN9A 5F5LA 3AUUA 4E4YA 4CM5A 3WTCA 3RQSA 1DPGA 1H6DA 1D8AA 1Y8RA 3FWNA 1GV1A 3PQFA 1K0UA 2WD7B 1X7HA 1RM0A 1MG0A 4JBGA 1CF2O 3AY7A 3PJFA 2ZYAA 2Q3EA 4AJ4A 4IQGA 1U8XX 2O7QA 3UFXA 4BQRA 3M1AA 5B4VA 4HADA 3VH2A 3KYDB 4BVAA 3GF4A 3MOIA 4JP2A 4BMVA 4XIJA 4J1NA 5C7OO 1HT0A 1M76A 2IE0A 3BTOA 3DL2A 3PLNA 4YQYA 5ER9A 4WECA 2WE7A 3ROPA 3RUFA 2A94A 3CIFA 1E77A 1Y9EA 1N5DA 4IZHA 2GERA 4WPGA 3GFBA 3HDHA 3G49A 3PDJA 4NJMB 3I9NA 2POQX 4L9RA 2UV8A 4I1IA 3G1UA 1GUFA 4B8WA 5CDTA 3DDNA 4ID9A 2ZIZA 2VWGA 4Z9FA 2P5UA 1KEPA 4GKBA 3M1LA 5TNXA 1OI7A 5HBRA 5A9SB 3WNVA 5KJEA 3RVDA 1RM4A 8ADHA 4PLPA 4BO4A 4N5MA 3WGOA 3WMWA 1H93A 2J3IA 1ULUA 3SX2A 1ENOA 2X9NA 1YH3A 3E5MA 5B4TA 3F47A 2PKQP 4JROA 3C1OA 1H94A 3FHLA 3MWEB 1T4BA 2QYTA 5CPFA 4XGNA 2OORA 5EESA 3HNPA 1EUZA 4RPKA 3E8XA 2Y1CA 1HEUA 4JQCA 3H6KA 4R5HA 4ESOA 4OAQA 4R69A 4RPGA 3NX4A 4E33A 4FBGA 1GPJA 1Y5MA 2B4TO 2X86A 1TT5A 1QLJA 1I32A 1OMOA 4AJKA 1DLJA 1KVSA 4R1TA 2O3UA 4O0LA 1UZNA 4Q3CA 1C0PA 5DOVA 2DBRA 3V2HA 1Y5RA 2A92A 3G79A 1GV0A 3PDUA 3WX0A 2I67A 2VRCA 1H5QA 1SEPA 3OHSX 4CQLA 3MCVA 1I2BA 4TRRA 3LT1A 1ISHA 1N9GB 2YUTA 2BH9A 2QW8A 2QZZA 3F1KA 1MUUA 3JQBA 3ABIA 4BS9A 5IXSA 3P19A 1K6JA 3H9EO 2W8ZA 1Y8QA 4CV3A 2EIHA 4OOEA 4RCVA 5CPBA 3QVSA 1XKQA 2P9CA 2O3RA 3JD0A 4BV9A 4RJTA 2HMWA 3KO8A 3JV7A 4B4VA 2IEBA 3DBLA 2DBVO 4L4XA 1E7QA 2UUOA 5JW6A 2HMSA 1NQ5A 1BTOA 1T2AA 3VZSA 5C7LO 1MFZA 5A04A 5U1PA 5JO0A 2CVZA 3A1NA 2OBNA 3WQRA 1I3MA 4IXTA 4GPD1 4C4OA 3L0DA 1CQIA 3B20A 1E1KA 2C82A 1MGOA 3TFQA 1DHRA 2OGUA 1E6EA 4QT0A 3I3OA 1CQJA 4IBOA 5L9AA 2QX7A 3VKVA 3D7LA 3MJ4A 3Q0EA 4R01A 3UAGA 2C29D 2X9GA 4A73A 2C7VA 4YDRA 5CAEA 1U4OA 4AVYA 5B4UA 5BSFA 3N74A 2D4AA 2AEMA 2CSUA 4CMAA 3ZHBA 3RJ5A 3WOHA 1B7GO 1DB3A 4GVXA 1A9ZA 1XCBA 3DZHA 1TVEA 2PH5A 4GI2A 3PGXA 5ENDA 4KP7A 2W98A 5T5QA 3ZWNA 5LCXA 2NVUA 2ZQYA 3CXRA 2GD1O 1LDBA 1YO6A 4RO0A 1EFLA 3CINA 1HLPA 1KEVA 5AVOA 1SPXA 4UREA 3PEFA 2DT5A 1VC2A 1V3VA 3PP8A 3PXXA 3U4IA 1UXIA 3MOGA 3NGLA 4JN6B 3EZYA 1LQTA 4Q9NA 2A9FA 4XB1A 2F00A 2JD0A 4URFA 4IJWA 1HZJA 1EUDA 2OXIA 4OXYA 3ZWXA 1BVUA 2C2YA 3A28A 2CMDA 3F1LA 4I9NA 5DBIA 1ZEMA 5K6AA 3EK2A 3FN4A 2CVQA 3BHIA 5KNLA 3K9QO 2Z95A 3E18A 2VYVD 2UDPA 1X0XA 2ZJ1A 3AOEA 3V8BA 3W1VA 3DHNA 1CWUA 2LDBA 5G0WA 2AG5A 1DC4A 4Z9XA 2Y1DA 1H6CA 1XG5A 3GN2A 1CJCA 2EHDA 3UXYA 3PJGA 5AXDA 4BNGA 4RPJA 3JQ6A 1ORRA 1WP4A 4P8RA 1JLLA 3OQ6A 1UP4A 1LUAA 1UP6A 2PKQO 3RIHA 3UHAA 5A4DA 3WGZA 2Q2VA 3ASUA 3NV9A 2FOIA 4UAGA 5HS6A 5DOZA 4B4OA 6ADHA 4HUJA 2CVOA 1S6YA 1DFGA 4R1SA 4PN3A 9LDTA 3GY0A 6LDHA 4RVSA 5T6BA 5JDIA 5L7TA 1Y81A 1LI4A 2VYVA 3FF4A 3P5SA 1JWAB 4ZJUA 4U6SA 5A3VA 4OJNA 4H15A 1QKIA 5FFFA 3GEGA 2EW2A 2NTVA 5BR7A 4YA6A 3EAGA 1NM5A 1V9LA 1DC6A 4Q3EA 1KC3A 3RBXA 4A03A 1PJTA 3RU9A 4EBFA 3VTZA 2GN8A 1PS0A 3W4IA 3WXBA 3JQFC 4GH5A 5TS3A 3ITDA 4PLCA 4E5PA 4LCEA 5THKA 5BSGA 4XQCA 5JNLA 1RYDA 4KOAA 4RLHA 1LX6A 1IHYA 3FPCA 4IDFA 3ZWBA 1O89A 4GMFA 2DU8A 3QRWA 3DB2A 5IDXA 3GT0A 4TRNA 3C7DB 5G0UA 1TEHA 2NTNA 4A10A 4BO3A 4RPLA 2X9VA 1LRJA 3B1FA 4J2OA 4OH1A 3ZI0A 3O9ZA 5L7WA 4R3WA 1ZMTA 1YONA 3NGXA 2P2SA 3WLFA 1DRVA 4L73A 1HE4A 4BNLA 2PGJA 4ND4A 3HADA 1XWFA 1V0JA 2HCTA 4FJ2A 3ZHXA 4HY3A 1DIGA 1HSZA 3ZGYA 3RUEA 4H3VA 3AU9A 4OXKA 4CLXA 2PK3A 2O50A 3CH6A 3CZRA 2E48A 1LEHA 3U0BA 1UP7A 2GASA 4S1VA 4IGFA 5ENVA 1EDOA 3R6DA 4HNGA 1WDMA 3BYZA 1WVGA 3E82A 3Q6IA 3NRCA 4DBZA 5DP2A 5EMHA 3WBBA 3VVCA 4RVHA 4YJHB 1YL6A 4FW8A 2P4QA 4L0QA 1PQUA 4CMEA 1KY4A 2BI8A 5I9MA 2RHRA 1C0KA 1ZXLA 3F3SA 1Z75A 1HTBA 4CR7A 1ZK1A 2Q49A 3IMFA 3UVEA 1NNUA 5H83A 2Q1TA 1Q1NA 4XQEA 5A9TA 4OXNA 5CHEA 3BMNA 3I6QA 1PZFA 5TT0A 4TRMA 1QG6A 4L76A 2AHRA 3K92A 1N1GA 4R9SA 4WNCA 2Y0DA 4A0SA 3ONEA 3QP9A 2NNLD 3GPDG 3HN2A 1ONPA 2IZ1A 4MP6A 1VL8A 1HYHA 4F6LA 1KIFA 4YAKA 3KBOA 3QE3A 1YBAA 3ZWOA 3KTDA 5C7IO 4D0SA 1A5ZA 2HMVA 3SEFA 2EERA 2I9PA 3U3XA 4TMFA 2DFVA 2V7PA 3B1KA 1TB4A 5CG2A 5ICMA 5JDIC 4FC7A 4OIMA 1WDLA 4AJLA 4U0JA 4GX1A 3I9LA 3JYNA 2AA3A 4BNNA 1KVRA 3L4SO 2QQ5A 1P1HA 4PVDA 4LRTB 1NTOA 1KBZA 2RH4A 4QO8A 5AYVA 3AY3A 1U3TA 4NFYA 1AHHA 5TQVA 4BNTA 4BB5A 1HKUA 2FN7A 1OC4A 2BFAA 3LYLA 1R4MB 2O3JA 4W9NC 1GEEA 4NNJA 1ZNQO 1BDMA 3IP1A 5F3RA 2PD3A 2DC1A 4WASA 4PRKA 3PQEA 1YE3A 3U4DA 3MJCA 3GHYA 5F1KA 3RKRA 4AJPA 2R00C 3TZKA 2IYOA 1RM5A 2RCYA 1WNTA 3DZBA 4EDFA 3JQ7A 1JTVA 4IPTA 1NXQA 1P3DA 4P4LA 3LT0A 4XRGA 1YBMA 4HFMA 5EINA 1VJ0A 4E3ZA 1HYGA 3NEPX 5G2OA 1HE2A 5FI5A 1LRLA 4MO2A 3ZW9A 1H2BA 4GKVA 4DIFA 2Q1WA 5KVQA 3BMCA 4GL4A 3TN7A 2B35A 4NBRA 4JBIA 1N8KA 2X22A 4CLOA 4LISA 3OP4A 4OGWA 2G17A 4W82A 1A9YA 3H5NA 3M2PA 4I9UA 4XQ9A 3ROKA 2GUGA 3F5SA 3QLJA 4WLFA 4YPOA 3VTFA 2DBZA 4ONEA 4B3IA 4YJFA 5JYEA 4MDHA 2VHZA 4IJVA 4W7IA 5TT1A 4B7UA 2H5LA 4YXFA 3FTNA 1ENYA 1A4IA 1CDOA 1WMBA 2JKVA 4OM8A 4ZA2A 5IN4A 2EGHA 5JFOA 2O4CA 4O59O 4JIGA 3DOCA 4J91A 3RFXA 3C24A 4ITUA 1B2LA 5JAQA 5AQ1A 4TZTA 1J4AA 1BGVA 3GG9A 5JMPA 3AY6A 1LDGA 1ZW1A 3A06A 3PK0A 1DAOA 4CUKA 2DUUA 2OUIA 3GEMA 4OSOA 4XQGA 5DZSA 4DMMA 3WFIA 4DQVA 4QUKA 3I23A 2FHSA 3ZU3A 1W6UA 4L74A 4DQUA 4MKZA 3H2ZA 1HDRA 1VI2A 1YJ8A 2YHIB 3SBOA 5THQA 4RGBA 4RF3A 2FSSA 1MXFA 3K96A 3EVNA 4O1MA 3TDKA 1ZKMA 4QTZA 5ADHA 3E9MA 5JAMA 2QHXA 4G2NA 4PG4A 3ROQA 1V3UA 3G0OA 1P77A 2NUAA 1X14A 2RHCA 1Z74A 4ALKA 1T2FA 3GVPA 1I36A 1HETA 3IJPA 1LC0A 2G76A 2PZJA 4CM8B 3S2IA 1DAPA 3ZWYA 4J9VA 3ZV3A 3DQPA 5JBIA 1GR0A 1NQAO 2EG9A 3HFGA 4IMPA 5IZCA 3DMYA 2AQKA 5TLSA 4P22A 4YAJA 2ZYDA 2Z5LA 4BNVA 4NFSA 2P4HX 2I65A 3QA9A 4HFJA 4FN4A 5EIOA 2NACA 4XGKA 3RC2A 4CODB 4HFNA 4KMSA 1IY8A 2VWHA 1ENPA 2ZQZA 4PLVA 3F9IA 2C0CA 5KJFA 1BXGB 3AM4A 3RKUA 4YWJA 1UXGA 3PIIA 4M86A 4BO1A 4E12A 4CMBA 2VWPA 2BRUA 1R12A 4ZGWA 3CSDA 4XYBA 1Y6JA 3IAHA 2PWZA 3MJSA 1W73A 3IUSA 4AL4A 3K6JA 1DEHA 1HDZA 3GC6A 1DO8A 3FCOA 4KDFA 3TZHA 3DHYA 2YFHA 4K6FA 4DREA 1XQ1A 1LLUA 3E48A 3GGGA 1ZFNA 3GNSA 3R3JA 4CQLB 5TIIA 2G5CA 3JTMA 5MGBA 3ONDA 1NFRA 3GUCA 1U5CA 2NADA 5DCWA 4ZVVA 2CD9A
chains in the Genus database with same CATH superfamily
2WFLA 1XHFA 4L9SA 5AHWA 3P1JA 5HFJA 2OHIA 3EFHA 3ZDZB 4CQLA 5EJ6A 4FCWA 2HQRA 1I1QB 2PG3A 4TXNA 5AKZA 1M6EX 4KTVE 1D2EA 2AOTB 2PJDA 4HXYA 4EGCB 3VZQA 2EGGA 3BN3A 4RL6A 1I4TD 4OREX 5EMKA 4BMOB 4BQFA 4EPTA 3LE8A 2TS1A 2J3JA 3M4NA 4HSEA 4KFRA 2O1SA 4YALA 4R1LA 1A72A 1FU7A 1OHHA 4BQPA 2AOTA 4MHTA 5JSZB 3PZRA 3LQKA 1FXWF 3QVGA 2XXJA 1DBRA 3TB6A 1R4MA 3IILA 4KSCA 3WLEA 4JYPA 2YVUA 5J3JA 4FCTA 3HJUA 1LRKA 4GOND 4Z9BA 2OCBA 5K8JB 3IP6A 4CCSA 3E0XA 5F52A 2VTBB 1P0QA 1M6HA 3VGJA 2P9GA 2F3TA 3P9RA 1Q44A 3A37A 2VYND 3ZWKA 3ZWWA 1G5PA 2NLOA 3IPYA 3R0ZA 4M0EA 3VNSA 5JD5A 1F20A 3PNQA 3IL2A 2GDJA 1WBBA 1T2CA 2WG1A 1PR6A 1PJ8A 3W04A 3NP7A 3IDAA 4LYHA 2VAWA 2W4QA 1FMCA 1SXIA 4DCJA 4QDTA 3OQ1A 1FQKA 3MWLA 1TQ2A 5LD2C 1RHMA 1Z2PX 4WNIA 4LOKA 4QODA 2ZJYA 1E4OA 5B37A 4ZYZA 3ND7A 2OLKA 1BMQA 2P40A 2Z57A 4HBZA 1AOXA 3TQIA 3YASA 5B7NA 1MP0A 4JVMA 4FX2A 3F7NA 4QUIA 3CVVA 2Q8NA 1BQ4A 3B70A 3M82A 4RX1A 4D3XA 1VHQA 1A9QA 1W6RA 2IJGX 1P0MA 3BWYA 3N86A 4PZPA 3VC3A 1XZPA 4JBXA 5EJ2A 1M0SA 1EBUA 2XCUA 3P71T 3AQ4A 4IUCS 5BVGA 4YBZA 1P1FA 3ZU2A 4PPNA 4Z4IA 1A95A 4KQ6A 4ZOCA 5LXTF 3EIFA 2XMQA 4JR2A 4K40A 4JX8A 1R88A 1U28C 1WTAA 5LA6F 2XCSB 3GJSA 4P4UA 2OG2A 2FSIA 1WXWA 3I4CA 3HI6A 4D57A 4PG8A 3LUDA 1RZRA 1J6UA 1ZESA 1RRPA 1O0SA 2VHVA 3JQ8B 1FQWA 3IQHX 2IYPA 2BW0A 3D5EA 3E6AA 4MYUA 2W6IA 3RPEA 2FPGB 1EE2A 4LOIA 2I3AA 1U3DA 4TLAA 2BGLA 4HNRA 3WIDA 4PQEA 4HZIA 4LZWA 4RDHA 3THXB 3GFFA 1T1EA 3T61A 1XLWA 5EN4A 1X7GA 3M4ZA 3E4CA 3UV7A 1P4AA 1USIA 2VDWA 2FGJA 5EZYF 3HN7A 3WIUA 1XDBA 1FLNA 1C3XA 4KAFA 4XR4A 4JOQA 5I6DA 4RTKA 3IODA 2ZWPA 1IM2A 2BONA 2J7KA 1Z07A 2JI7A 3BCUA 4YI5A 1KI4A 2HPAA 2N3ZA 5TF4A 4CKXA 3PLAE 4NK4A 4UHEA 5KNBA 1VE7A 4MUBA 4YRCA 3BSWA 1I7LA 5TMEA 1IN8A 1T5DX 2CVHA 1JHRA 3HB5X 1EA7A 3AW9A 3W3AH 1W44A 4YRGA 5LZ5A 1VHTA 2Q27A 1VKZA 3X1XA 4ZI7B 4FHGA 1AB6A 2Q21A 1K4MA 3T1QA 5A4JA 5ITVA 1WLYA 4HVAA 3WGUA 3P9CA 2O0HA 4PM4A 3H5WA 2AWNA 2EX1A 1JDBB 2YRFA 4QOHA 4QFMA 1E9VA 3KLMX 2QQEA 3WZMA 2EW1A 5BN4A 3TSYA 2X5KO 3K0EA 2JFPA 4FPXA 4IHJA 4BFWA 3AKYA 1DRKA 1PJRA 4P54A 3JW8A 1P4GA 1KQPA 3GH3A 5BSKA 5HWSA 5IBPA 3ECCA 1E79A 1SQ6A 3HFJA 3F3YA 2IPXA 1V35A 3QJGA 1NRJB 3L5OA 3D64A 2XEDA 3GVIA 1YL7A 1XR3A 1D6NA 4RTOA 5FR2A 1FDTA 4O4LF 5H16A 5IT0A 2ZREA 4TV9B 1KI9A 1PJLA 3IAFA 2GRJA 4N7BA 4YT2A 2P2GA 5TJHA 1DBQA 1JQKA 2NZWA 1HK7A 2C92A 2VP3A 2VYCA 5B58T 1JDUA 4OD0A 1NI5A 2Z2JA 3B13B 1K89A 3BA1A 1GG5A 4OMCA 3EGDA 4TVKA 3T8YA 1RAHA 1ZOIA 3WIEA 3LPDA 3LPLA 1IBMB 1EMDA 3ANNA 4OHCA 2TSYB 1I80A 2GOYA 2W6OA 3FYUA 1DG3A 2BEWA 2HXGA 2XWQA 2EC5A 3LX4A 3AVWA 2WWYA 4KPFC 4K88A 4IMJB 2HU2A 5L7YA 5EJEA 1M0EA 4GYKA 3GP5A 1WHSA 4P7FA 1AM4D 1AT1A 3KM0A 3WMXA 3BIXA 4EI9A 3SDZA 3QV1A 2ZUUA 1Z4IA 1Z2DA 5JMOA 1Q0SA 4Q82A 1LVGA 2D0IA 4DA4A 1XIVA 2Q2NA 4UD2A 3PGA1 1DEXA 1ZVMA 1T6NA 4MAFA 3H65A 3I04M 4UNSA 4RHEA 3TJRA 4TLMB 4XPIA 3GCGA 1UDBA 4YJ3B 3UNXA 1ADBA 2CJPA 4J0HA 2GN6A 2XECA 3RAEC 2CMFA 1U2TA 2P68A 4HXEB 1CDDA 3Q1LA 1M6VA 5A05A 4WOCA 1IUKA 2UU9B 5AI0A 2DTEA 4X65B 2QW1A 4TL6A 4KKVA 2B21A 1D7OA 3KKPA 1OFUX 1RHQA 3PE3A 4TWIA 4LRSB 5D6OA 1AKTA 4H2DA 1VKRA 4RVUA 4MKXA 2C5AA 2VZEA 2ZVPX 4YCBA 5EL0A 3H5OA 4MVJF 4RFSA 4CI0B 3G8AA 1JVNA 1G7CA 3RJTA 4UU1A 1DXOA 1W4CA 3HDJA 3VQTA 2GN9A 3V48A 1SBCA 5AVQA 3FTEA 1P2DA 3RIYA 3NETA 3OQHA 4MCJA 4IOLA 4I9GA 1ZUNB 2PBRA 1P3Y1 3O4HA 3V7WA 4UU7A 1R0SA 4LJLA 3LQ4A 3RSFA 2J5BA 1NQTA 1OBCA 3IV7A 4NXMB 3GOHA 4AJOA 1XPUA 2EFCB 3IQZA 1ZGHA 1GQSA 5COQA 2J9XB 3PZBA 1GJRA 4O2AF 1TZJA 1IXKA 2NZVG 3G9UA 1WW8A 3O4GA 3PENA 3SZMA 3NNNA 1ADCA 3WXMA 4CRWB 3BE6A 2HA3A 1H9AA 1PYOA 1JJ7A 4DGQA 3LC2O 2P0AA 1C7ZA 4DLAA 1J06A 1T91A 3AXSA 4IOMA 1I6MA 2GK4A 2I8LA 3AI2A 1YU6A 1F8YA 1EP2B 1PAUA 1O58A 1VLQA 2HMUA 2PKCA 2WKQA 3CWZA 3E1GA 3JD3A 3K0AA 4NS4A 4RF2A 1EE9A 3V6MA 1HMPA 3UHJA 4RBNA 4ZCLA 1G5IA 4DIBA 2ZPUA 4JLNA 2O5EA 3CLTD 3WTBA 1E0AA 3R4VA 2C2XA 4Q9AA 4YT4A 5K7SA 4FBMA 3SHWA 4I4TA 4KRYA 2CJYA 2DBQA 3H18A 3PGJA 5IAKA 3WISA 3RYCA 3KHUA 2Q28A 3FYTA 1YC2A 3DF9A 4KZKA 2MYPA 3RWMB 1Q1QA 1RYNA 1OAOC 4MRRA 3BZBA 5HCIA 3SF0A 5JMWA 1UPUA 3ENNA 1YFLA 3V4OA 1L7RA 2W7TA 5I7AA 4TQUS 4EI2A 4BNJA 3PXUA 1GFWA 2XVAA 1VPLA 4X3PA 4BGEA 3FPBA 1U8TA 1E62A 2GCIA 3H5IA 2D62A 3R0JA 4Z4FA 3OTQA 2I91A 4PY2A 5EE0A 1TPZA 1GA1A 1TUIA 3K94A 3BQ9A 5D8DA 4UDYX 2Q50A 4M8LA 3HTXA 3HA7A 3P45A 1KZGB 4R16A 1EXVA 1E59A 1K75A 1ZRNA 1EP3B 3IKTA 4EATA 2WU0A 2ODEA 2V3WA 2HA0A 1ZL2A 2RAUA 2RHDA 2DJ5A 3ACBA 4PZYA 4X8LA 1PG2A 2X0EA 4MUMA 4DMKA 4B73A 2Q7OE 3H7IA 1GN9A 4JJZA 2PS9A 2WJ6A 4DXDA 5HIMA 4E2XA 4RZIA 3ELWA 4URWR 1IYZA 3IO3A 1U4SA 5KNDA 5H59A 1E6KA 5JEDA 5JANA 1GZHB 2WHRA 3CV3A 3DAPA 3VH1A 1OF1A 2C4WA 1DO2A 2H00A 1KFCB 3HCRA 4NV1A 1CUWA 3QWHA 3OTIA 2IOFK 1YHZA 1VGQA 3ZGZA 1G19A 4BNZA 5EJ9A 1XHEA 3ZH2A 4I99A 2GESA 3M5WA 4HNTA 2XNDA 3OSUA 5ILGA 3MTEA 5G4KA 3SLKA 4I9FA 1VRWA 2A1UB 2IYUA 3RJ9A 4UDOA 3TAXA 5KJFA 5F1OA 4EA6A 1JI0A 1RNLA 2PZKA 1YVDA 2ZIGA 2WT4A 4FS3A 3DE4X 1DT5A 3K9WA 4D9GA 4QJ3A 4Y2GA 1IQRA 4LPSA 3D1VA 1DX9A 1CU1A 3H3XA 3QG1A 4MPRA 4CL8A 4DVGA 1RHKA 2E4XA 2VTKA 3MSCA 5MDHA 1JIIA 4FQ7A 3OUUA 5BQFA 3DBRB 4OO3A 3DCJA 4IIHA 5JBNA 1TZBA 1QHEA 2J67A 3K09A 3QUAA 4PO3X 5MFPA 1KGDA 3W5JA 1JEYA 1E2IA 1ZS9A 1E0JA 1A8SA 5FDFA 4IYRA 3EEIA 4QDOA 3EWAA 4CR6A 4CR8A 4D8VA 3PWZA 4Q1AA 2WLSA 4D9EA 4HQ6A 1XJWA 4IHJF 3JYHA 5JCZA 3CE6A 2GD6A 3QMPA 2C3YA 4LDJA 2FPGA 3D43A 3FDXA 3DE5X 1NXPA 1IG0A 5F21A 1B1CA 4Q6WA 4GO1A 3ZWDA 3PI6A 3TUIC 3PYMA 1E2DA 1X1TA 3ZHSA 3IQWA 3GVHA 1L7VC 2CHUA 4RSHA 4G9EA 1CUGA 2QTVA 2V65A 3VHQA 1ZVKA 3Q87B 2RG7A 3L3BA 3TRJA 4C29A 5M7EA 3DVSX 4NMHA 1EG2A 2V6GA 4FNAA 5B6IA 2IZZA 1H2HA 2ID8A 4WCFB 4IDDA 3IX7A 5KOHB 2B78A 5L40A 1XVVA 3M9WA 3PXDA 4LOHA 2GK7A 1UJCA 4UUPA 4KUEA 2GZRA 2J7PA 4HXGA 2OXRA 4WOJA 3VO2A 4FP9A 1PEKE 2RHLA 2WDZA 1DGQA 5DYGA 6AT1A 3MHTA 4PZZA 3DTNA 4PPGA 4YHBA 5FPTA 1BWPA 1VYTA 2VDNB 3ACCA 3AUYA 4XCXA 4OIFA 4XFKA 2VDUE 3RVOA 4B7CA 4D97A 4MEJA 1SXJE 2BFWA 2FLWA 3PU6A 5CBKA 5CDSA 4CU2A 5IHXA 2OQVA 2JRCA 3RC3A 4ARSA 1Z33A 4QYSA 3OFND 4HO1X 4TQGA 5DJ5A 3G9TA 5BYJA 4QPJC 1U2PA 2AUMA 3K8YA 1NW6A 4HJRA 4I3GA 4W5TA 4B79A 3T9FA 1VPDA 2C4VA 4MB0A 4DSTA 3KQNA 1VKNA 2H1RA 3D4NA 3ELYA 1C3OB 2ZRFA 1OXKB 4HVTA 5JWRA 1FCJA 1FTSA 1EDBA 3FYDA 1PVOA 2VP2A 1I2MA 4D98A 2D54A 1ICIA 2FEOA 3OCXA 3MTJA 5TXGA 4RTLA 4C3UA 1O4WA 3ZWCA 2D74A 4NBNA 3KWLA 5DSTA 2L82A 4ZOLA 3RBAA 3PDIA 2AH5A 3L1JA 4UZSA 4FFOA 5LZ9A 2HTEA 1U80A 1MX9A 3BE4A 4V02A 2PAFA 2ZUVA 4LXIA 5FWDA 2PX6A 3UATA 2OMKA 3DXZA 4N54A 3TK1A 2ZI5A 2H1SA 4Z2AA 5D5PA 1NE7A 2IXBA 3ITKA 1ZJ6A 3KAPA 4CU5A 1RXUA 3CUSA 1V11B 2WINI 3L7IA 2H6EA 2PWPA 2VR1A 3QI7A 4GSLA 1O9GA 2EFEB 1NGSA 2WWFA 3WLNA 1DKRA 1PX2A 2ATEA 1ZU5A 4XDHA 5ALEA 2JHGA 5F7JA 3INGA 1MOZA 2JLYA 3H04A 4AFNA 5IG2A 3JD2A 3TM4A 2IF0A 4DY4A 1DCTA 3DFKA 1BQEA 2P9FA 3LVQE 3E9RA 3NONA 2OD2A 5K3EA 2QJWA 3NWBA 4YAGA 3N8IA 1WF3A 3WGHA 4UHCA 4YUZA 2HHAA 5KU1A 2QBYB 1IOLA 1A71A 1MAWA 3IAEA 4M9SA 4QLAA 3V5NA 3KR9A 4HNVA 3GUYA 5JXWA 2QD1A 1JV2B 2WJ3A 3DPUA 4BUCA 1QC5A 1PGOA 1USWA 621PA 2PFKA 2R48A 3I0ZA 1GPBA 2Y8EA 1KZHA 1L4NA 1RS0A 2Q2WA 4D0GA 1YQXA 4OK3A 1OXTA 3OPVA 4INOA 4F3TA 3P20A 1JN0A 4KWHA 4L7VA 4MWSA 1VL2A 4TTPA 1T1RA 3LDUA 4UEQA 4WWHA 5SYMA 3ORHA 2ZPAA 4RK4A 3LWZA 4AF6A 3HCEA 1PJ2A 1XKTA 2NXNA 3PD1A 5F1PA 2HIHA 1LLCA 4DR6B 1LJ8A 1ZICA 3CSSA 3U4AA 3UKOA 4EHNA 1WUJS 2PFGA 2XNCA 4MJ3A 2CXNA 5LDDC 4R8SA 3ZNPA 3KIPA 3FBTA 3TLEA 2EBHX 2G6TA 4R7GA 2J85A 2DFNA 3RV4A 3FLAA 1RBYA 5EWLB 1KDYA 1FQOA 1EFAA 5DLPA 1TAUA 3VR5H 3R3SA 4IG9A 2JF0A 1E3WA 4AWAA 1I3KA 4OL0A 2ISSD 3RUAA 4KNVA 5EOVA 2H17A 2O52A 4Z7QB 2XNSA 4LNUA 4FZ5A 1K3FA 5DX8A 1YNOA 5SZIA 2ZS9A 3PC7A 4F4JA 2RI0A 1ZWKA 4PQRA 1NE2A 5JLAA 4B3SB 1T2EA 4HGOA 2JJYA 2FZ5A 4O2LA 1F48A 1D0SA 1YRYE 2ZTSA 3FZNA 2G9ZA 3DEFA 4BO9A 1OJLA 3ID6C 4FYWA 1G55A 3X1YA 2PMDA 4UMEA 1EESA 2OV3A 3OU6A 1NG1A 4IMRA 2CMKA 3DT9A 1Q91A 4OQXA 4QVGA 5REQB 3V1TC 2I2BA 4YT8A 4HEA6 4IZIA 4KGDA 2NX2A 3C8MA 4FMCB 4ND8B 5EP1A 3RJMA 1O6ZA 1QFJA 1Z6XA 3AETB 3KE9A 3ON5A 2RG1A 1U63A 1HL7A 4ZIRB 1IY2A 4DGSA 2VH5R 1QJCA 3DO5A 1KARA 2J7PD 2XUGA 5K3SA 4OJTA 3A1TA 1D2GA 4G1VA 2PQ2A 3TOZA 4C1BA 4EHJA 2BWJA 1S7GA 1KZ4A 2JGEA 3N75A 2Q0QA 3N0RA 4L22A 4UE3S 3U09A 2WMOB 1JWBB 3EQZA 4I14A 4ESHA 3CLKA 1QAMA 1JL3A 2AX3A 4M1ZA 4AZTA 1ZI8A 2HRQA 3T3EA 3L8ZA 4F7WA 3QOYA 5TMDA 3Q3CA 4WY8A 4H4EA 4HN9A 3LX8A 3P97A 4XD7D 5AFSA 1K8YB 1XZAA 1XK6A 1PN3A 3D6MA 4NE2A 1CERA 1SBTA 2GJ8A 2J30A 2HIMA 1JILA 3CM0A 2C7PA 4GMGA 3ZCSA 4MR7B 3O3MB 1PD0A 1L3IA 3SXUB 3WL6A 3BFKA 3H7AA 4GXRA 4XX0A 5JH7B 2A8YA 2QQ0A 2J0EA 3A3NA 1P31A 2FVYA 4AO6A 4AY4A 4PYJA 1OH7A 3B6KA 4PSAA 1FYEA 4B3BA 3GIWA 1ORIA 3KTOA 1UOOA 1QK5A 1P4JA 4WLOA 1MABA 5ICEA 4MR8A 1XAIA 1O6FA 5CIWA 2BTQA 5FJIA 4MDEA 2ZYHA 1NRIA 4WLUA 3UJDA 1SCKA 2P6NA 1TGYA 1C7RA 3OCJA 1YZNA 3OOSA 4I19A 3QJ5A 1CUUA 1C9MA 1Z2OX 1TO6A 5BV1A 4V2UA 2AZDA 3NUZA 4HPXB 4NARA 4WOBA 5EJ7A 1F60A 3IUJA 4ND2A 1UDRA 5ADWA 3KKOA 2XZLA 3KEFA 1RVDA 2QAGC 5JJIA 1GTMA 4CIVA 4PZCA 4YMWA 1BRMA 4RIFA 4FGSA 3O4RA 5JISA 3D0KA 5FCDA 1XB2A 1BKSB 1URPA 2QJFA 4B4WA 1AE1A 2BC9A 3R7WA 1U6KA 4NPCA 3D4PA 3SZLA 5B57C 4QL3A 2PUCA 2JJ1A 1XU7A 3FKSA 2ICAA 4LWQA 2VN8A 2WWHA 2ZIUB 3GK3A 3SXJA 5ULLA 4EW3A 1XZEA 4B71A 5JZOA 4L51A 5LP1A 3QUCA 5C35A 3G13A 2EKDA 4JP8A 1H2YA 3VPFA 3L05A 4RK7A 4OV6B 2CUTA 2HYIC 2JLWA 4DJDC 4MGIR 1R6DA 1RADA 2GS9A 4M7WA 4F46A 5CAEB 3OTOB 1LU9A 3PQ4A 3ZE7A 3DCYA 1SD5A 1ULTA 4FT2A 4BX2A 1VMEA 1ZW6A 1TEVA 1DQNA 3G9QA 4CDRA 3D4IA 3QSGA 1XD2B 7AT1A 3BWDD 3U6BA 5C46F 2BMAA 1M2HA 3P2OA 4IIBA 3OZFA 4S1WA 1XEAA 3K9LA 5MFZA 4DR1B 4ZVTA 1USVA 2VK2A 1IDOA 1IZ7A 2ECFA 2WYWA 5CT4A 3EODA 4GL2A 1ETUA 1T0PA 3AUFA 3G0BA 1YJ5A 3HBLA 4KBYA 4NQRA 5T3UA 2RHTA 3ZXUB 3UZUA 2W8BB 2AQ8A 2WQZA 4ZAGA 5DNYB 1FF9A 2G88A 3HXLA 4HDMA 3H1AA 2Z3ZA 4BMCA 3WJAA 3U9LA 4JD5A 3X1KA 3AHCA 3S55A 1OH5A 3I5UA 2YZGA 5AJXA 1XTRA 4TYYA 2O0KA 1Q83A 1O4VA 3NLLA 1QHSA 4Y2RA 1C2YA 2ZSFA 3PEYA 4R0VA 1PL6A 4B3JA 3HR7A 3HJFA 3PQCA 1CUCA 2AXEA 4RPCA 5CVJA 4ZYTA 1NNLA 4U02A 5K3FA 4CMHA 2GHIA 4Z4CA 1KXZA 2PKRA 2O2ZA 4I4NA 3WDSA 1BMFA 3GFTA 4OXRA 3BE8A 2LCQA 2HZ7A 3T0GA 4B0OA 4Y7DA 2D0DA 2ZXUA 3SYMA 4QC2A 1U8YA 3OM0A 2WYVA 4YJGB 1Y33E 4Q6BA 4CM1A 1E1RA 3VYTB 3SDBA 3RK1A 3HVJA 4LRYA 3ORYA 5CD9A 2JS7A 4HWTA 4PYKA 3CLHA 3ND8A 4IP0A 1QFZA 5ALPA 4BL5A 2FCAA 3S2SA 1LSSA 2QU8A 2I4IA 2CV2A 2QS9A 3A6DA 4A23A 4AJEA 4EG5A 4X94A 1EWYA 1U9IC 2EWMA 3BF7A 4G4JA 5BW8A 1ZD8A 2VQ3A 2WAMA 4ZI7A 1I1OA 4OHOA 4DBLC 2IF2A 4FMDB 2RE8A 2GD0A 4R98A 3OZGA 1R5JA 4MLZA 1KQGA 2FB9A 2Y77A 3H2YA 3HKEA 1S3GA 4L5JA 5T4FA 2B61A 2PJUA 3AW8A 2NYUA 1N5RA 2O7NA 3WIBA 4LGMA 4RJIA 1WCIB 4YJ2F 3MJEA 5J4KA 2XWSA 1LX7A 2EAUA 1TZCA 2V45A 5EIFA 2QG4A 2QUIA 5ADHA 1YDFA 4LDPA 5K6TA 1W48A 4HS4A 4RXUA 4TMVA 1YS7A 3U3JA 2A0KA 4F21A 1IXRC 2WFAA 3GJZA 5CTJA 3AONB 1YAJA 1E9CA 4U39A 3N2NA 4GX0A 2REXB 5B7PA 2Q3HA 3KAJA 3SJUA 5T3YA 2I29A 1RP7A 3DPIA 2TECE 3JWHA 2B8WA 3MAGA 4HRAA 3MA0A 5JYCA 4AU1A 1GZ3A 1LPNA 1X70A 2ZATA 3FDIA 3KYIB 3EPKA 2SBTA 4K3VA 3STUA 1W9HA 5CB4A 4N3BA 3TCNA 2Y0EA 2QTFA 1ISPA 2R8YA 3BMOA 3MJFA 4LF5B 1GAWA 3M4YA 2B98A 3HKDB 1PWHA 2EDCA 1M1YB 1J1IA 2BTOA 3CH4B 4C78A 3KQHA 2YDXA 1C0LA 4EFNA 3P27A 3KPVA 3MOSA 4I7EA 1YF3A 3LZCA 2QOEA 1MIHA 1DINA 5CVVA 4LFBB 1Y6GA 4OGLA 3T4XA 1FJXA 4Q7EA 3A9CA 1DWOA 5B2FA 2DP4E 5ALHA 5IBRA 4CDGA 1UF9A 3FKSD 2C8JA 2R96A 3TINA 4BKOA 4DJAA 3ANSA 4TWJA 3WNDA 2QF7A 2CLFB 4XR9A 2Q5HA 3TD6A 1Y9JA 3TSWA 3U19A 1P2SA 5CFZA 4W8HA 1OIVA 2HNBA 4PYRA 5HYVA 1QP8A 2ZSUA 3WBFA 1Y3BE 5AICA 4FSHA 3H84A 2NU6A 2P2YA 1ADYA 1OQAA 2FWRA 2E4WA 2ZETA 3ITNA 2RH9B 2PHZA 3JVDA 1WX1A 1M66A 3BERA 3K4PA 3QYAA 4QX6A 4HCJA 5EIHA 2A9JA 3MINA 5K03A 1KYYA 1CQZA 4MINA 2A3NA 1Y37A 3AFMA 1U7ZA 1U3VA 1JMYA 3CISA 3G2JA 4LVUA 1F0PA 2JZCA 4NICA 4M37A 4NLLA 5WRFA 3TOSA 4BFZA 4JEIA 5ITZA 4DVJA 2Y1EA 1Z56C 4I66A 3L8CA 1PV2A 2Z6UA 2WTBA 1JAYA 3ZJVA 4HH1A 1N5MA 2XUAA 1CR4A 2Q2OA 4PGAA 3V8MA 4ESEA 5HCNA 3S44A 1CY7A 2R8BA 2HRRA 1RLJA 3DHEA 4ETIA 2XXAA 4WL0A 1DTSA 1XALA 1P19A 3NP9A 4GOXA 4UDNA 3W5BA 1FFSA 4ZXFA 5ECWA 1UK6A 2EP8A 2ZIVB 4YROA 1FJGB 5C51B 1HL3A 4AICA 5BQ5A 4R5MA 4UUMA 4JI4B 3LA8A 4FYPA 2XRZA 5I5EA 2P6OA 3EW7A 3AIKA 4GBGA 3F6BX 4KUHA 2AC2A 3DA8A 3I58A 4GZMA 1MU0A 2BFDA 3HRHA 3KQSA 5MF6A 1FRZA 1X9HA 3WWYA 2VHEA 4JJFA 4Y8VA 1HX7A 2Y2UA 1OXXK 3HNRA 5C5IA 3MJHA 3W5CA 2W22A 1F7UA 1WDWB 1NLFA 3ZNQA 2H5JA 1CZRA 4TM7A 2EP7A 5FULA 3WA6A 2AFIB 4AX4A 1OKKA 3B1JA 3B3FA 1EGAA 4MWCA 1FPMA 2HHLA 3PI7A 3WK9A 4EG8A 1CBUA 4LRUA 3JWEA 1QR2A 2Q4OA 3DFIA 3A1VA 3M70A 5M3BA 1S4MA 3QI2A 1HE3A 3HKBA 1RYMA 2IKQA 4OGGA 2YC2C 2WJPA 1Z7GA 4LNAA 4KVFA 5TMPA 4YX9A 4TOIA 5BNFA 1NONA 1FJHA 4F86A 2PKEA 2D2FA 2QRLA 1G9TA 2PUHA 3HO6A 1AH2A 1DUSA 1L1EA 2RJNA 3HU2A 4KXLA 4D8UA 3IOYA 2BM0A 1GADO 3T6KA 1IOZA 2FZ4A 2G5PA 3A2MA 4EELA 2C0PA 1U0NA 3BSSA 5HDQA 3CLRC 1FP2A 3DO6A 1ORWA 5IZCC 3PXCX 4JEHA 3IKMB 2ORVA 3F5FA 1W34A 2DQZA 1JKJA 3BGVA 1G60A 5FF9A 4AXBA 1PQWA 2BI4A 2MSNA 4PYOA 2OFFA 1Y8CA 2EBUA 5D01A 4OKSA 2JFQA 4ENTA 1MZPA 2J9RA 4BMDA 2WM8A 2Y1WA 4DCPA 4TUYB 1XZHA 1IJFA 4FQ5A 5AXBA 1PX0A 4K9RA 4KKXB 5JS1A 4JJEA 1SCBA 4MDYA 5FADA 4UMFA 1GLNA 1P60A 1RM3A 4TWZA 2W83A 2ATCA 1JU4A 3CWCA 3PVZA 4YAOA 5FTLA 3NEAA 3ND5A 4O4LA 3VA7A 1QH8A 2FN8A 3PQ7A 3Q7RA 3EVTA 4G5OA 3HJBA 4EB8A 3PJEA 1T2NA 3PGVA 4X7MA 1IOVA 1SMKA 4AMVA 3WYCA 1YXMA 5HM8A 5JARA 1XKXA 2II6A 1JIQA 1LK7A 3ELBA 3H83A 4OL9A 2JW5A 1EX6A 2VXOA 1F3LA 5DNAA 3RI3A 2IS6A 4BMNA 2XQKA 2P62A 5GY7A 4NEHB 3UMMA 2NZUG 1ADGA 3PDIB 4FM9A 2JGKA 4OB6A 3TQHA 1EEXB 2J9FA 2Y1GA 3SC6A 1GTZA 2IVZA 4GR4A 2IQIA 3DUFA 1PR1A 3A1SA 4TLDA 5TQ2A 4Z3KA 3CLTC 2VPIA 1WXQA 2B7CA 3GRAA 3IP9A 4MNTA 2WSBA 3L92A 1Q7EA 2P3SA 1UPFA 1P80A 1WUKS 2ZKIA 2ZRKA 1C7IA 4JVOA 4FXOA 1QFXA 4FLMA 5T4HA 3TZLA 2K5UA 3CH7A 3MTBA 5E9JA 4M55A 2FEPA 2JJ2D 3CX7A 1GA4A 1GITA 1FDWA 1CUFA 1HZZA 5HBGA 1UK8A 1ODSA 4Q1EA 3IERA 1IIRA 2H3EA 4J0KA 4L2IB 2W58A 4NMMA 4TKZA 4BMPB 4DDWA 3IE1A 3IOCA 1TMKA 5AW3A 2WVAA 4RTMA 3TTXA 2W4IA 3S2GA 2AZMA 3NANA 4WK2B 1Q0QA 4F85A 3GBSA 5IULC 4ZCPA 2H1CA 3N58A 3WK8A 2J6HA 2GAFA 1I0LA 1K8XB 3W8FA 1SU6A 4KWIA 5KYUB 5HZKA 2X6QA 2VJKA 3KHTA 2CDBA 5CEFA 5JVDF 5I9LA 1C30B 3C6BA 2W2QA 5HRAA 2HH9A 2B1QA 2SICE 3ADKA 3AX6A 3Q3VA 4DLNA 1U11A 5D3MB 2GB4A 1G3QA 2O5VA 1T29A 4XCVA 2IEGA 1KAOA 2AYYA 4QOIA 4J3FA 4BAZA 2F67A 1U7PA 5EIWA 5JCJD 3EFOB 3F3MA 3FVVA 5LQUA 4B74A 3VSEA 3SS8A 3GBPA 1XD9A 2GEVA 5JXGA 3H4VA 4JENA 4GM0A 5EP2A 3VXKA 5IUKC 2ODWA 1JEOA 2Q3JA 4JOCA 2ZBRA 3Q12A 3IUBA 3F71A 3IPCA 3AHDA 3C85A 1IVSA 4M0MA 1PJSA 2FUKA 1U0FA 4Y2XA 3RODA 4C43A 1J20A 1R0RE 2FP4A 4P4NA 3JSXA 3BB1A 1W93A 4HLUA 4IQFA 1WULS 2VHWA 1NMZA 2VNKA 3AEUB 3CT6A 4MIYA 4RCYA 1RWMA 1ILEA 2K2QB 2ZRCA 3UH1A 1AN9A 5HHTA 5EYPA 4C30A 2BJHA 4GICA 1QOPB 5CP8A 1PSZA 2C7GA 3MZ0A 4R71A 2B99A 3RUIA 3PQDA 2O6HA 3UJ8A 2AR0A 3HM2A 2GCNA 1MB0A 1L5NA 2C3PA 3AR9A 3DZJA 4I5DA 1W46A 1GGHA 2E6UX 3SVLA 4ZOBA 1PJAA 2BFEA 3ESYA 2FPIA 3O03A 4TTRA 4MQFB 2DERA 4G56A 3DTVA 2Z6AA 3M3PA 1ZONA 4MA4A 4LN1A 4KQIA 1JA0A 2O8EA 1NFQA 3CG4A 3D4LA 4FSDA 2K7FA 4MYDA 5MN6A 3MLEA 2Q45A 2A0WA 2P77A 4PBRA 1KVQA 3X2SA 4Q7LA 5KOIA 5K0ZA 1BA2A 1ZJYA 2A9VA 5BUCA 5LYJB 2HLDD 4ZV7A 3LCRA 1KAQA 3NTOA 1Y7IA 2FQYA 4CT0A 2JGDA 3GRVA 2Q3BA 1J0EA 3BM5A 2WWGA 4UMVA 4C7JA 3OD5A 1YZLA 3OJCA 1PZGA 5COBA 2C1EA 3O82A 4P53A 4XSHA 1JECA 2WPDA 4JSRA 1PK8A 4EPXA 4GYJA 4RD0A 3HB9A 1MRZA 2G1UA 2B36A 3GEEA 1UKCA 4RF5A 2PMFA 3ZCVA 4ZU3A 2AKAB 5IYZB 2QD5A 1NJGA 2R5FA 3PHLA 3FGZA 3GPIA 2WZQA 1ND5A 4H7DA 2I6TA 4LTMA 4AS1A 1BAPA 3KB1A 4Q4AA 2AG0A 3HB7A 5MN4A 3OIGA 1H4VB 2W9XA 3A4VA 1J8DA 2VK8A 1R8YA 2CNWA 2IPOA 4Z0PA 3QNMA 2WNSA 4JBWA 5B6PA 2DFKB 1K6XA 1WUTA 5FPSA 3MT9A 4JEUA 2YOFA 1OILA 5AHKA 4HVCA 4F92B 3QPAA 3IEIA 3E9ZA 1RJEA 3TR5A 4OATA 2FDCA 1UIRA 4YCAA 1NL3A 5H80A 4D7AA 1XTPA 4MWDA 1KQ3A 1INLA 4QU5A 5ALKA 2ZTLA 2PJZA 3KUXA 1BXKA 1M8PA 2HWUA 1TCCA 4HH4A 4QJ5A 5CVUA 5C81A 4I55A 1RJGA 3VFDA 2CWWA 1U5BB 2UYQA 1RSZA 3UXHA 2ZYGA 4DRYA 3LUCA 3RASA 3WGJA 4K46A 4NBVA 1C1YA 2X3YA 2CL5A 1E6WA 2W6ZA 3WZLA 1ZN8A 4UTXA 5T4EA 1CNMA 1WWKA 1LH0A 3GDFA 3A7EA 4G07A 4RYLA 1NTRA 4ZJZA 2ZAIA 1GUAA 2B8EA 2IEZA 3K9GA 5GONB 2LE0A 1KL7A 4GNKA 2WMNB 2JCYA 1MEOA 3NKVA 2PR7A 2MSKA 3TGLA 1JHZA 1I2CA 3GRPA 3B9QA 1PLJA 3EXIA 5CXXA 1JXOA 3SC4A 3SX4A 1NVXQ 2H06A 1FP7A 1YMUA 1ZK4A 1OGIA 2IPMA 1E5LA 3QF4A 4P0QB 5JOQA 5UKDA 2O3TA 4X85A 2RHJA 4Z3OA 5AO9A 1G291 1HFWA 1BOFA 1GRQA 3PITA 4GOOD 5E1MA 3K0KA 1U8UA 4Z99A 3PBKA 5AKIA 2HXSA 3P2EA 1O87A 3DW1X 3I9JA 5CFQA 5DNEA 4J0DA 2J0UB 4DR7B 4GRDA 1W4RA 1FP6A 4WBNB 1MA0A 4RY8A 3GHHA 1NNI1 5LLSA 1GM5A 2QTMA 3M6VA 4DR4B 2O23A 1W8DA 1XDZA 4GXQA 1N9ZA 1K7EB 2PZEA 3C8ZA 1CZLA 3MUNA 5E4FA 5A9RA 5GMOA 1Q22A 4ZV4A 3GU3A 4LTDA 4EYOA 3K8QA 1LDMA 3BRQA 3TSOA 2ZSEA 3DFFA 1BMFD 2W2OA 1TLTA 4F4CA 3B8EA 1ULBA 4G9GA 4M9XA 1BJRE 5FBHA 2XT0A 4JUAA 4U8GA 3V9AA 2Y6UA 3NHFA 3NBXX 4MVJI 1WRBA 2YASA 3HZZA 4UVHA 4L8VA 3OE1A 1ZHOA 1GN8A 1OA0A 2UUPA 3RD5A 2XODA 2A5DA 2QXUA 2VHYA 1DP4A 4H1HA 4C06A 1M5RA 1H0RA 3P9YA 1IL0A 4RULA 2V9ZA 5TMBA 1UMBA 5JADA 3L6EA 4Y0AA 3ZY2A 4G4SO 4D9NA 4DLVA 1XVTA 2EL7A 4A0FA 4KWTA 4JOSA 2BD0A 3QXSA 2I2FA 2XZTA 2RHHA 2ZI3A 3AOEC 4P3XA 1CP2A 3BMNB 3EDMA 3ICEA 3K5WA 2C97A 4EK9A 1P5FA 3FCYA 4AW9A 2BKXA 3OUZA 1A76A 4F3CA 2DTDA 2KYRA 3OFKA 4C76A 1QV7A 1NQXA 1UDCA 3NHKA 4QSMA 1ZH6A 3X1JA 3NBZC 1MOPA 4WDQA 1R5BA 1DAMA 1Z6ZA 2BFEB 4TLBA 3JPWA 2C9BA 4H35A 2BAGA 2Z98A 5JE8A 1HRDA 3OETA 4D2IA 4ZVMA 1RD4A 1C14A 4DSUA 1JDZA 2JASA 3DDUA 3VPGA 8GPBA 4WGGA 1RRGA 4YR7A 2PNFA 3ADBA 4AZVA 3VR1A 5HKAA 2BMWA 1Z63A 3VH3A 1C0IA 2HBQA 2ES4A 1BRTA 1QAQA 1TJ5A 4P4SB 4B9EA 2LXNA 1OD6A 3IUNA 5A1TA 5BUQA 2CCJA 3SNKA 4UBNA 1H3NA 2F55A 1X7YA 3IULA 3ME5A 3GPBA 1O8CA 3OKPA 3OM9A 4WKGA 1NJSA 2QI9F 2DKFA 4ZZ3A 5J43A 4P2BA 3Q0IA 4K9DA 4B33A 4YLGA 4GQAA 3HYLA 2FZKA 4Z0HO 4LE1A 3A6PC 4TS4A 4GKJB 1RMQA 1OGYA 4MJXA 4A92A 4RMIA 1R9MA 4HVLA 2PR2A 1RLTA 1XLTA 2GYVA 2SKDA 1T2DA 4QGBA 1LLQA 1RXIA 3G17A 4QGHA 3VC1A 4E5YA 4KE9A 2YN4A 1Z0AA 1E8NA 1JAXA 2YC4C 3ILXA 5K8LA 2DWPA 2EJVA 1NUSA 2VXCA 5J4LA 4P34A 2I78A 5LSAA 1E7WA 1YRAA 5HQ3A 3MQ4A 3EG5A 9ATCA 2Q4DA 2VSNA 1ZUWA 5KDOA 2R4TA 3C2QA 4Q3BA 4B0PA 3R76A 3UA4A 1ZWLA 2OBYA 1QOZA 3UG6A 3UYLA 4CTMA 1VB5A 1YVUA 2BKLA 3OZSA 2JK0A 2IYAA 3PFHA 4GD3Q 4WN3A 1DI0A 5DBOA 4AN0A 2J3MA 3JVEA 1D4AA 2G80A 1UDAA 2P9QA 2WM3A 3HYSA 4PYIA 5FKJA 4DNOA 1JR6A 3HV2A 3K8OE 3ODPA 4LMRA 1YWGO 1JF8A 1R7RA 1EZZA 2WF8A 5DTRA 2D8AA 3LQFA 4ZJYA 4L5CA 4KB5A 4MI3A 4D82A 4DIEA 5A9SA 1SBYA 4ZYVA 1N75A 1NXXA 2MWMA 3NDIA 4HRYA 4LE2A 2CD9A 3B2NA 2PYZA 2RHOA 3LL7A 4S12A 4X20B 5DCUA 4DCOA 1E1LA 2OKGA 2TMYA 4AWBA 4E0BA 4TWRA 3QBDA 1Z4NA 3RHTA 3OZIA 3JARA 3UHPA 1JR4A 3QYFA 1NSFA 3VHXA 2V6MA 3SF8B 5LUAA 1EVJA 1E4EA 1USGA 3EIOA 4EB6A 4OU4A 3NRBA 4L27A 3R7DA 4A0RA 3AM3A 1AUVA 1U2GA 2F9LA 2V74B 5LQKA 4YJFB 5ERGB 4BO6A 5EKUA 3HQ4O 1W5BA 5EZQA 4X63A 4TV9F 4UASA 1FL9A 1NT2A 4YQZA 1PNOA 5H3CA 3TWOA 1TYBE 3FNGA 5IJAA 4B40A 3C87A 3DDZX 4NJMA 2BUAA 2ZYWX 5EJIA 3ZBQA 2C20A 3RJZA 4KAAA 5A1JA 1Z82A 2YYZA 3BTSA 3GRCA 3WYEA 4W5QA 1GLVA 2JFOA 1XZ8A 4A6XA 4X6XA 4G63A 2ZUSA 2CDRA 2M9MA 1N3BA 2WF6A 3I09A 4H0NA 3MYYA 4F1WA 5K9ZA 3HZRA 3KJIA 3LBFA 3O95A 2YWXA 2A5YB 3KD2A 3KUCA 2QX4A 2UZIR 4D4IA 1S1CA 4CG3A 4RSRA 1MB3A 2B4QA 3IDFA 1T5LA 4Z0TA 2PGDA 4DBVO 4UBLA 2XD9A 4RJKA 5EXPA 3FDZA 3RR2A 3UT6A