4F4IA

Crystal structure of thymidylate kinase from staphylococcus aureus in apo-form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
204
structure length
193
Chain Sequence
MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in apo-form
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 74
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4iA00
3JVVA 4LC1A 1G291 2JDID 3RSOA 4JLNA 1X86B 4FWIB 5TVKA 3TR0A 4RVCA 1UF9A 2AWOA 1W4CA 4NBSA 4XTCS 2J45A 2JJ2A 4A0RA 4AC9A 1OB5A 2EFHB 3KL4A 1Q12A 3CW2A 5G53C 1XZPA 1XJQA 2XX3A 4B6EA 3T5DA 1Z0DA 1P7CA 2IYLD 1OIVA 1F6BA 1VG0B 1E2FA 2HV8A 2WWWA 3GJ7A 2C98A 2HYDA 4MDEA 2E87A 4Q48A 1R8SA 2F1HA 1XTRA 1F48A 1N25A 1IY0A 1KMHB 2PCLA 1E0KA 1I4DD 1WCV1 4DT1A 1D5CA 2F43A 1EK0A 1KO8A 3OIUA 3V00A 4G5GA 1FOEB 4WZAE 2OAP1 4JBXA 1RRGA 4XWKA 1HQCA 1YZLA 1OXSC 2CBZA 2JLYA 4RFSB 2QAGB 2QSZA 2GAAA 3B13B 2E9SA 5HE9A 4K81B 3HR7A 4Q5IA 1OPXA 3RNLA 2YV5A 4W7SA 2GF9A 2DFKB 1OKKD 2QQ0A 1T3LA 3BFKA 4LJ4A 4X8LA 2W83A 3C5CA 4QOSA 4MRRA 3FTQA 1JR3D 5JBQA 5JEEA 2BBTA 1E0JA 1U0LA 1VMAA 2H57A 5H70A 2IYTA 1S1CA 3VR5A 4OHXA 1II8A 1GUAA 1UKEA 1KHTA 1EFRD 1Z6GA 2IYUA 4LBYA 2WWYA 1BMFA 1NNEA 4PO1A 2W58A 2X8AA 4JLKA 3VR4A 1W7AA 2GESA 2FFQA 1X8KA 3R7WB 4U02A 2CLSA 1R5NA 2IX3A 2BHRA 2RCNA 4HAUA 1Q1BA 2CLDX 1O3YA 3NTUA 1W5TA 1XMJA 3EZ6A 1GKIA 1LY1A 4DKXA 3QJYA 4TQ9A 4ZDWA 2V55B 2ZJAA 2UZIR 1BYIA 1NL3A 3OAAD 2WTUA 2V9PA 4D26A 2BMEA 3I5XA 2C03A 5DI3B 4P4SA 5FTJA 4C3ZA 5GJBA 2GNOA 4FI3C 4LDJA 4G01B 2ODNA 4D2IA 4DB2A 3NVAA 1QHNA 3FMOB 3SJCA 3E2IA 2RGBA 1NN3A 1A82A 4ACAA 1XPRA 3VR2A 4KVAA 1Q21A 4CIDA 2FDCA 1SGWA 4LBWA 3WNCA 1QHGA 1HV8A 4JL6A 4HLUA 3KKMA 1YE8A 4F4JA 1E1QD 1E2GA 3T5GA 1CF4A 1GSIA 3CPEA 2J5XA 2JLVA 1W4AA 3B7GA 4XIGS 5FBWB 2FFHA 3WYGA 3CRVA 5JI3E 1UADA 2FN4A 3EAQA 4M0LA 2BKUA 1XEFA 4V0LA 1QZXA 3WBKA 1I4LD 1UPTA 5TV2A 4F4IA 1CR0A 3B78A 5FH9A 4DLRA 1KZGB 1GNQA 4XVUA 3IIJA 5BN5A 1M2OB 2ZR7A 5SZIA 4X8MA 3TVTA 1M7BA 2B6HA 3W9YA 1IJFA 1TF5A 1KNXA 2JA1A 1CJMA 2ZE6A 4LV8B 5FTLA 1G18A 5JS7A 2CNWA 3TW8B 1NY6A 2BJVA 4LHXA 1XDBA 4F38A 2VHTA 4PTLA 3W5JA 1YKSA 1G20E 3GCGA 2OCYC 1M74A 3ZD6A 2H7VA 3W6OA 3THYB 2WSSA 3IHWA 3MWYW 3CX7A 4F93B 3L0PA 3CR8A 3CWQA 3X1WA 2CDNA 4KCGA 4MKHA 2ZYTX 4Q21A 5EP2A 3KUDA 4BFYA 2ZS9A 3BH0A 4I81A 3HU2A 1G4UR 3JZMA 3NC1C 4HB2A 1CR2A 4JVNA 3CRW1 3F3YA 1CJKC 2VSFA 4K46A 4CEHA 3WP1B 5TB5A 1NKSA 5F2EA 3I73A 4MQBA 4OJKA 3RWMB 2ZTSA 1KI6B 1VYVA 1X8LA 4CT4B 2FFAA 3P32A 2CVFA 2D74A 1X6VA 2ZU6A 1QHIA 1G8PA 3UWKA 4TYPA 3SYLA 3L0SA 3NEJA 3T1OA 1KI7A 2QG6A 4HLDA 3VAAA 3KKNA 3CF6R 3KQKA 4PQRA 3UXMA 1UM8A 2QTFA 5EE5B 1AKEA 1E2LA 4P0TA 4QJ4A 2RGNC 2HYIC 1JI0A 2FPLA 2KWIA 4PPNA 1TL7C 2G0TA 1HH4A 2FE4A 1OH8A 3FE2A 2HXYA 3AF1A 1GAJA 3WHLA 3KQLA 1F5NA 4P4UA 4YXWA 4BFXA 2FEOA 3SQWA 4OJQA 1T9HA 2WWIA 2VYFA 2GWHA 2QMUA 1CRQA 1QG2A 3C14C 5JHHB 4D4JA 3SJAA 3OIWA 1BH2A 1GOTA 1SZPA 1OFIA 4KSBA 3BFXA 3R7WA 1HT2E 1GNPA 3TAUA 5CYPA 4QGHA 1Z2CA 4XD7D 1MR3F 1LS6A 4JBWA 2A78A 2BV3A 1COWD 3A4MA 2GZDA 4JJZA 1TQ4A 2ASEA 4RD4A 2ZJYA 3ONWA 3ADBA 4OHWA 2IS1A 2EFEB 4KBFA 1JAHA 1ZAKA 5FUVA 4ZDIA 4ZIRB 5KNDA 3BIFA 3VTKA 1P73A 4O25A 2ZE7A 1TU3A 3RLFA 1G3UA 3EG5A 5H68A 3THOA 2P6RA 1D9XA 1MO6A 5KDLA 3HPRA 2NZ8A 3LA6A 4LRWA 5BYKA 5D3MB 1MABB 1RIFA 3C41J 4IFEA 2YZ2A 3RYTC 5EP3A 3Q85A 4MUAA 3WMFA 1P2VA 1Z83A 3LVQE 2ONJA 5E7MA 2ZRLA 2W2XA 3WP0A 3QQ5A 5FR2A 1LW7A 4F4CA 4JLAA 4ZI2A 2O8BB 4YQFA 3DOFA 1JALA 1E9FA 4RZ3A 3K0CA 2W2TA 3FMIA 2O8DA 2ODEA 4JLDA 1M6NA 4G0NA 3R9IA 1DEKA 1G21E 2OFXA 4AKIA 3X1DA 1FNMA 4IKEA 4LPSA 1GDDA 2DWOA 1KK2A 1N0VC 3EZ2A 4ZDKA 1ETUA 3Q7PA 1NKTA 4TLEA 3U2QA 4A9AA 4C0AC 3F8TA 1W5SA 2CHGA 4O2RA 2B7BA 3GJ6A 2CJWB 1EXMA 3FKSA 5GVSA 2N1BA 4QJ3A 2QAGA 2ZI9A 5KYKA 1S0UA 2PX3A 2KBFA 4WA7A 2XGJA 2QPTA 1SXJB 4RCYA 3I72A 3M6AA 3IKJA 1T0JB 3KXIA 2P3SA 1N6LA 1AQYA 1Z2AA 3JZAA 3VFDA 1SVOA 5ELXA 2UVQA 2WZQA 1KK3A 1FFHA 3L0IB 3BK7A 2AHOA 1E2NA 4Q1FA 4NYMQ 4B3CA 4TZ6A 1H8HD 1Z22A 4GMDA 4QRHA 2YC4C 1ONBA 2Q3MA 4ZI3A 4EPRA 5CJPA 1QHXA 2XJ9A 2GEDA 3DM9B 2ZXUA 3NKVA 2Z0MA 3V4FA 5AUQA 2BBOA 2G88A 4LX0A 2CJWA 3AVVA 4LJ8A 4U7DA 3KTAB 1Q57A 3CB4A 4MYHA 1G5TA 2F9MA 2QTVB 4DJTA 2NO0A 3CH5A 2VSOA 3CR7A 2ANBA 3NIBA 2F43B 3ZS9A 1S3GA 4ASUD 4CEIB 1CXZA 1YZNA 2CLCX 3REFA 2ZUDA 3K70C 1IN7A 5DO9A 2ONKA 3U3OA 5EJEA 4B47A 2OG2A 3KUCA 2AD1A 4BRUA 2GVZC 2CVHA 2AK3A 1YRAA 3FFBA 4Y0VA 2NOAA 1CBUA 2CNWD 3NBFA 1QVAA 5B2ZA 1KAOA 3EPLA 4I99A 4XJXA 1ZC4A 1YR7A 4E09A 3DVLA 3TK1A 3C15C 1NIJA 5C18A 2FF7A 1XMSA 1VG8A 4PZYA 3RC8A 3VR6A 3WRXC 1BS1A 4P33A 4HB4A 3AVPA 3IPYA 4JSTA 2KB0A 2ORWA 2WSSD 4TSFD 1GM5A 3ETLA 2D62A 2GBLC 3RSLA 4TL9A 3GLHE 2OHFA 3NC0C 2QY9A 1KDOA 1YZGA 4RD1A 2PZFA 3Q3JB 1G64A 1KNQA 1E79D 4KU4A 1HA3A 2Q3FA 3L0OA 2MMGA 4JLVA 3ZVMA 3K0FA 4US1R 1HYQA 2P6UA 3AKDA 4Z8XA 2GJ8A 1E1QA 3Q9LA 4ZCIA 1GG2A 2G83A 1P2SA 1J8YF 3F0TA 3GEHA 4KVGA 5EXXA 3Q72A 5GVRA 4M1SA 4C0JA 3CWZA 4MA4A 4HUQB 3LV8A 2ECKA 5KSZA 4IEIA 4HAXA 4Q4HB 2H16A 1Z0IA 3SYNA 4PPGA 1TUEA 1E0AA 3IDQA 4RFSA 1FUUA 2REOA 5CM8B 2YVUA 1KSHA 1ZM9A 1GIAA 2QP3A 5FOSA 1E2HA 3GJXC 4BWYA 3I61A 2FNAA 1SVSA 2A2ZA 1KDTA 3OFNA 4AIIA 1FPMA 1E3MA 4DEXA 3THWA 1AS3A 4Q19A 5G3YA 2QMOA 1G3MA 1R0YA 2O0KA 4A6XA 2PH1A 2XXAA 1B23P 2WOJA 1DVRA 2P67A 1NN5A 2ZI3A 3HP1A 3QIAA 3B1ZA 2D3WA 5EE3A 3BH6A 4YDHB 1E9SA 1W0JA 1WBBA 4BASA 3UMSA 4M2LA 5JJKA 4M4SA 1JAIA 4KYIB 4ON9A 1VCMA 4KLNA 2FGJA 2QQEA 2ZE8A 2ZI7A 3IIKA 4W5JA 3FMFA 3DKPA 3U3RA 3C5HA 4DSOA 4BE7B 1KY2A 1NVVQ 1ZUIA 3O47A 2Q3HA 1GTVA 4Q1BA 1AGRA 4GMXA 1JNYA 3OAAA 5KDDA 2ERYA 3B60A 3QNUA 4Q4LA 2J7KA 3TR5A 2ZRFA 3SE0A 4LSGA 4M21A 5DN6A 5F98A 5DGXA 4FW9A 4GNKA 3WYAA 2L0XA 5AUNB 1WRBA 2ZU0C 4BRWA 3EPHA 2UKDA 4C0KA 1DO2A 2F7SA 4M22A 1H8HA 3PUWA 3GLIB 1OLOA 4NYIR 1SULA 1XWIA 4HSEA 4FD2A 2Z4RA 4BFTA 1Z28A 3LW7A 3S1AA 2VIIA 3OESA 3W6PA 1T0HB 4NYJQ 3D31A 2WHXA 3IUYA 3QPVA 3OF5A 3FHTA 4POAA 5CIWA 3V9PA 1VIYA 3WNDA 2H5EA 4DT1B 1OYWA 2O8EB 2C78A 2YINC 1NBMD 2PMKA 1FMLA 2JAQA 1G19A 5CK5A 5GJCA 4BLQA 4US2R 3UMRA 2XNSA 2BDTA 3AV0B 1Z6XA 1P9WA 2FSIA 4IDPA 4TWZA 1IAQA 3HYRA 1X1RA 1P2TA 2WWGA 1AK2A 4KV9A 1VG9B 2D06A 4LYFA 3SI7A 2WJVA 3VR3A 1N6IA 3A4LA 1WDTA 5B58C 4UNPA 1D8TA 1JR6A 4Q9LA 4IDNA 1J7KA 1BO6A 3UG6A 4BFZA 2CHQA 2EFDB 5D3MA 1Q44A 2AN9A 2GCOA 3EC2A 3AB3A 4JL5A 1DE0A 2OESA 1OB2A 2K5UA 2JLXA 4YMTA 1KMHA 3QPWA 3ECCA 5LDDC 2R62A 3B82A 4N0DA 4Q7LA 2P2LA 1GKYA 3AVTA 2IYQA 2OXRA 1U9IA 3C8UA 3ZVNA 2G9NA 4JZKA 1G7SA 4DUGD 5LBIA 2CL0X 1RKBA 4A0FA 2HT1A 3KKPA 2ZR0A 3JVUA 2OO7A 3AM1A 4O3MA 1W46A 4NL4H 5E7JA 1P62B 2IYXA 1XCPA 3UG7A 1KIMA 4MYCA 3ND8A 5KSYA 3LBNA 2QI9C 4B35A 3E5HA 2Z4SA 3ICQB 3B9QA 1SVKA 4JLMA 4JVMA 1KKMA 2H18A 1XCMA 1KDPA 2KI5A 4URVR 5JLJA 1ZNYA 2IS2A 4II7A 2HUPA 1IXZA 2YOHA 4B3XA 4CDGA 4H1UA 1MO5A 3NXSA 2XZLA 2OLKA 2XNDD 1U90A 3QY0A 4A82A 1YR9A 3QKRA 2YKGA 1E69A 4PQYA 1SQ5A 3Q8XB 4E22A 2AXNA 5KSOA 4XTRA 5AJWA 3KJIA 4B34A 1RYHA 4FCTA 2YC2C 4XWOA 5CJ2A 1XPUA 1KO4A 4XD7A 3RC3A 3T61A 3U7GA 5LB2A 3RHFA 2A30A 3CNOA 4S35A 4JLOA 4DEYA 3BORA 3RS2A 2EVWX 4HI0E 3ZVLA 1OE0A 4OYHA 3KKQA 2BCJQ 2GXSA 3T12A 5AUPB 4M1KA 1XJCA 4LJ7A 1GRNA 3A1SA 4DLSA 2JJ2D 1EESA 2JLSA 4I4LA 5EUQB 3GLGB 2ZSAA 4OQMA 4XVQA 4ZDJA 1DAIA 2AR7A 2HF9A 5JECA 1ANKA 2BEJA 4O2LA 2ZIAA 4BFVA 2A3RA 4IOKA 2ZS7A 4Z54A 2VH5R 3QUSA 1J70A 4E03A 4KFSA 3CUEF 1AZSC 2NO1A 4OQNA 2IYYA 1O87A 4L16A 1XXHE 2FPKA 2FSGA 4KHZA 2D2EA 3PFIA 2ZQ5A 3SOPA 3FPAA 1II8B 5A0FA 4XOIA 1AGPA 4RZXA 5LPNA 2A5GA 3FHCB 3FVQA 4OQFA 2O8DB 2O8FB 3MG9A 1GVNB 4G5QA 5CYOA 5C4MA 3CH4B 1N6OA 1IM2A 1W44A 3LBHA 2PEZA 1LNZA 4DUGA 2F1RA 3K0AA 1MV5A 4HUTA 2OSBA 1OH7A 1U0JA 4IDOA 5KO2A 3GFOA 3PQCA 1XJ0A 4QHYA 4YC7A 4LPKA 5JWHA 1XTSA 3I8XA 1KI3A 1M8PA 4Q4HA 5FR1A 4EUNA 3RAPR 1N3BA 1SXJE 5K8IA 4S2EA 2JATA 5F3WB 2OCAA 1ZP6A 2ZUCA 1COWA 3R8CA 1OXXK 3SBEA 1SVLA 5DIFA 3X1YA 5JSZB 2RGAA 1XTJA 4TYQA 3B1VA 4G5OA 1FX0A 2Y8EA 3EZFA 4ZKDA 4PHTA 3VKWA 8OHMA 1VHTA 4A36A 3P26A 1R0WA 1G7TA 2N42A 1U81A 5AJVB 1CU1A 4NPHA 3AVXA 2GJ9A 1TPZA 1MO3A 2EWWA 3DMNA 1W2GA 4MRVA 4NZYA 3U5ZB 2G1KA 3BFVA 4FMCF 1T5LA 3I3SR 2HCBA 3DPUA 1JPNA 1P3JA 1UBGA 5L3QB 4P4SB 4BLTA 2Q21A 3EIQA 4Q00A 1ZD8A 2QMHA 4DHEA 1RRPA 1II9A 3NBXX 4PC1A 4L5BA 3PIRA 4TYYA 3MGCA 3KFVA 1OH6A 1KKLA 4A1FA 1E9EA 4IHQA 1L8QA 3UIEA 2VSXA 3MWLA 1DG1G 1U99A 1QF9A 2QPAA 121PA 5LB4A 2VHQA 4XWAA 4AWXA 2WKQA 4FIDA 1ZNZA 4HLQB 2C8VA 2I1VB 1G3RA 1JQJC 2NQ2C 4KODA 3IEVA 1KMQA 5C1BA 1ZW6A 1OSNA 3U44A 1II0A 3W5IA 2VF7A 3RRMA 1IJEA 1S96A 4QBGB 3HU1A 2VEDA 4EIWA 1J99A 3REGA 3QKUA 1VKJA 1TEVA 2RGDA 3NHBA 1AIPA 2G3YA 3LX5A 1ZNWA 2A5YB 3QVVA 4R2HA 3D6TB 4NMMA 4A6PA 1CJUC 1NIPA 2EWVA 4FWTA 2XNDA 3K9GA 1GNRA 4RFVA 2DPXA 1EX6A 1U98A 1F2TA 3U6KA 4A15A 1TAGA 2IF0A 4V0KA 2C2HA 2RGXA 2WIAA 4DIEA 1OV4A 4LYHA 4HZUB 4LBZA 4CT5A 2I3BA 3EWAA 3TGPA 1UEJA 4QKQA 3P20A 4Q7MB 3RRZA 2HDNB 2EYQA 1QHSA 3B85A 1N5LA 2C9YA 1Y63A 4TMKA 3U3KA 4EKDA 1VTKA 1NMYA 4L4UA 4LHYA 4URWR 3ZQJA 1KI8A 5LD2B 2ZVQX 4HAWA 3TRFA 3W6NA 1GKUB 3B1YA 4RSGA 2QRZA 2B21A 1Z5ZA 3KFXA 1KK0A 2FEMA 2ZYVX 4IXNA 4DDWA 2D7CA 4IOJA 3I62A 4TMXA 1Q1QA 2R65A 1UKYA 2QA5A 4OI1A 4DCSA 1DAHA 5HTKA 4OHYA 3KZ1E 4Q9HA 4TLDA 5BWMA 2A5DA 4QG7A 4A4DA 2F1IA 2P6NA 4Q9IA 3LVRE 2V1XA 3LWNA 4OI0A 721PA 3W3ZB 2QE7D 4AK9A 1E9BA 1T8TA 4Q4AA 4FXPA 3L8ZA 4HATA 3MLEA 4JT2A 2GEUA 1JJVA 4OK6A 5EXSA 2R9VA 1TQ2A 1P60A 2WMNB 2IYZA 2W6ID 2H92A 2R6FA 4B43A 2LKDA 5CDFE 1WB9A 1Z3IX 2ZE5A 3SZRA 1AN0A 1T8UA 1E1RA 1N0UA 1XEWY 1G8FA 3LO5A 4DC9A 3ASYA 1TX4B 2VTKA 2YNMA 5J47A 1HT1E 1P72A 2PBRA 1UBEA 4W9MC 3BRWD 4D0NA 4KITB 2YWGA 4WAUA 5JMTA 1UDWA 2BMDA 5DH9A 1KI1A 2XSZA 3H1TA 3AVUA 1YHNA 1QBKC 1YVDA 1ZM3A 2IYWA 2VLIA 4NCIA 3GLIA 1XU4A 1VECA 2PLFA 4L8GA 4DRZA 5KUTA 4UXJA 2B8WA 4ZPXA 1E4YA 3ZQ6A 4EFLA 1Z63A 4NYIQ 1HE1C 5JWOA 4C0BA 3CX6A 2NZJA 3QKSA 4PAOA 3ZZ0A 3KB1A 4NKRA 3NH9A 4NYMR 1IN4A 1NLYA 5IRCD 4JIMA 1Q3TA 1Z29A 1DO0A 1PLJA 4NCHA 4FMBB 3AP2A 4LK2A 1E2JA 1RVDA 4OL0A 4QGAA 5EE9A 2H8KA 5A4JA 3I32A 1ZJ6A 3W8RA 3GJ0A 2SHKA 1NVVR 3K9NA 2LWIA 2DR3A 2GK6A 1W0KD 4PC3A 1P5ZB 2ATXA 2JJ1D 5L3SA 4K8OA 1PLLA 1R0XA 4BLSA 1Q20A 4TN1A 1IN6A 3RANA 2ZEJA 3LQQA 4EJSC 5IK2D 3PUYA 5FOTA 2NTYC 1HEIA 1ZMXA 3K0CC 2OLJA 1OF1A 3OEHA 3PV0A 4WXPA 2X1VA 4EDHA 2GKSA 3SFZA 4E07A 1RC8A 2GXUA 3WHKA 4BLOA 3N2IA 4LUCA 4D0GA 1FL9A 4DSTA 2YHSA 3EC1A 1S9HA 3MFYA 4KI0A 4EPXA 1CRPA 1C9KA 5DN6D 5EZ6B 2R2AA 3N70A 3FB4A 3GJ8A 2YWHA 2HCJB 3B6EA 4LJ5A 2O0HA 1XCGB 2VP6A 1TUIA 2WIBA 4LJ9A 4EPTA 1BYUA 1K6MA 1KI6A 1R6BX 2ZAMA 3E70C 4Q1DA 2RGEA 3QXHA 2AXPA 4QFMA 4OQLA 4LHZA 1G17A 2ZJ5A 1XZQA 2X2FA 4PAMA 1UJ2A 1R0ZA 1WA5A 1U94A 2A5FA 1NLFA 3KDSE 5DISB 3W8NA 1MRSA 2PLRA 2R8RA 3M0EA 4PR0A 4WW0A 5F9FA 2BOVA 3NDBB 3H4MA 4TYWA 4MKFA 4Y0AA 2HEIA 2FSHA 3B5JA 3BB4A 2FA9A 2WJGA 821PA 3EZ7A 3PG5A 4RKFA 1E99A 2IHBA 2BEKA 3AGPA 1YZQA 3K70D 4DSUA 2QM7A 3BB3A 2P5TB 4FMDB 2WJIA 3CNNA 3LY5A 4Q7JB 3A1WA 2XXAB 3OE7A 2NO7A 2OT3B 2GZAA 1UFQA 3PEWA 4YDSA 1ZCBA 3L8YA 2XTMA 4M1MA 3G0HA 2IUTA 1CS4C 4IVRA 3SN6A 1U9IC 1W49A 4R98A 3IBYA 3W34A 2ZRIA 4M1TA 4OK5A 3FKSD 2NO9A 1XP8A 4B33A 1C4OA 4EQ6A 2OBMA 5JS8A 3HWSA 1A1VA 1ZM2A 2IUSA 5FOVA 3BOSA 1XD2B 3DOEA 5HE8A 1IONA 5CIQA 1C1YA 5BN3A 2OUKA 4B73A 3L82B 4ZKEA 3QXJA 4OI4A 4DLWA 2J0UB 4ERNA 2C5LA 2QT0A 2QTHA 2OE2A 1AJEA 1S2MA 2XAUA 4X8OA 1G9XA 4MRSA 4QL3A 1F3OA 5AJXA 3TQFA 4DSNA 2C9CA 2BC9A 4QGGA 2VHCA 4LYAA 4UXHA 4NCNA 3QXCA 3KX2A 2KSQA 4P3YA 2CL7X 5HPYB 1ZUNB 3VNVA 1NBME 4QM7A 4PQFA 1FUKA 4HZIA 4NONA 1W4BA 3PUXA 3ZH9B 5HR5A 3B9PA 2J3EA 4NTZA 3AF2A 2LCFA 2QENA 4B32A 1XTIA 2MMCA 3MMPA 2CMKA 3AH8A 3IO3A 4D25A 3GLFA 4RD6A 2J9RA 4Q7KA 1RRCA 4AKHA 3O8BA 2GXQA 2Q0HA 1G5RA 3W90A 4LY6A 1W0KA 3L2OB 2GHIA 2F6RA 3ASZA 1MH1A 2WKRA 3N2EA 3QBVA 2ZYUX 1EGAA 1E2DA 4DLYA 4ARZA 3CBQA 3GJ3A 1BKDR 4TQAA 2G6BA 3RWOA 1AS2A 2JIZA 1NP6A 4CF7A 1PUJA 3AKYA 2W0MA 2HLDD 4NHOA 2JDIA 1HQYE 1OXUA 4BEBA 1MRNA 5EUMA 2WAXA 2ZRNA 5FL7A 2Z83A 3OEED 2XOKA 3LAWA 4QGFA 2IWRA 1F2TB 1JECA 1VHLA 3U3MA 2XJ4A 1F2UA 2WWHA 3VU9A 1G7CA 1XXHB 3UWOA 1US8A 2QBYB 3I8SA 4D4LA 5J5CA 4EPVA 1QG4A 3BERA 4B3GA 1P6XA 2JASA 3S1AB 3ZIAA 1G3IA 1KTVA 4GI7A 3TLXA 5AR1A 4GSYA 1NSTA 3FMPB 3TSOA 2GF0A 1FQJA 2JLQA 2EFCB 4MYUA 4JS0A 4ESHA 1ZD1A 4F92B 4BPBA 1BOFA 1JEEA 2VP9A 3QOFA 1CJTC 4G1UC 2ANCA 3MCAA 3BD9A 2WV9A 3X1ZA 1EFUA 1NI3A 2C95A 4PZLA 4WZBE 2OBNA 4YONB 4AYXA 5FL7D 1DBSA 3O8CA 1PV4A 1MABA 1N0WA 2J7PD 2PCJA 1W4RA 2XZPA 3CONA 4ARZB 3H84A 3HDTA 4HYYA 4AYTA 4C2UA 3AVQA 4LWZA 2A7QA 3NBYC 1EFCA 3RRNA 4JVLA 2YWEA 3AVYA 2RKOA 3ND9A 4LYJA 1T3HA 4BZQA 5JWRA 3GLGA 1X1SA 4M8NE 5BW8A 3I92A 2WBLC 1Y3AA 3Q5DA 3SBDA 4DCNA 4TMTA 3R9WA 3U6BA 1IQPA 3CF2A 3VU9B 3TUJC 2ZRKA 4FCVA 5JZVA 3PENA 2CE2X 3NWJA 1AKYA 4ASUA 2KJQA 2AFHE 2DHRA 1ESNA 5G3ZA 4M9QA 5FTKA 4TZ0A 1XMIA 2X19A 2OV2A 1LS1A 2O8EA 4PHHA 1X3SA 4OI2A 1D2MA 3CLVA 4LBVA 4AURA 4UNNA 4QJ5A 1M7GA 4YMWA 3P4YA 4QBFA 4EFMA 1LVGA 2Z6VA 1LF0A 4W5HA 3SJBA 1GL6A 1PZNA 5HKKD 5J4YA 2J59A 4TT3A 1MKYA 1JR3E 3EW9A 3SDZA 3VX3A 5KNBA 2O8CA 1FP6A 1E9AA 3FKQA 4Q47A 4C9BA 1NRJB 4URUR 3QI2A 3ZLJA 2YWFA 1W36D 2ZSDA 4B2PA 1NJGA 4A8JA 5L8VA 3AGQA 2QGZA 3T1TA 2QORA 4D0LB 4XVRA 5ANRB 1N5IA 4Q01A 1G8YA 4Z8YA 4Q9KA 3SU8A 2W6IA 2J41A 3K09C 1PJRA 2W00A 1XRJA 2PL3A 3K8YA 1D6JA 2GZHA 1FX0B 1NN1A 2P5SA 3FGNA 3IIMA 3H2YA 4E5UA 1JPJA 4CEHB 2G0NA 4URYR 1F2UB 4C4PA 4KO8A 1CP2A 2V4ZA 1KDRA 4JKIA 3K0SA 3G82C 5KDOA 2CK3D 5HZHA 4A2QA 2DFTA 4MUBA 4GOKA 3HYTA 1KSGA 3ZD7A 4GP6A 3TBKA 3Q7QA 5FPSA 3R8FA 2GXAA 4V0MA 4GDFA 5H1YA 2DBYA 5AK0A 4PC7A 3PITA 4FINA 4MYTA 1XEXA 5DI3A 1H65A 4ACBA 2PZEA 3SEAA 1NY5A 2F55A 3CO5A 2IC5A 1UBCA 3PUVA 4PZZA 5CK4A 5DYGA 1W36C 1JJ7A 2FZLA 2IF2A 1QHYA 2MSEB 4GOXA 4JLBA 3PXGA 3GLIE 3C7KA 3U44B 3ADDA 3AF0A 5FOXA 2O0JA 1NF3A 4L15A 1DG3A 4Q4JB 1IXRC 3GEIA 1OW3B 4WIAA 3LQRA 4X8HA 4C0HA 4B6FA 1SKQA 1OXTA 1YQTA 1IHUA 3QKRB 2JLWA 4HDCA 3U7FB 1ELOA 4LV6A 3A36A 4WZ6A 1RE0A 4D4MA 1XNJA 4DZZA 4GZMA 3UPUA 3ZIAD 1M1YE 4URZR 3TW4A 5HZKA 2QL6A 3GEEA 2FPMA 2GA8A 4MKIA 3U4QA 4R7ZA 3HR8A 2VHUA 4KYUA 1Z6AA 3IPXA 4MGYR 2BMJA 2BM1A 3KB2A 1SVMA 2G1JA 1HE8B 1W48A 4PHFA 5D3QA 1GL7A 1OH5A 4M53A 1OIWA 3O8RA 1WMSA 1YZTA 3EA0A 5FUWA 2D7DA 2QN6A 3RRYA 1RRFA 1SKYE 2J0SA 2W6JD 1GWNA 3WMEA 4D4KA 3QPUA 2DWPA 4IW3B 4NDZA 2OAQ1 1W2HA 1M34E 3U7EB 2PEYA 2ZRHA 3J81k 3I5YA 1RJ9A 3BH7A 1UEIA 5K8TA 2ZS8A 1EFHA 4PC6A 3QF4B 5UKDA 3AF3A 5C2JB 3VHXA 4B44A 4C7OA 1TADA 2GDJA 1KI9A 3QEOA 5JCZA 3OZXA 3QXXA 4YXWD 4KFRA 4LGMA 1E2KA 4IRUB 3EA5A 1IN5A 1XB2A 1ZUHA 2B92A 4QNRA 4C30A 5LD2C 1Z8FA 4D82A 4IVPA 1ZM7A 2O52A 4F7WA 5L3SB 3IEUA 4YMVA 2JLRA 1IBRA 1S4QA 1S8FA 2VP2A 4JMPA 2QSYA 4V03A 4MDFA 1DAMA 3D8BA 3QENA 4RY2A 4LJAA 4UXIA 5JI2E 1SVWA 2DB3A 3TSWA 4B3DA 4V02A 1OYYA 3K9LA 1GP2A 1V43A 4BLPA 1ZCAA 1W47A 3AUYA 5CM9C 1AZTA 3SR0A 1M7HA 2OBLA 1PVOA 2D2FA 3G5UA 5J40A 3SNHA 4C0LA 1G6OA 4PPQA 2OFWA 3GMTA 4LHVA 3GJ5A 5FI1B 1QHHB 1KO7A 2XITA 3I1FA 2XSZD 2WWXA 2P0EA 4KJZA 1P9RA 2BBWA 3BE4A 2YYZA 4ITRC 2DCUA 4CVNA 3AEZA 3PEVA 2ZRDA 1T3SA 1Z0JA 1G41A 2IXFA 2JLZA 3CM0A 3FOZA 2QT1A 4UJ5A 5AUOB 2FU5C 4DIDA 4URXR 5EE1A 4OHZA 2PMDA 3KKOA 2FV8A 2AL7A 2Q9CA 3DKVA 4GP7A 4WOPA 2ZJZA 1X8JA 2QROA 2JCSA 5IHPA 2GRJA 4HAVA 4YLGA 5DSZA 1KAGA 2VRWA 2QGNA 4G5RA 1OJLA 3PR1A 1UDXA 3VKGA 5EP4A 3WNBA 2NMVA 4ZCLA 2J0QA 2HLDA 2QNRA 2F1JA 3CRMA 4QNMA 1IXSB 3TUIC 1VCIA 5DYIA 2PT5A 4DLVA 3Q5EA 2GCOB 2VPPA 5JRJA 4P31A 1EFRA 4LV5B 3ZDQA 5KTYA 3THYA 2I4IA 4FN5A 2HF8A 1L7VC 2WOOA 3T15A 1YR6A 2WJHA 1E98A 1Z07A 3CIOA 2PJZA 4Q9JA 3ZGXA 1NG1A 1L2TA 3SJZA 2Q9AA 1OKKA 3OEHD 4QHSA 1CEEA 1HTWA 1AM4D 3BC1A 3EPJA 4G3XA 2IT1A 1S3SA 4NCJA 4PSAA 3WXMA 521PA 2IYRA 5AWFC 4M1YA 1ZC3A 3KJGA 3TIFA 3HJNA 4B74A 5FBLB 1V5WA 3FWYA 1RYFA 4V0OA 1ZM4A 4B2IA 1KYIA 3VNUA 3CF0A 3GLGE 2ZI6A 1Z0FA 3THWB 4TL7A 1G8HA 3ZJYA 2FX3A 1ZD9A 4QBIA 3PJRA 1TNDA 5JJIA 3NEYA 1E94E 2KE5A 3OIYA 4L9WA 2CCKA 1KO1A 2DFNA 3TH5A 4JT4A 5JHGB 2J0VA 1SHZA 1K8RA 1T91A 4HLUC 5G41A 2NO6A 3A4NA 2PX0A 3KQUA 4EPWA 3LDAA 2GJKA 2ZANA 4HB3A 4ZV4A 5FPKA 5F9HA 3U7HB 4Q4JA 2VF8A 3E1SA 1QRAA 4HLCA 4IDQA 4WXRA 4R71A 3DMDA 1KI4A 3LH5A 3R20A 2AKYA 2FOLA 3TQCA 4EAQA 4RD3A 2MSDB 4GZLA 1FMJA 4DDTA 3MAAC 3EZ9A 4PANA 2WPDA 2X2EA 2GAOA 1ODFA 2W2VA 2AWNA 1WBDA 2EQBA 1RFLA 1SHKA 4NP6A 2VHJA 3BXZA 2ZI4A 4DWJA 1XEWX 1HY3A 1G16A 2ZRMA 221PA 4KFTA 4P32A 4RJLA 4Q1EA 1KJZA 1TF2A 1WF3A 3AF4A 3X1XA 1OIXA 2IK8A 2VP5A 1Q3HA 4MRNA 1NN0A 2RGCA 4PO9A 2QPOA 1Z47A 4AD8A 3IBGA 2ZJBA 1R5OA 3QE0A 1U8ZA 3NDPA 4ZO4A 3QF7A 1N6HA 3T1VA 1QDEA 2WKPA 3KJEA 1FTNA 4DCUA 1I2DA 2VP4A 4R9UC 2XTZA 2OILA 3IGFA 1MT0A 5BQ5A 4EQ6B 5CLQA 4TL8A 3B8HA 3H86A 4NU0A 1VYUA 2G77B 1E2EA 2GK7A 1ZU5A 2JJ1A 4PX9A 4TMVA 4DDUA 1XD9A 4DB4A 3RVBA 4AYWA 1IY2A 4IEEA 4LI0A 4DBLC 2BIFA 3BS4A 1EFTA 1NLZA 3QF4A 3GPLA 2CK3A 2J0UA 2FMXA 4QHTA 3T34A 3MWKA 3A1TA 1AS0A 1SKYB 2IS4A 1XX6A 4N1AA 5KHOC 2BMFA 2FSFA 3LNCA 3MRSA 3TNFA 1JR3A 4RZ2A 2V6IA 3CZPA 4HDQB 4BQSA 3KTAA 1G6HA 1VYTA 2VBCA 2E1RA 4R2IA 4MGKR 3QKTA 1QHHA 3EWSA 1H8EA 2OCPA 4JSYA 4OQXA 1E2IA 1YU9A 3K0EA 4XH9B 2ZUBA 1PUIA 5FBVB 1OXVA 1UAAA 2NPIA 3KQNA 2CCJA 6Q21A 3DEFA 1GRRA 2WJYA 2O8FA 1T5IA 1VCOA 621PA 5SZHB 2ZETA 1A2KC 2GBLA 2BWJA 2BCGY 1ZIPA 2RHMA 3OIVA 3QSYA 2YOGA 2ODWA 1OFTA 4UKDA 2BKEA 5DI9A 2QUZA 2ATVA 4Q02A 3AVOA 1R5BA 1N6NA 5E3HA 4FMCB 4U5XA 1I2MA 1US8B 5EZ5A 4RCZA 5FFMA 4Z1MD 2QBYA 5AJZA 5HKKA 1JXMA 3ZVRA 1FQKA 5FUXA 4HB0A 2IBMA 4JYCA 3B2EA 5GJWC 3PUZA 2EU8A 4TL6A 5E95A 2WMOB 3TMKA 2GETA 3GFTA 3WMGA 3H0KA 4JLPA 4TLBA 2QAJA 4FCWA 3QG5A 2IA5A 3BAFA 2CHVA 5G40A 1KK1A 2R6AA 2F3RA 3K70B 1VCNA 2C04A 1XEXB 3CZQA 2Z5FA 5JEDA 4A0HA 1OFUX 1FZQA 3RS5A 4TTPA 4A8JC 3VMFA 4BUJA 5B30A 1LB1B 1NMXA 2OZEA 2NPFA 1VG1A 1XBTA 1IN8A 3VHLB 1DAEA 2R44A 2ZSEA 2ZVPX 1N5KA 2AD5A 1SVIA 1RW4A 4TSFA 3A58B 3FDIA 3THXB 2LKCA 2XB2A 5L3QA 4OBEA 3BWDD 4B3FX 4EJSB 3LLUA 4B71A 2X77A 5BXQC 1YRBA 2W6JA 4TTQA 5KU1A 4PO8A 3FYHA 3IO5A 4M1WA 5C4GB 3SC3A 1Q22A 2MSCB 2CXXA 1Z08A 3OEEA 3ICEA 3QG1A 1W36B 3DDCA 2OXCA 5BN4A 2QP9X 5SZJA 1EX7A 1GRQA 1PLKA 2VO1A 3VQTA 5JSZA 2RMKA 1OT3A 2B8TA 1TF7A 1IY1A 3UK6A 1Q1EA 1WQ1R 1BIFA 1K5DA 1R2QA 4RZUA 4GL2A 3CPJB 4WBSA 1DARA 5FTNA 5E4FA 5TXGA 4GBMA 1E4VA 4YMSA 4TTRA 4KSCA 3K0FB 4RD2A 4B2LA 2H1LA 4JLJA 1N6RA 2PT7A 2ZAOA 3AP1A 4I1UA 3DHWC 3F5FA 3AP3A 5JRZA 1KY3A 4ZIRA 3WRYC 5KNCA 1ZVQA 3K09A 3MSXA 4M9XA 1KI2A 2XTNA 3GLHA 4DLUA 5L3VA 2CCGA 2D4HA 4IXMA 1CLUA 1NVXQ 1GL9B 3KXLA 1P9NA 4PXAA 1E2MA 3O8DA 5H8WA 1XTKA 1I4TD 3AKCA 5GADl 3SYKA 4UJ3A 1KSFX 2JJ8A 5EE0A 2TMKA 2C9OA 3EIHA 4TMWA 1YZUA 2C77A 5M04A 3RS3A 3T06B 3CRRA 1JBKA 3C16C 4UNQA 2FFBA 2IUUA 3HU3A 4Q1CA 4B48A 1EG7A 4LHWA 5J4HA 2V7QD 4B75A 3NH6A 4D80A 2ZJ2A 1LTQA 4EPYA 3LW8A 3LBIA 4B3BA 2FZ4A 3GFPA 2ZRAA 1NJFA 1TQDA 3A1VA 4KFUA 2ORVA 2C96A 2RGGA 2RHDA 4A2PA 4RD0A 3BBPA 1LFDB 3HPQA 1DPFA 2HXSA 5FPHA 1KJYA 4A8JB 2HJGA 4GFDA 2ERXA 2ZSBA 4LJ6A 2QE7A 3IHLA 1B0UA 1XXHA 1E2PA 3QXSA 3NBZC 1ZIOA 4Q03A 2A9KA 3U3JA 5IDVA 3DZ8A 1RPZA 1UBFA 2KBEA 2WJJA 3LRPA 4GT1A 1FP7A 4Z1MA 3LLMA 1CIPA 2IYSA 1YJ5A 4M9SA 5FUYA 1OHHD 4N3NA 1EWQA 2J7PA 1KSJA 5KOYA 1ZBDA 3B1WA 4A92A 2NGRA 5DLQC 4DCVA 2ZREA 3M4YA 3LXXA 2O5VA 1KOFA 1XF9A 2OM2A 3K9HA 1A2BA 5J4KA 5EQTA 5JFGA 1DELA 3NG1A 3EXAA 1HUQA 2ZSFA 3D7MA 1D9ZA 3TUZC 3GP8A 2AFIE 1LV7A 1P61B 3TVDA 1WP9A 1DAGA 1JQLB 2GJSA 4BLRA 1HURA 3ADCA 4CEJA 3TSZA 1IOZA 5FL3A 2QZ4A 2R6DA 2REXB 2ZPTX 3A1UA 4M9ZA 4CRWB 2V3CC 4ILEA 5CB6A 3T35A 4QBHA 4JL8A 3C4JA 4LC0A 2QAGC 2UZ3A 4A2WA 1TMKA 4EFNA 3EPKA 2R6GA 2WM9B 2JIZD 2JGNA 3GLHB 2XZOA 2ZRJA 5FOUA 4L9SA 1Z6TA 2FH5B 4I1VA 2HJVA 4IJMA 4BZPA 4LZZA 4BECA 3T1QA 4KBGA 2W0SA 1ZINA 2V1UA 1F60A 1NMZA 2BM0A 2ZR9A 1R7RA 1L4UA 3MUFA 1J2JA 3MD0A 2V7QA 2CE7A 5FPTA 5A5GA 1WXQA 5B57C 3B1XA 1E9RA 1EWRA 4H9GA 4BZXA 2C99A 3MWJA 1R8QA 2FGKA 4TMZA 1DAFA 2WPDD 1ZNXA 4MGIR 4HZUA 4LJYA 4US0R 2FG5A 4FMDF 2Q9BA 3PEYA 4D81A 2J46A 2ZRPA 4MKGA 4DLZA 2ZYWX 1S9DA 2ZRBA 4HDOB 3FHOA 3QVUA 2IHYA 4XSHA 5IF9A 4DVGA 3SQXA 3BJIC 2HT6A 3LXRA 4F91B 1VIAA 3ZYCA 2A5JA 3QEJA 1KZ7B 1Z0KA 4LOAA 2JLUA 1NG9A 5HCIA 3WY9A 3THXA 2IS6A 1S1MA 3A6PC 4IDHA 2EYUA 1W0JD 1BMFD 2AK2A 2BBSA 2IYVA 4KXFB 2NIPA 3R9XA 3OHMA 1E6CA 4TQUS 4DDVA 5EXPA 2J87A 3AUXA 1N2CE 2JEOA 1GFIA 2P65A 3AKEA 1UKZA 2IEYA 1JB1A 1CR1A 1N6PA 1LF5A 4NH0A 2AKAB 3CPHA 2Z43A 1D2NA 2YJTD 1CJVC 4CGZA 2EFGA 3UMFA 3VX4A 5JJLA 1ZRHA 4HUQA 3CNLA 4P4TA 4EJSA 1G7RA 5JCPA 2ZI5A 3GQBA 1G1MA 4GOJA 1FW6A 4MH0R 1VDZA 3GD7A 4DCTA 1NBMA 1D2EA 1ESMA 4UNSA 3DM5A 4NE2A 3SHWA 4BFUA 5L3RA 5K8UA 5EP1A 4OHVA 2H17A 1G4AE 3OFND 3W3AA 3DL0A 4QXAA 1XMVA 4AKGA 4PHGA 1AA9A 4W5WA 2O8BA 3MJRA 5CB8A 1GILA 4GRAA 3CRQA 2ZRGA 3PEUA 4BGDA 4QM6A 3GLFE 1G5PA 2IXEA 2VL7A 4JKYA 4TLCA 4GPTA 3MJHA 4CW7A 1OHHA 2QU8A 1T4GA 2WVJA 3N5CA 4V0NA 3QBTA 5CDFA 3KQHA 1R4AA 4PSKA 1P4SA 1TTTA 3PCRB 5SZKB 1J8MF 4XSGA 1AQUA 1VPLA 2F3TA 1A4RA 1DS6A 3L43A 4I1OA 1WE2A 2QRNA 1JXOA 1SXJC 1DAKA 3CKLA 4HAYA 2J1LA 4CEJB 3IQXA 1N5JA 1U8AA 2ZITA 5FPYA 1L4YA 1GITA 4NYJR 4O0MA 5FBQB 3SHFA 4PSVA 3K1JA 3X2SA 1E79A 3SFVA 3RS7A 4C0SA 2VQSA 3A37A 3BGWA 1DADA 4TT3D 4C2TA 3DZDA 1E1RD 3P1JA 4ESVA 2QMEA 1U8YA 2GCPA 4U00A 2R6CA 1E32A 1GZSA 4CEIA 2WSMA 1T6NA 1TEXA 3V4RA 4OK3A 4JBYA 1E9CA 3U4QB 2VA8A 2ORIA 2QP4A 2WAYA 4DLTA 5GJVC 5J4LA 3P4XA 2GJAA 1XD8A 3ZS8A 2RGNA 3LX8A 4BEJA 4AG6A 4IOMA 1H8ED 1Q1ZA 2ZJ8A 4TLAA 5IT5A 1E2QA 3K0AB 1SXJA 1QVRA 5FOWA 1NVWQ 3KJHA 4PPFA 4CZ2A 3RS0A 3SS8A 2ZROA 1U2RA 1CULC 1XTQA 3CX8A 1W1WA 5DHFA 4DXAA 4H1VA 4JVSB 2ZM5A 2XEXA 3K53A 4B76A 1MO4A 2ZRCA 1RJ9B 2O8CB 1NSFA 3UANA 2FWRA 1SXJD 2XOKD 5B64A 4Z51A 4BFSA 3TKLA 1A5TA 1G3QA 2GVDC 5BYJA 1K5GA 3TE6A 4JYBA 3D3QA 2CEAA 3TJZA 4UNRA 1UKVY 2Q6TA 3NHAA 1DTSA 1G8GA 5FBRB 1Z0AA 1TQ6A 3RS4A 5J4VA 3U61B 4MGZR 4IVQA 4LCBA 4AY2A 2IEZA 3PVSA 2QM8A 421PA 4Q4AB 4AKEA 3AQ4A 4C0QC 1CKEA 4PC2A 4ZCMA 4KLZA 4V0ME 3UKDA 2F9LA 4C7OB 3UATA 4AG5A 4PFSA 1FTSA 2RAPA 2GILA 5TY0A 3VKHA 1YR8A 2OCBA 4Q18A 4NCKA 3WYFA 1E96A 1XD2A 1CTQA 3QKSB 1NVUQ 2BJWA 5FTMA 5KSPA 4IOLA 2RB4A 1FNNA 4RKEA 1J90A 2DWQA 1KO5A 2NG1A 4I1SA 5P21A 1Q0UA 2DFLA 3AVWA 2CL6X 3I4LA 4WVFA 5TDHA 3LD9A 2N46A 4YMUA 3U60B 3WBJA 1P75A 5TARA 2BVNA 2OEPA 2WWFA 1P2UA 1E9DA 3FFAA 3P27A 2XB4A 3RABA 5K8LA 1A7JA 5E7IA 2EW1A 2DYKA 2ODBA 1CR4A 1Z6YA 3DO6A 1OFHA 4IFBA 4HAZA 3KXKA 3RDPA 3BB1A 4N0EA 4PAQA 4UQOA 1XFAA 1JEDA 2IXGA 2ZJOA 5CLLA 2PJRA 1N6KA 4QC2A 2GEVA 4Q1AA 1R10A 4MITA 2GCNA 2RH5A 2REBA 3M1IA 5TMPA 1RZ3A 3GJ4A 5DNYB 4D6PA 1ZYUA 1ZU4A 2V8OA 5DE3A 3VR1A 4J0QA 2WICA 2IL1A 3TAHA 1KJWA 4Q66C 4ABYA 2QEQA 5DHAA 3OE7D 3ZZUA 3EIEA 3IQWA 3EX7C 2AX4A 4OKSA 5IK2A 1MOZA 1Z06A 2DY1A 2V54A 4AI6A 2I1QA 5EXTA 2VP0A 4DLXA 4JJKA 4BFWA 2YOFA 4A0GA 2V6JA 1TU4A 1XPOA 5CITA 1E0SA 2FJUA 2GTPA 4HEJA 3ZZTA 3A8TA 5KPDA 2OFOA 3ADKA 4CYMA 5FI0B 4TYNA 1DOAA 4MRPA 2PZGA 5C46F 1KGDA 2IWHA 5KPJA 3GLFB 3EARA 3LFUA 4M1OA 5AJYA 1U0HC 4KAXA 5HCNA 2IW3A 4G5SA 3EASA 3IILA 2B7CA 1YZKA
chains in the Genus database with same CATH superfamily
4LC1A 4YA6A 1EWKA 1V45E 2X5XA 2JDID 1GZ6A 2RHWA 5IWCA 2D0IA 2UUCB 2FX5A 1GYPA 4JLNA 4P92A 1MRZA 3UGQA 1JAZA 2V74B 4L50A 5TVKA 2A4KA 1L5FA 2FEPA 1K7EB 2J9FB 3DMRA 4LQ4A 4NBSA 1TVCA 3GFQA 4RVCA 2OYCA 3S1LA 4AC9A 2EFHB 5B37A 4KYTA 2R6JA 1UAGA 3K0HA 3NTLA 3CC8A 5G53C 1XZPA 2C31A 4Q3LA 3F9RA 5DV9A 2H4JA 4ZJPA 2AQKA 1GPJA 1QX4A 1A9SA 1Z0DA 2JHGA 2K4MA 4GOND 1N2EA 4TV8B 5F21A 3DEJA 3QVGB 1E2FA 2HV8A 4K87A 3W5SA 5HSGA 4MDEA 5K3DA 1IY8A 2P9ZA 1WDWB 1F48A 1YDGA 2QW1A 2R8YA 4KXXA 1I4DD 2ATEA 4BIIA 5BSWA 3MRVA 4NJMB 3AEYA 3OPYA 4ZO7A 5DCUA 3V00A 4G4JA 1P4GA 1UP7A 4G5GA 4JUDX 4WZAE 3ABIA 4KO1S 5THQA 3PC8A 4IGEA 4PBRA 1HQCA 4L4RA 4ZU3A 1YZYA 4UASA 1RMTA 4EO7A 1GRCA 2OB1A 4RFSB 2C1XA 2O57A 2QAGB 1KH2A 2QSZA 3B13B 3GFGA 4K8RB 1KEEA 4W5OA 4IGIA 1P5FA 5HE9A 1TZMA 4K81B 3HR7A 4OHRA 2O4UX 3WMXA 4BX2A 1UMDB 1ZA1A 4W7SA 5BQXA 4OSPA 1PHRA 2QQ0A 3GEDA 3N59A 1GYQA 3UW3A 3WNZA 3C5CA 3CU5A 5BV0A 1GYRA 1Q2UA 3FTQA 1NX6A 1VMAA 1Y4AE 3VR5A 1IZ8A 2GAIA 5DTJA 3OSUA 4UQLA 1II8A 3V32A 1U5BB 3HACA 1J23A 1X7DA 3HSKA 4UREA 4YJFA 3LLCA 3D7KA 3WLKX 1DU4A 3F6CA 4ZHSA 3H65A 4PO1A 3ROEA 3VR4A 2FPIB 1NNEA 3GVHA 5BN5B 1P2DA 4Y3UA 3FHLA 3OJXA 4IYJA 4ZT6A 4ZOLB 2VCHA 4MS3A 3R7WB 5LN1A 3R76A 2AN3A 3IUEA 3QVOA 2K2WA 2PGJA 1O89A 4IH4A 4YWJA 4TV9B 4DMRA 3UAXA 1U3TA 4DNFA 5ITWA 5C52B 1GKIA 5C53B 2IDMA 4BQPA 1GQQA 1YZ3A 1HDYA 2V55B 2ZIWB 5DM60 1GUZA 2NAFA 4V1CB 2ZJAA 2YDXA 2UZIR 3VBEA 5M34A 3BMQB 1G8KA 4GBED 1QVVA 2V9PA 2ZYDA 3B2QA 3UH0A 5EEGA 4DC0A 5CU7A 3D9QX 3N87A 2D0DA 4L8VA 3G2MA 3H2BA 1CPYA 2QRHA 4REQB 2NUTA 3RSFA 1XHLA 2Z30A 4D2IA 2ZIGA 4GBJA 1KC1A 4DB2A 1B6GA 1XZAA 3HCDA 1J97A 3IAXA 3V8MA 2PRIA 4F5DA 5IS2A 3E2IA 2VUSA 1HDXA 2ZYIA 1Y5IA 1NN3A 4ACAA 3JXEA 1XMQB 4KVAA 3ACBA 4I4TF 2JRCA 3AEQB 4B17A 5IJ0B 1KZ6A 1SGWA 2QXTA 4LBWA 3N2LA 3T3PB 2W6MA 3DSRA 1NJ8A 2G08A 1I9GA 1RQPA 2XLCA 1OVMA 4CODB 1Z7EA 3E7XA 5A7HA 4BMOB 4GICA 4HLUA 1YE8A 4A1OA 1YHYA 2PGLA 1EGHA 2PSEA 3F6EX 5FLKA 1KFEB 3UCXA 3IQEA 1ZN8A 2ZYSA 4OHMA 1GSIA 4RHEA 3V8VA 1Y82A 3CPEA 3D8NA 3QRWA 2J5XA 3D2AA 3EEFA 1Y33E 3FZGA 4II2A 2BZ0A 3KT3A 1LTKA 3O73A 4BHTA 1JXAA 4H3VA 2Q3JA 3CRVA 3N05A 3RT9A 2JD0A 3M89A 3PNLA 5JPIA 5JI3E 4M0LA 2RH4A 1NW3A 4M36A 2NQTA 1JRLA 1LEHA 2BKUA 1QCYA 1XEFA 1RJFA 1H3FA 1BEUB 4V0LA 3N86A 4XIFA 1QZXA 1A72A 1VL1A 4BMNA 2X9VA 5I7EA 3RAGA 4LK3A 4M88A 5TV2A 2GK3A 4F4IA 1CR0A 1KJQA 3ENWA 5FH9A 1JIKA 1KZGB 1GNQA 1E4EB 2GNAA 3C85A 4MI6A 1AV7A 3VJLA 3IIJA 4ZCRA 2YWXA 4IMRA 4R40A 5C8DA 2PYIA 5L53A 4X8MA 3PCTA 4B0OA 2IJGX 2POQX 1J07A 3T7KA 1TF5A 2JA1A 4TTSA 1TYZA 1CJMA 2NXWA 2ZE6A 4YUXA 1OZHA 1OXMA 1XZGA 5FTLA 3IBTA 4MMZB 5JS7A 3DXZA 4MKRA 2BJVA 3TD9A 5A6SA 1LDEA 5IVDA 4F38A 1CHDA 1TLFA 4PTLA 4AUMA 2ZZNA 1BW9A 3W5JA 1YKSA 1G20E 1H3EA 4UEJA 1I0LA 4LE0A 3QUTA 3ZG6A 1CV2A 2H7VA 3ZD6A 1A2OA 1OBVA 3W6OA 2P5UA 4CV3A 4E5NA 1JKIA 4ZQEA 4KPFC 1NNI1 3HJFA 2WSSA 3D6UA 1SU4A 3CX7A 4EG8A 1XKLA 3V8PA 1XZ8A 2GDZA 3CR8A 4KCGA 3ZGOA 4FPXA 3V1UA 1J8DA 2WWRA 1EDEA 4Q21A 3KUDA 4J3JA 4PSCA 2XADA 1JEYB 4Q0MA 1MB0A 4IRXA 1G4UR 2PL1A 3NC1C 2R4QA 5DMXA 4GLBA 2VSFA 3E1GA 4K46A 4X5OA 1I9CA 3EWIA 1TCAA 2ST1A 1H9CA 3O1HB 2JANA 5F2EA 2QWXA 2Q7OE 3GUZA 3BD8A 3SLRA 3TRJA 3P32A 4M49A 3O9VA 1ODJA 5E6SB 7REQB 2WMDA 1QHIA 5EMNA 4WESA 1ZI8A 2C92A 3A6DA 3WLLA 5EJAA 1KBZA 1RABA 3M34A 2HFKA 3CH7A 1ZX1A 3NM5A 5FO1A 3AETA 3UXMA 1HSOA 3ZI7A 4GOOD 1WVMA 1YOVB 3GI1A 1ZNQO 4P36A 3LCUA 4CTJA 4E13A 4U2BA 3VNQA 1DWOA 3E23A 3WV4A 4B6SA 4LHEA 2HYIC 3N2ZB 4RF4A 1DGQA 2ON6A 1TL7C 5ALQA 4DMKA 1GGEA 4K26A 1OH8A 1GCGA 1P1CA 2GD0A 5DASA 1BEZA 1Q6YA 2F00A 4IHJA 3WHLA 1XDGA 5BV7A 1BWRA 1YL7A 1ZK0A 2O2GA 3PHIA 3AHFA 1IPFA 4I3HA 1T9HA 3TZCA 1I3NA 2LV8A 1E1YA 1U8UA 2GWHA 5ARDA 1HO3A 1DZIA 4ZZ3A 2AOWA 1Z36A 2JAUA 2VCYA 1E5QA 1NUQA 5FBZA 3OIWA 1BH2A 4XZ3A 2PKCA 3O93A 4H7HA 4TZKA 1C80A 3R7WA 1HT2E 2WAMA 5B36A 5CYPA 4QGHA 2X5NA 4IWYA 1M8JA 3L4KA 4AQYB 2YQ4A 1PQ4A 3N7TA 1XYGA 4LRXA 4MW4A 3B20A 3UJ9A 3F6YA 2I80A 3IOCA 1BRMA 3EXIA 3QEBZ 3TIIA 1TQ4A 3QVLA 4L22A 3TCXB 4CV2A 2PUEA 1GKLA 4HQFA 2ZSUA 5B3AA 1UFVA 4MP8A 3ADBA 1U04A 4OHWA 2Q8QA 1BVYF 1O77A 2VJKA 3R7AA 3WGOA 3FY4A 3UJHA 4KBFA 4ZDIA 5BNWA 5KNDA 1ID1A 2JHPA 1QGOA 4PIPA 3UB2A 1D9XA 2X8LA 1MO6A 3H2GA 2ENWA 3LLVA 2NZ8A 3LA6A 1WEKA 3OT5A 1CB7A 1RYDA 4XAQA 5D3MB 2R8OA 1RIFA 1ZOSA 2FN7A 3IAS1 4IFEA 4JDUA 3EJ6A 1SEVA 2CJPA 1O08A 3AUAA 4N4AA 1P2VA 1Z83A 2CVQA 2J3QA 3WMFA 5E7MA 1O9BA 2ZRLA 4BN5A 1RHMA 4C4RA 2Z8YA 5JNVA 1DXYA 3WP0A 2IEDA 3NXKA 5FR2A 4F4CA 3ZE8A 1LZLA 3UMBA 3N3AC 5DBIA 1RM3A 4RXMA 4MHSA 3DV0B 3FMIA 2O8DA 4BQRA 4OXQA 4HWKA 4AMUA 5EVJA 1JHZA 3D4PA 1MB9A 4GI1A 4U39A 3OUZA 5HJ7A 4G0NA 1DEKA 4BJHB 2Q6OA 1FTWA 1RFGE 3X1DA 1IUNA 1FNMA 4IKEA 4AZ3B 1GUYA 1HNZB 1KK2A 1QFYA 1N0VC 4P3NA 3T99A 5B7NA 1IJKA 1ETUA 3MWGA 2O0LA 5JAMA 4KE9A 1CC1S 4A9AA 5EMMA 3GRPA 1JG7A 1HQDA 1I3MA 3F2IA 3VTFA 5GZ3A 3USZA 4ETMA 1EXMA 1O1YA 1FDIA 1YQDA 3W7BA 4BBAA 1WR8A 4BNMA 1MDBA 2V7BA 3HUDA 3VU3A 3WYCA 5BVHB 5BNTA 2PX3A 3IR6A 1G4HA 3EFHA 4CLRA 2VJCA 1OUMA 1PJZA 3LG2A 3PQ7A 4W6QA 3WIBA 1LK5A 5F7OA 1NUUA 1TA0A 3ICPA 1MJGM 4CM4B 1CSEE 3QP9A 2FEWB 3U09A 3COYA 2HRZA 2XQFA 3JZAA 4PLFA 3E81A 5ALFA 3VFDA 4XA8A 4Y9SA 4AECA 2AEMA 2VAXA 3FTCA 4JR0A 1PS0A 4UE2A 1OZ0A 3E9DA 4OYRA 5ARBA 4YACA 1E2NA 2YYSA 3L7LA 4B3CA 4M0DA 1B74A 4QRHA 1Z22A 2M2IA 4GMDA 1VE3A 4PIMA 3X44A 3EAGA 2XJ9A 2GEDA 3BD7A 4Q3NA 4RY8A 4V24A 1PGJA 3PT9A 3R8XA 2PGDA 3PXUA 4QO7A 3KTAB 3A4IA 4LW8A 3CLTC 1JA0A 3T3NA 3KYDB 4OTZA 2QTVB 2ZZMA 3EDRA 5EN4A 3CH5A 3CR7A 3I12A 4JQSA 5IANA 3HVKA 1PJ4A 2IV7A 4ASUD 3INGA 3SKYA 1NRIA 1JHQA 5EUBA 2ZYAA 3OI7A 3I64A 3UH1A 2Q99A 1YZNA 1HLFA 2ZUDA 5DO9A 2ONKA 4NENA 4B47A 3EFOA 3I2GA 3KUCA 4Q6WA 2XYRA 4CEHA 5CDUA 4N65A 2QTRA 2AQ8A 1GAWA 3I9LA 2BMWA 3FFBA 4U2CA 1M6WA 1CBUA 1PR4A 1YJAA 2NUPB 3BMOA 4KPYA 2HM7A 1H85A 1OFGA 4BBPA 4YJ3B 1U7TA 4XJXA 3WLJA 4E09A 2A84A 3ON5A 5HKBA 3O8QA 5CFOA 4RV9A 2P4QA 5A3QA 1N92A 1XGKA 3M5DA 1NUTA 4HNHA 1BS1A 3MW8A 4R9VA 5GONA 4GD3Q 3IPYA 4XWGA 1PJQA 2KB0A 1ISHA 3G7UA 3IIEA 5H5JA 1EG2A 1ZVMA 3JAMA 5A2QA 4CMEC 4JQZA 4WEOA 4JIGA 5H9VA 2OHFA 3DL2A 2H31A 5DM2A 5JVDF 1JHMA 2APJA 1FCJA 3LBFA 4RU1A 1ZG3A 2GM5A 4QXRA 2WD8A 2B30A 1F1JA 1N2SA 4RD1A 3Q3JB 4AF7A 4A3SA 5JD4A 1E79D 5B4TA 2R4TA 4QWMA 3SLKA 3KU4A 2X3FA 3HO6A 3KTDA 4E1BA 2JH8A 3K0FA 4DM7A 5IBRA 5K3EA 1WCWA 3VYSB 1TK9A 4F3RA 1GG2A 4PNHA 2G83A 5GVRA 1N3YA 4KVGA 4PX3A 5ES4B 3Q72A 4BY9E 2AFIB 5JSUA 3OM0A 3TRDA 3N8KA 1GNVA 4HUQB 5C35A 1AZLA 4GVPA 5KNLA 1JE0A 4J0DA 3E4CA 4Q4HB 2A0WA 3G5AA 1G66A 3BXXA 3O4IA 2OK8A 3VH3A 3RVDA 2G28A 2HDOA 4GI3A 1FRVA 4P54A 1EJBA 3TFQA 2REOA 3TMAA 4CCSA 1E0AA 4FHZA 2EKLA 1E2HA 1YC2A 3USES 4JGIA 1TAQA 1V48A 5M5BA 5F2KA 4DEXA 3THWA 1AS3A 2WI8A 3G49A 3DMFA 1R0YA 5G3YA 5AHOA 3DO5A 2PH1A 3KQHA 4QPPA 1P9OA 1FF9A 2IIQA 2I3DA 3NANA 1YUBA 2P67A 2ZI3A 3QIAA 2JFUA 2L2QA 3EGCA 6REQB 2IHVA 1VPVA 3EWNA 3DDNA 4U6SA 4YDHB 3ROZA 4B6GA 4YMHA 1ILEA 3OOEA 2GO7A 5T3YA 5JALA 3ORHA 4G0MA 4MV1A 5ESXA 4FNMA 2QD3A 1A9TA 1NVMB 5DNAA 2ZE8A 2H63A 3FYSA 2ZI7A 3NGXA 2HSEA 5GZ6A 3DKPA 4YN3A 4BE7B 4CM8B 5LIPA 2VH2A 3FSGD 2Q3HA 1WB6A 2HMVA 1YB6A 2QLMA 1AGRA 2PKEA 3O47A 3R41A 4I6GA 1M33A 2ERYA 1I1OA 3FIJA 4A8TA 4MUEA 2ZRFA 2B99A 2HGZA 1VDMA 2XUZA 3HJAA 5EXDA 4ZAZA 2AB0A 1THMA 4GW3A 4M99A 1VBFA 5KI6A 5DN6A 3FI0A 3NDRA 2Q46A 1S7CA 3I30X 4QJBA 3PXXA 1R4MA 4RH3A 3LKDA 4D9KA 5LQRA 4DANA 4J03A 2WILA 4C0KA 5A4FS 3BICA 3C3CA 4M7RA 5JIBA 1W9MA 4TLMB 2JK1A 4NYIR 1ZLYA 4CMJA 1ECCA 1PR5A 3U7IA 2FLWA 3LW7A 2W70A 4HPJB 3RIMA 1GZUA 1X1EA 4MUYA 5JXHA 4E4RA 2WHXA 1AU9A 4ALMA 4Z2AA 3OF5A 4MP3A 4YRPA 2XCIA 2H1SA 5CIWA 4DT1B 2H5EA 4B3HA 1E3TA 5AOVA 3M9WA 2O8EB 2LR0A 2YINC 4AY4A 1GTSA 2GR9A 2HR1A 1G20A 3R7LA 1FMLA 4JT9A 5A02A 2VXBA 3PXCX 3Q3HA 1RQ2A 3UGKA 5HQTA 3I1JA 4E2ZA 3DNMA 1MVOA 1CF2O 5JJCA 3CF4A 2EJWA 1Z6XA 2G71A 4MNTA 2AXEA 2FSIA 5EKDA 4IDAA 2A0KA 3QU2A 2D06A 4IIUA 2O59A 3VR3A 2JJMA 2AE1A 5ALSA 1H4SA 3A4LA 1DC3A 8ABPA 1I4WA 5DP2A 1J21A 3EMDA 3KB8A 4B7CA 4HDSA 4Q9LA 4PN3A 3CPSA 1GGNA 3RHTA 4BFZA 4KQ2A 4OX9B 5D3MA 3U4HA 3M1YA 2R25B 3AB3A 5K3BA 1J0AA 4OM7A 4G6ZA 2VDLB 4CMHA 3V8BA 4ALLA 3WGMA 5K01A 2JLXA 2B20A 4K9OA 4UAJA 4DWOA 2JCXA 3H1EA 2W4MA 1DBWA 3JYNA 4Q7LA 4DEVA 2WC1A 3PQFA 1VBKA 5CLGA 3AVTA 2OXRA 3C8UA 2DUWA 2G36A 2X0IA 3TOSA 2G9NA 4HDSB 4JZKA 1G7SA 2PWPA 2X1LA 2XVZA 2PLWA 4A0FA 5K2MA 2HT1A 1Z5GA 2I71A 2WD9A 3NBUA 2BEWB 3TI9A 1HEUA 2OO7A 4K6OA 3ZCUA 3R3HA 4QOJA 4O3MA 3AM1A 3H3XA 5E7JA 4ZV9A 2QD5A 2R8PA 2XCQA 3LDUA 3ND8A 2QI9C 4NVRA 3E5HA 1HE2A 2MSWA 3A6JA 1SVKA 4JLMA 2VWGA 3G2NA 2G7ZA 3V33A 1X3LA 2ZAGA 3L5OA 1ZNYA 1H22A 4II7A 3QW2A 1YB4A 2HUPA 1IXZA 2QD1A 3HCBA 4RHFA 1BMQA 2DRIA 2O2EA 4CDGA 4H1UA 4EMSA 5CGZA 3EULA 4OXNA 2P9FA 1YR9A 3QKRA 2RKBA 4ZU1X 4BYMA 1J8VA 1VSTA 4GZ6A 1A3CA 4JAVC 1DWUA 3MS4A 3S7ZA 2YW2A 4FCTA 2ZSJA 4U7GA 2XCTB 4EY4A 3ZQUA 5IN4A 1O6BA 5BNZA 3IUQA 4XD7A 3RC3A 3QMPA 4L5YA 4EEKA 3RHFA 2ZT7A 1QDUA 4D8YA 1EIZA 2ZSKA 1NQWA 5IDWA 7MHTA 1HKHA 2DTXA 1OZGA 4YJFB 5E4JA 1HZZA 3WB2A 2G4CA 4GQAA 4HI0E 3RSCA 4L76A 3KKQA 1OC4A 2GXSA 3LTEA 4B40A 1U4SA 4M1KA 5T6MA 4CKCA 1OZFA 3A1SA 3GNLA 3LOUA 5E6SA 1C0PA 1QV6A 2I6GA 3C74A 1AHIA 1AQ6A 3D8UA 3R09A 4LRYA 5JNSA 5MN6A 4MICA 2HRBA 2ZSAA 4XSVA 5ESRA 2N9UA 3VKGA 2BGLA 3EUAA 5AVXA 3Q9UA 5M2QA 1WZCA 3RUFA 2X7JA 3UFXB 4UBLA 4IOKA 5C1PA 2ZS7A 3NJRA 4Z54A 2VH5R 1E5LA 2LZ0A 3QUSA 3VPGA 2FMTA 4FE3A 3GJSA 4E03A 1EIWA 1BKSB 3OJLA 1AZSC 3DEAA 2NO1A 1QH1A 3ZCPA 2IYYA 5F33A 5AW8A 2ZB7A 2FPKA 3I4FA 4KHZA 3D3JA 3AB7A 3RBAA 2ZQ5A 2C84A 3SOPA 2OORA 1RM4A 3FPAA 3FNBA 5LPNA 1AGPA 3QPCA 4KBYA 1JMYA 4F2GA 4GWKA 4OQFA 3GGOA 4HYQA 3JWEA 2R66A 3IJEB 3MG9A 1SUEA 1P9LA 4YP0A 5CYOA 5DHTA 1MZVA 2PTHA 5ALGA 1IUKA 3FLAA 1W96A 4E5MA 2ES4A 3GGCA 3TLGA 2FQWA 4NZ9A 5J9FA 1FBNA 3R7SA 1Y8AA 3L06A 1PGPA 2JH3A 1U0JA 3JQEA 3ESXA 4WL0A 1UODA 1EDOA 2E7ZA 3DVAB 3PQCA 4QHYA 5JDCC 1SXQA 4ZOBA 1IQRA 2ZBUA 3I8XA 4Q4HA 1B3BA 1DKUA 2IU3A 2YWBA 2Z1DA 3PF9A 3WLIA 4D6YA 3IPAA 1TTQB 5D6OA 2G1UA 3RAPR 1SXJE 4DSUA 4E14A 3HLTA 2OCAA 3GJTA 3KSUA 4NPAA 4F46A 3R8CA 5A04A 5LP6C 1T2AA 3QELB 1FYVA 3GFVA 5FHQA 4LE1A 4I9UA 4RSMA 5SYMA 4G5OA 3QJGA 1KY5A 1VHTA 3OD1A 3VR0A 3P26A 3I5UA 4S1OA 3M83A 4BMZA 1DT3A 5J2UF 4CMGA 2N42A 3U7QA 5AJVB 1FYWA 1CU1A 3F6PA 1X1AA 3DZJA 1A4UA 3PPVA 5JBIA 1T34A 5KQRA 1W2GA 5LXTA 1K2VN 1TZJA 3BFVA 2C3PA 1YB7A 4OHCA 3I3SR 4PCAA 1GCUA 1EPUA 1VXRA 3BVPA 4D8TA 1H2AS 1UBGA 1P3JA 3DPUA 4ZYVA 1VMIA 2XUIA 3F1KA 3RUAA 2CNNA 3BEDA 2Q21A 4GR5A 3P0FA 4MEJA 1CUSA 3TTVA 5HK9A 3RSSA 4FFBA 2QN2A 4RVOA 4CHTA 1BU5A 4OMUA 1M1XB 3PIRA 1ADFA 4GQIA 2R2GA 4AKSA 1OH6A 1NT2A 1KKLA 2O14A 1P3DA 5TX7A 4A1FA 1E9EA 2CXTA 4L6CA 1DCTA 3G8YA 5B7QA 3S70A 2PRSA 3KNZA 1X7WB 3VPCA 3WLFA 2VHQA 4AWXA 4DLBA 5FWXB 1ZNZA 2MDTA 4HLQB 1E3QA 5JZSA 1JQJC 4HGOA 3LM8A 4AO7A 3KOMA 2P9EA 1K4YA 5TVGA 4H0FA 3QYJA 4ZI7F 3W5IA 3U44A 1WXFA 2HKIA 1AOXA 3HU1A 2XQKA 2CXPA 3ZK9A 5ADWA 1VKJA 2FN3A 3OTQA 2RGDA 1ECGA 1AIPA 4WN3A 3ZV4A 1A8PA 5A5VA 4EHDA 3IPLA 3D6TB 4NMMA 4Q3CA 3VU8A 2PUJA 4R9RA 2EWVA 1NIPA 3E9RA 2XNDA 4CM9A 1VE6A 5HQ3B 4F86A 4GVLA 1KQOA 3DLCA 4FZVA 2BEVB 1JQBA 4A15A 4DIEA 2RGXA 1IBMB 1Y6JA 1PZGA 4JITA 1JH8A 2RBKA 2NN3C 3CEPB 3BM5A 2QRVA 4I5GA 3MA0A 4CIVA 4CT5A 3ZEIA 4QTUB 1LWOA 3ZBUA 3TGPA 1UEJA 1H6BA 1C9MA 4YJ2B 3RRZA 4EG5A 1L1RA 3DKRA 2IZZA 1CZLA 1SCKA 3B85A 4PW0A 1N5LA 3U3KA 4EKDA 2VDNB 5LDGA 4V3CA 1NMYA 4L4UA 4LHYA 4M9UA 1P2FA 4URWR 3VH1A 3R6LA 2EFYA 2JKVA 2AA3A 1IMJA 2DWCA 3NHSA 4HAWA 2I2AA 3KV3O 3W6NA 3JWJA 1GKUB 3NCHA 4YCJA 2GHQA 3INNA 1Z5ZA 4DV6B 3C3WA 4DILA 1IRIA 4Y1EA 1KFCB 3IOEA 1Q1QA 5JTUA 1GFZA 4DCSA 4ER3A 1HRDA 1U8EA 4EZIA 4E5VA 1GPH1 5HTKA 2B3DA 3BZUA 5DBOA 5HEKA 2PE5A 1FMTA 3LHIA 4QG7A 4KQJA 3DAOA 1PZHA 1PR1A 4FYVA 1E1LA 2P6NA 3DEZA 2C5HA 3CUTA 1LTHR 2UZ1A 3KHTA 3H13A 4Q9IA 3O4RA 5A3VA 2WD7B 3OQOA 3MWDA 2V1XA 3DE6X 2GNPA 2XMSA 1SWWA 3ZIDA 1AUVA 2E48A 3W3ZB 4F72A 3EEOA 1E9BA 1XQXA 2MYNA 1JKJA 3F74A 3HQ4O 4FXPA 4J1QA 4JT2A 1DQRA 5A7FA 4KK3A 2WHYA 5A2GA 3CKKA 4X92A 3QFHA 2R9VA 2HQOA 4YJGA 4X7BA 1P60A 4H6PA 2H92A 2HLHA 4LXUA 1AHHA 3C6MA 3PNKA 3SZRA 1FTGA 1Z16A 3WR5A 1D0SA 4QO8A 2W8BA 2DR0A 5JR3A 1XEWY 2IP1A 4XGQA 4D3XA 4NECA 1TX4B 4HADA 5LOVF 1J00A 4FMPA 3ZXUB 5J47A 1REQB 1HT1E 3KOYA 2FG7C 1O97D 4I4IA 1DJQA 3F7MA 1P72A 2D5IA 3FNEA 3SM9A 1RZRA 3L6BA 3BFPA 5D3KA 1DTWA 4KITB 2SKCA 5GP1A 1UDWA 2BMDA 1NVGA 2W7TA 2B5OA 3I6IA 4FYHA 5CXSA 3ZU5A 4TV8F 4CFSA 3DBHA 1YA6A 1QBKC 2VLIA 1FVXA 1LVHA 2NV0A 2VZ9A 3PICA 3QVMA 1VECA 2PLFA 3NYWA 4PLHA 3A3NA 4UUQA 4N3AA 3N6RA 3ZQ6A 4AJOA 3CT6A 1HE1C 1U8CB 3Q87B 2I8LA 1ZAYA 1E0DA 4BNTA 3WL3A 5AK6A 3QFSA 2DFVA 4D9GA 4JIMA 5TMDA 3TLMA 1VIDA 4YH1A 1TGVA 2HA5A 4TKVB 4DQLA 1ZL0A 1R27A 4NCHA 1I51A 1Z45A 2G8NA 3NUGA 3OZGA 3KUXA 4FMBB 4QATA 5LLSA 4OL0A 2O3JA 2Y0BA 3E3AA 2HSDA 5A4JA 3I32A 2YZKA 2V6BA 1MMFB 2IYFA 1RZUA 3GJ0A 1SUDA 1NVVR 2BJHA 3DWGA 3MB5A 4O4HB 2DR3A 2GK6A 1OOEA 4YJHB 4YASA 3SCZA 4YLYA 2QN1A 4UC0A 4K8OA 2HA3A 1R0XA 1TMOA 5ALXA 5F52A 4AUEA 4C4SA 5AIBA 4TN1A 5FQOA 1IN6A 4IDBA 1X1BA 1SU8A 5FOTA 2NTYC 1IHDA 1MA3A 1LLCA 5EGNA 3ESQA 4FFVA 3V46A 3OEHA 4ARBA 3FAZA 4KIUA 3TTSA 3RJMA 1W9HA 2X1VA 4IIFA 2GKSA 1RC8A 1O5TA 2H08A 3L1HA 3LOPA 5E38A 2HUNA 3ERCA 3QBEA 3G0IA 4D0GA 2WKSA 3I9V6 3ZHCA 2GCIA 4DSTA 3DCYA 1E77A 2P4UA 2VNJA 5JJ5A 2F8SA 1S9HA 3FGZA 4M0MA 1ID8A 2WDPA 1CRPA 1C9KA 1YS4A 2D1QA 2VC2B 2VPIA 3DR5A 4H17A 3GCDA 4XGRA 1RT9A 3H9BA 3L8GA 4X6YA 4X00A 3AR4A 2P9HA 3AL0C 2RGYA 1TUIA 2AZMA 2WIBA 4G5XA 4AZTA 2H4HA 1R6BX 1UJBA 5AI4A 1ZGJA 1DKOA 5BSHA 4IMPA 4OQLA 1N2HA 3GBVA 2QTMA 5IP5A 3B6MA 3HUFA 2LP4Y 4LHZA 3UGJA 1R0ZA 1KDZA 1U94A 3IE2A 3KDSE 3PX2A 4B85A 3GG2A 4EYKA 3TX6A 1NP3A 5F9FA 3CMMA 5IG2A 1E2UA 1ZK2A 3TSYA 1QOZA 3V4PB 3WFIA 3AFHA 3BB4A 3F5SA 3QFTA 4D3SA 4EHFA 4U2FA 1U8XX 1YWGO 3AFIA 5HDQA 1LBEA 4BL5A 2ECOA 3V1KA 2QPLA 1Z2NX 1YZQA 2FQYA 2WZDA 4PV7A 4RX1A 1WUJS 2QM7A 2RHLA 3QK7A 4PGMA 3T9FA 2Q5CA 3EQ2A 4G36A 4E94A 3IDFA 4Q1VA 2GZ3A 3LY5A 3CHYA 2XH8A 3A1WA 3PLAE 1WNTA 3CEHA 1XLWA 3CKMA 2DTEA 1UFQA 3QV1A 3ETGA 5FRDA 4F6LA 2X58A 1K98A 2YJNA 3IAM1 1JQDA 4QASA 1G2OA 1MDFA 1RXYA 2J3JA 1D8AA 4M1MA 5L51A 2VNAA 1QIEA 1CS4C 2CFOA 2QUKA 3SN6A 4R05A 4BJ1A 2YICA 3DXXA 3PC3A 3S99A 4COOA 4GKAA 3WZMA 4F1KA 1QQAA 1E4OA 1UXHA 4MW1A 3SBXA 1J5XA 5C8YB 1PFUA 3JU3A 4WLOA 1YB5A 4OK5A 3IMEA 3QMVA 1XP8A 3GB9A 4N47A 3WK5A 2RHRA 2PL5A 1WZUA 1WCYA 4D8WA 3AKZA 4L8YA 3M2TA 4QULA 3T3GA 2Z6AA 3UAWA 2HRQA 1ZM2A 1N2XA 2IUSA 3DOEA 4IIHA 2H06A 5K0FA 5BN3A 1A69A 3D3NA 4QRDA 3BMXA 2AOUB 3ME5A 4ZKEA 3SQMA 3ZLTA 1X39A 2AC7A 1IK4A 1GQ2A 2NZYA 3C1UA 3R74A 1IU9A 2OE2A 1WABA 5ITZB 1AJEA 1S2MA 3GDFA 4X8OA 1HR0B 5EMJA 2AEEA 4EY3A 1NW5A 1NYQA 2C9CA 4ND4A 3HVRA 1CUCA 4YK7A 1B8OA 2VHCA 1EB8A 4Y98A 2ODTX 1PJAA 1XZNA 1NT4A 3G85A 3GT7A 3OLVA 2O20A 4FYIA 3IQIX 3FLEA 3PSAA 1CJCA 3QEMB 5EG5A 5IXSA 2J5KA 1U9ZA 3I0ZA 3VNVA 4JC8A 4QM7A 2J30A 4HZIA 1A0OA 1XQ1A 1ORHA 1EDZA 1WMDA 1N32B 3P2YA 3PUXA 3ZH9B 5ITZA 1EM8B 3SFTA 2BM8A 2LCFA 4HCJA 3QLVA 5B6JA 2NU8B 3QA3E 1XAHA 1W88B 4Y2JA 1ZOIA 3AH8A 3MBKA 2ZSIA 4BVAA 2Q5HA 3DV9A 4Q7KA 1KEUA 1E3DA 1P19A 1J0EA 2ZOSA 2B2NA 4YAWA 4NZPA 3RG8A 3SYMA 3G1WA 3WZLA 4EA7A 4JI4B 2QMYA 2Q0HA 1G5RA 4GHWA 4PF1A 4I2VA 3Q1LA 5LXTB 2FE1A 4JX9A 3AG5A 3PFKA 1SZDA 4Z9BA 2ZYUX 3ZBPA 1EGAA 3OFSA 4EA6A 1U4NA 2JD1A 2C61A 4ZK2A 2ISQA 1QG6A 3BSYA 1CYEA 1JYEA 1QUEA 3RWOA 1AS2A 2JIZA 1PO7A 1NP6A 3LS2A 1NTRA 3UT5B 2QTVA 3IR7A 1U2GC 3AKYA 3JCZA 1E1KA 5IM4F 4MUFA 4NHOA 2JDIA 1T2EA 2R11A 3ID6C 4OH1A 4J91A 3AY3A 2QRKA 3PGXA 4INZA 1TYDE 4F96A 1VGRA 2ZRNA 1UCFA 2XY4A 3B7PA 3D6MA 3F98A 4LRSB 4MXDA 1NF8A 5TMBA 4ZFNA 2FPWA 2LUOA 4BQEA 1KPGA 1XXHB 1JVNA 3UWOA 1I8TA 3C87A 5B6IA 1YBAA 3PUKA 4X95A 3MWEB 1QG4A 3BERA 4RMHA 5J5CA 2JASA 4ER5A 5ALMA 3DVRX 2FVXA 4MUIA 3PUIA 3ZE7A 4GI7A 4RAOA 2BTQA 3I6BA 4QUKA 5ADVA 2AKEA 3EF0A 2JLQA 3I09A 4MYUA 2EP5A 3CZ4A 4P93A 1BXRB 2QN8A 3RC9A 1A27A 2OCXA 2GSWA 2BMVA 1BOFA 1SZCA 4AJ1A 1CJTC 4MUKA 2FAXA 3ROPA 2WV9A 2CFCA 2C95A 4WZBE 1FNSA 1B2RA 5FL7D 3DB1A 3HP4A 3I37X 4QYXA 2IZOA 1PV4A 1F0PA 1J8QA 2CUTA 3WL6A 1MX5A 2DLCX 3V7FA 4HYYA 2HWUA 4LTDA 3NBYC 1D6NA 4PEVA 1EFCA 2ZBQA 3ZTWA 3KPJA 2DCMA 4RHTA 5ALNA 4YCSA 1JH9A 2IHNA 2HCFA 1Y81A 3BDVA 4BZQA 1YO6A 5ALDA 4JEHA 4ZZIA 4DCNA 4KQ9A 3ROTA 5CCXA 4RL6A 1HC7A 2DX7A 4J6EA 1ZHOA 2ZRKA 4O1MA 3BT7A 1Z37A 1JU3A 3JZFA 3NWJA 4BDSA 3MGKA 3MMXA 4ZVSA 4EVSA 4L78A 2HBRA 2XD4A 5FYQA 5G3ZA 4M9QA 5F1PA 4BAZA 2ZFUA 4BJ3A 5DP1A 3M1LA 4X7PA 2O8EA 2I7CA 3R24A 4DJ5X 4HR7A 8GPBA 4OQ4A 3FAKA 3ZNQA 4YMWA 3WWOA 4QBFA 5G4KA 2D5LA 1FXWF 9ABPA 1C8VB 1RHKA 1GL6A 4IX9A 4HGYA 2FX2A 5HKKD 4WUVA 5LZ8A 1TDJA 4B84A 1XZEA 4N3GA 5LWQA 2A9FA 5LDHA 3F5MA 3QTTA 1XRMA 4B80A 3NDIA 5K2OA 2LIPA 1EJ0A 2ONZA 1E9AA 1YJQA 1X94A 3M1AA 4C9BA 4URUR 4NBKA 4KN6A 3V3KA 1RZVA 2GM9A 3DZGA 2J67A 5IEBA 4B2PA 1XAGA 4FEYA 4OQDA 4C1BA 1G0NA 3KZVA 5K20A 3T1TA 3RD5A 1CZOA 4XVRA 4D02A 3CMCO 1KDYA 1VIMA 2RJ3A 1JDPA 2HEGA 2WPNA 3ZWMA 4OXXA 3T0FA 4Q9KA 5CVUA 2RCYA 4MV3A 3L49A 5CT9A 2KHZA 3ORSA 1YFLA 4XR9A 5BQFA 4MVJI 1PJRA 4HWSA 2EJCA 2PL3A 3HDVA 1R74A 1ZJWA 3BQNB 4GKVA 3ZWPA 2GBCA 1EVYA 2KLHA 2FPPA 5D87A 4E5UA 1JPJA 1EBBA 1PZFA 3H8VA 5BV8A 2XWPA 3D43A 4TTJA 1LDMA 1C3LA 4IYRA 1KDVA 7GPBA 2FW0A 2Q4RA 4BQNA 2EOAA 3MS2A 2PRKA 3GNSA 4YAJA 4JN6B 4AMYA 2BP7A 3U39A 5DSXA 5HZHA 2NAPA 4HV4A 4G0YA 2P1DA 2DFTA 4GXNA 1Z13A 3D4LA 2VRBA 1E7WA 1LQTA 2Y68A 3PNMA 4X44A 4N5IX 4Y2YA 3U9LA 5E6UB 1TKCA 1QRRA 3RYCA 3HL4A 5F3RA 2NVUB 3ZE6A 3FUUA 3ACCA 1XF1A 4F97A 2WSLA 4NFLA 2VPWA 1LJLA 1UC5B 1PJTA 3D6FA 1FLAA 3GPBA 4IS3A 5H1YA 1L3IA 5AK0A 2FMKA 2VBIA 1O8BA 2VRCD 5FV7A 4D45A 1FRNA 1X7XB 4BBJA 2WLSA 3GJRA 4MYTA 4PC7A 2X5KO 4ENRA 3P0RA 2PZEA 1LU9A 1NY5A 3B70A 3P52A 4X6LA 2CLFB 2QTLA 1UBCA 5AKLA 4PZZA 5DYGA 4C7XA 2G4LA 3RUIA 1W36C 1JJ7A 2FZLA 3SVZA 5JISA 2IF2A 1QHYA 4GOXA 1LPPA 2PPLA 1Y8ZA 1VE1A 4JLSA 4WLEA 1KETA 1WW3A 1NF3A 4L15A 1N8SA 1NRWA 4ZOCA 3NJ8A 3SLGA 5EOVA