4FONA

High energy remote sad structure solution of proteinase k from the 37.8 kev tellurium k edge
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Macromolecular Crystallography at High(er) Energy
rcsb
molecule tags Hydrolase
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4fonA00
1SVNA 1YJBA 1GT91 1T1GA 2Z30A 3TECE 3VV3A 2X8JA 3GCXA 4M1ZA 1SUEA 3BGOS 3WHIA 1PTKA 5JXIA 1SN7A 3BX1A 3DDZX 4JP8A 1SBHA 3I34X 5B1EA 1SBTA 1THMA 2W2QA 1KDYA 5FFNA 5K7SA 1SCNE 2V8BA 3AJ9A 1ST3A 4Z2AA 3I37X 4OV6B 3DE5X 1NDUA 4C3VA 2P4EA 2WUWE 1TM3E 2PKCA 2SBTA 3VTAA 1TMGE 1C9MA 1SIUA 2IXTA 2QTWB 1Y1KE 3F7MA 1Y34E 1Y33E 1Y9ZA 4WOCA 4H6WA 4LVNA 3VYVA 4AKSA 5AVKA 2XRMA 1YJCA 3PTLA 4H6XA 4J94A 1C3LA 1SCAA 1YU6A 1T1IA 1JEAA 3EIFA 2GKOA 5ARBA 1C9NA 2DP4E 3D9QX 2WWTA 1SBCA 1WSDA 3F7OA 3DE0X 1Y3FE 4DJ5X 3SQOA 1WMDA 3LPDA 3WIUA 3VV2A 1SUPA 1GCIA 4KG7A 3Q5GA 1SPBS 1WMEA 2SNIE 5FBZA 4CG0A 4DWWA 5JXGA 5FAXA 3DVSX 1TM7E 1Y3CE 2G4VA 4KB5A 4HVLA 2IY9A 4WOBA 1P7WA 1KE2A 3LPAA 1AQNA 1AK9A 3CNQS 3EDYA 1AF4A 1VSBA 2ST1A 3A3OA 1TECE 1R0RE 1TO2E 1TO1E 1SIOA 1BE6A 1Q5PA 1SBNE 1P7VA 2ID4A 2W2OA 1SCJA 1EGQA 3F49S 3L1KA 3PRKE 5B1DA 1KE1A 1NDQA 2X8JB 2TECE 3T41A 3SICE 1GNSA 1S2NA 1SUBA 1Y3BE 4CFZA 1Y48E 2Z56A 1R6VA 3AFGA 2WUVA 5CW1A 5AMXA 1WVMA 1ZVKA 1ST2A 4ZOQI 4YN3A 5JXHA 1BFKA 1BE8A 2W2NA 1SELA 2SICE 4FONA 4C3UA 2DQKA 1OT5A 1WMFA 5ARCA 1KDVA 4DZTA 1SUDA 1R64A 3TI9A 1BFUA 1OYVA 2DUJA 1C9JA 1CSEE 3H42B 1AV7A 1SBIA 2PWAA 1Y4AE 4K8RB 1KDZA 3DW3X 3OSZA 5AQEA 3A3PA 4NMXB 5SICE 5JXJA 2B6NA 2ZWOA 2WV7A 1Y4DE 4AKTA 1TM1E 1PJ8A 1GTG1 3D43A 2Z2XA 1SCBA 2SECE 3DE3X 3GCWA 3P5BA 4MZDA 1MEEA 1TK2A 1BH6A 2HD4A 3ZXYA 1LW6E 1SH7A 1GA1A 3DE6X 4LVOA 4ZARA 3EE6A 1DUIA 1GNVA 2ZWPA 3DVRX 3GT3A 1EA7A 3DE4X 2ID8A 3DE2X 2PQ2A 1GA4A 3HJRA 1AH2A 1DBIA 2PYZA 3DE1X 3QFHA 3I2YX 2E1PA 2Z2ZA 1AVTA 3QTLA 4I0WB 3VSBA 3WQBA 4NE9A 2PRKA 2PWBA 1V6CA 2Z57A 3UNXA 5AVJA 2PMWB 4OMDA 1AU9A 1BJRE 3VHQA 1TM4E 1TM5E 3WIVA 1T1EA 4B5LA 1V5IA 3A3NA 1MPTA 1OYOA 1SIBE 3AJ8A 1ZVJA 3DYBA 1YJAA 1IC6A 2Z58A 2W2MA 3CO0S 3DVQX 3LPCA 1PFGA 4H6VA 4NE7A 1UBNA 3DWEX 1P8JA 3I30X 1IAVA 2HPZA 3DE7X 3GT4A 1A2QA 1GTJ1 3DW1X 1GA6A 1HT3A 1SUAA 3LXUX 4GI3A 4CFYA 3TI7A 2Z2YA 1GTL1 1XF1A 1PEKE 3Q40A 4HX2A 4BWGA 4RYDA 4OMCA 1CNMA 2W2PA 1SUCA 1SCDA 4KPGA 1NLUA 3QMPA 1Y3DE 2XTJA 5ARDA 2ZRQA 5I9SA 1S01A 5JMOA 1S02A 3BPSA 3ZXXA
chains in the Genus database with same CATH superfamily
3TUZC 1UMBB 4ZVPA 2C7VA 2EKZA 2Q5LA 4C7JA 4FU0A 4Q12A 1KK1A 2BT4A 4AXXA 1Z2CA 1Z4JA 1EXDA 2XB8A 3ZVNA 2CL6X 9MHTA 2EF1A 2V4UA 1OV6A 1ZCJA 5AI6A 2QGFA 2XOEA 3AWDA 4K6OA 3GNTA 3VYUB 4DVGA 3C8DA 1OXUA 4WZ6A 4J9UE 4TQAA 4Y2QA 4DLTA 2WIFA 4IIFA 4ZJZA 2X9QA 1ACMA 2DU8A 4M87A 5CB4A 2XYGA 1XVUA 4C4AA 1BX3A 3V8BA 3Q8WA 3W2IA 1LXCA 4DLLA 3EN0A 2C5GA 1XYGA 2CK3A 3K35A 3S7ZA 2JCYA 1T8WA 2YWRA 3OLWA 2E48A 2QRNA 4JA2A 2P40A 2P35A 3EZ9A 3IS3A 5D5QA 4EHHA 3KELA 4GOKA 3NQ41 4FYPA 4WGGA 3WOVA 1QLWA 1SBCA 4MUEA 1GY8A 5FL7A 4AJ2A 2YHIA 5BWNA 2FTKE 1RYNA 3KTAB 4XCXA 4AROA 4EYQA 4LISA 4KQIA 3UT6A 3THRA 3B9BA 3EF0A 4QSMA 3UK0A 1UIRA 1JSZA 1CR1A 3EXFA 3LO8A 4ARIA 4G4GA 3WR5A 3K9LA 4C04A 1XLVA 2FMFA 5EFZA 5T6MA 2A5GA 4CHTA 4RTNA 3OQNA 4QPPA 1TECE 1E2UA 3C3DA 4JMPA 2ID4A 1A8PA 5EJIA 5A3RA 2Y6VA 4UBMA 4KQKA 4ND7A 1IOWA 1D1SA 4NU0A 5MN5A 4DY6A 5E4YA 4N5MA 5A5EA 4F8YA 5HYVA 5KMGB 3M1AA 4G5FA 4LKOA 5AMXA 4V38A 5JS2A 2GAAA 2KMLA 4HFJA 4JNCA 1YRWA 3FTQA 5T3YA 4AN0A 1Z6XA 3CZ5A 1YDWA 1RI3A 1YE8A 2D1QA 3AUUA 1HLGA 3DDHA 3S8MA 1RABA 1Y4AE 4LFAB 3NBYC 3TW8A 4BRSA 1L4GA 5ANRB 3DUFA 3WK7A 4EI9A 4R8MA 2BFEA 3ESAA 3R77A 5FRDA 2FF7A 1TQ4A 1V0JA 1LK5A 2NWQA 3GARA 1U3GA 1JDTA 3IAUA 1MFPA 2GSWA 3MG9A 3NIDB 2VHWA 4RD3A 4OLHA 1MA0A 3AUKA 5GM1A 2ZB2A 3O83A 5KSPA 3LG2A 4LN1A 1XPUA 4UPDA 1DBPA 3S2SA 3JQ8B 2ONJA 1PJQA 4MI6A 2P67A 5DBGA 3VVLA 4YRSA 2QLTA 2PZLA 4LGVA 4BO5A 5LA6F 4UQOA 5E0KB 2NPOA 3TTXA 1YQ9A 3A6FA 4JDPA 4JHLA 2VPPA 5A9SA 5L9AA 4EM6A 1THTA 1E3DA 3GA7A 1NW8A 2A4MA 1JZSA 2BMEA 3WBBA 4A0FA 5KQPA 1K6JA 4YGXB 1TRHA 1P9RA 1CJKC 1JG2A 1Q14A 1R6TA 1ZH2A 3K0BA 3O3MB 3QG1A 4GQIA 4RJJA 3VPFA 1UT5A 3B8HA 4DZRA 3TXYA 5I7HA 3JALA 2O8FA 3FPGA 2AZTA 4HDMA 4PFKA 1C8VB 4KR9A 4DZZA 5CEEA 1HT3A 3M4ZA 2ZFUA 3HFJA 4HEHA 3ASYA 3PRHA 3DF7A 4QXPA 1G6Q1 5DRYA 4ZXFA 1EESA 3X1JA 2OD2A 4TVBA 4PLTA 2YZ2A 3E3OA 3U7FB 4HD8A 5BWOA 1HFEL 1CPYA 1MQSA 1Q15A 3PC8C 5H81A 2W6NA 4GM4A 2ZEJA 4H17A 4J2TA 2RHMA 2EG9A 2DHCA 1NE7A 1ML4A 3ZU6A 3KQKA 3N8HA 4XJVA 1BXRA 2CNKA 1LS6A 3IT3A 3BXEA 1U90A 3LLVA 1GUBA 4EPYA 5BWMA 3O2QB 5LXTB 2XYQA 2YOFA 3U39A 4X3PA 5I7SA 4FYIA 1WW3A 4Q21A 5DNUA 3KQPA 1VI2A 2HMSA 4MV0A 1PR9A 4NTZA 4QUBA 2XMPA 4U02A 4YJGA 4MVWA 3ROEA 3TBFA 1ACJA 1G9TA 4NL4H 1CETA 3HA2A 2VK4A 5CFQA 3QOWA 3WOHA 1QO0A 4BVAA 1K4YA 4FNAA 2V3CC 1ELOA 1QS0A 1KOFA 3PGLA 1IEQA 3IMGA 4EG4A 1C1DB 3RWBA 4PONA 3W5VA 1YJCA 4L75A 2HOQA 4MW4A 2IQ5A 4PGFA 3WGYA 2BRUA 2ZTHA 3K20A 4XIFA 4HNAB 2UU9B 3DBHA 3CT6A 2EOAA 4NX2A 4O4LF 3IIKA 5JSZA 1GZ3A 1Z88A 4WXPA 4OJMX 5LYJB 5FA5A 4F4UA 5JCOC 2IZOA 2NU6B 4OPMA 1P7PA 3RM3A 5ECYA 4INZA 3FJ1A 3DOEA 1S2DA 3EJ6A 3BWBA 2Z6UA 3OCZA 2VDWB 2JCGA 2EX0A 3BJMA 4Q9NA 3VAAA 1TQHA 4PZYA 1FK8A 2RGXA 1I6WA 4HJXA 4DJFC 1M8KA 3LPAA 4FILA 4HRAA 4JU8A 5L3QA 3HQ4O 1AF4A 2DWQA 3JQBC 1U3TA 1V1RA 2FFRA 2FEMA 1XP5A 2CXXA 2JFUA 3KJNA 4H60A 4OQEA 3Q9SA 3VR4H 1P7VA 3U19A 2W2OA 3K9NA 3ILXA 4Q15A 2CXHA 3PNSA 3R0IA 4YRNA 1W34A 1FMCA 4BU0A 5HZKA 2Y1CA 1JQDA 3JZDA 3GLFA 3PS9A 5ALOA 2RGYA 4XH9B 5IAGA 5ETJA 1R5BA 3E3LA 4QGBA 2HKIA 2JIZA 4WXMA 4I4LA 3SLKA 4ZPXA 1EHIA 1CUJA 3CY6A 2PA3A 4RETA 4XX1A 2C9DA 4ZI7A 4EJ2A 4M1EA 1AQJA 2ZYSA 3BERA 1KP3A 2ZREA 3WMGA 1AS3A 1RBMA 2OFOA 4E94A 4OGWA 1JQAA 1Z13A 2OAGA 4W5QA 1E3QA 4YCLA 5CLFA 2HNBA 4I5IA 2JLCA 4G0ZA 4TRMA 1U28A 2HK9A 1ECFA 4QXQA 3NVMB 1LRKA 4KE8A 1GNQA 3QLVA 4ZI2A 2A9VA 4M9UA 2PU5A 3E2IA 3ETCA 1NV9A 4EGJA 1N92A 1QPBA 1Z39A 3CX4A 3M9LA 3HB9A 4M98A 4OYHA 2FZVA 3MUOA 5FB3A 4HH4A 1R74A 1W73A 2A59A 4I4TF 1DV1A 1G9XA 1TQ6A 2VG8A 2ZOSA 2O7SA 3GWGA 4PPNA 5I7EA 1JQ3A 1KFEB 5FX2A 2WWWA 3GFFA 4JWTA 3SF8B 4NZZA 2TYSB 3A4IA 2R6JA 4HX9A 3PHJA 4AJKA 2O3RA 4RKQA 4IDAA 2BEKA 3AQ4A 3CWCA 3SFZA 4I6GA 4TMFA 2HEGA 3PICA 5PNTA 4U6SA 1VJDA 2XEXA 4BQNA 1YZVA 5CH3A 2HBQA 3UKDA 1JNXX 5E4TA 1QCZA 5E7QA 1VM6A 1CERA 1NOJA 2P9QA 2V96A 2F6RA 1DAPA 3OICA 2AH5A 3TLAA 2AN4A 4WKGA 4IW3B 4UCXA 3MBOA 5KMGA 2A9PA 1EG7A 4PO9A 1VKOA 2AMVA 3AP2A 2BDUA 2QP9X 4CDGA 4C7OB 2W00A 3ZIAD 1EK6A 1ZUHA 3FYCA 5IHXA 5CG2A 2FFBA 2VDRB 2ZULA 3VNSA 4ETMA 4ZAYA 1R8XA 4UFNA 4BO9A 4RPGA 5EHIA 2NUTA 7GPBA 1X0XA 1YE5A 3P45A 1X38A 5BR7A 2J5BA 4Q4HA 5TX7A 4ENQA 4DV5B 4IJKA 2R6ZA 2YR0A 2DPYA 1DQPA 1NLYA 2YHSA 1ZEMA 3N9IA 5K2OA 4QHSA 1O5TA 2ZSFA 3E15A 4M22A 1FPQA 4ZKEA 4Q3EA 1BEUB 4AKSA 5CFMA 4X62B 5JAMA 1HDYA 1L8QA 4I8IA 4GPZA 4BIIA 4M1OA 1ITZA 2A9OA 3OCXA 1QANA 3SSAA 1UZNA 2Z2JA 1P77A 3OZGA 1SKYB 4TWBA 1AKRA 3QI7A 5K3FA 2ZSHA 4G5HA 3H1BA 5FUWA 1E92A 4KU4A 3G9UA 3MTDA 4B45A 3D31A 3JS5A 3EGDB 3ADOA 5FBHA 4ZIRB 3GEGA 4RBNA 1W8DA 4YJ3A 1LI5A 3A1TA 4UU7A 4F5WA 2NM0A 3J80A 3PXEA 1Q92A 1JVBA 2F64A 3GVPA 3QU7A 4MV7A 4RKWA 2C88A 3FCYA 3IT2A 1NOIA 4KRXA 4HNGA 3LP8A 4I4TB 1TK3A 3PNQA 4WLEA 3TQHA 3WYCA 2P77A 1UEJA 4EUNA 4D9MA 2RGAA 5CJ2A 3PB3A 3ZWCA 2G71A 4YECA 1VKNA 3CW2A 1PJAA 2WJ6A 1PDOA 3A4YA 1QPGA 2G04A 3B7WA 2ORVA 3LT2A 4E4RA 1YR7A 3PNYA 4TTAA 3Q6MA 1FUUA 1RQ2A 1T5DX 2B1QA 1FSZA 3H5RA 4OHWA 4R1LA 2G1AA 3TI9A 4E1VA 1WDWB 1FRFS 4HG2A 4ZQCB 4QD3A 4UC0A 4A5OA 1TU0A 4UBIA 1LEHA 1T8RA 1E99A 2ZKIA 4LHVA 1NF8A 2ZU0C 5JJLA 4B85A 3TJZA 2X0RA 3IUEA 3U1TA 4TSFA 2R84A 3HB5X 5HJ2A 2A3NA 1A7KA 2D0IA 3FOCA 4RXTA 3P2OA 4PAQA 1KMMA 2NTJA 2C4KA 3DVRX 3N8GA 4GPBA 2XCQA 1S3SA 1EA5A 1RADA 2V98A 2FRDC 3ZV5A 3UJAA 4WOKA 2WKPA 4YT4A 3GJ5A 5SY9A 3C14C 4FW8A 2GTIA 1XAGA 3HYLA 4QPZA 1IMJA 5B37A 2IV2X 5BR1A 4GLOA 3LX6A 2R7AA 5HSGA 3ZEAA 1WCIB 1EZ4A 4Y30A 4DG9A 4I4TA 1TM4E 3V2UA 4FI3F 2JKVA 4KE6A 3NCTA 4C4PA 4EKDA 5BXQC 1I9CA 2F43B 2Q1XA 1VYHA 3CRMA 1RJFA 4I08A 1N0HA 5F4BA 5HJ7A 1FZTA 1VP9A 1UADA 4MVJF 2PGOA 3KYCA 4BZPA 4G0UA 3P9XA 2W8BB 4HBGA 4B83A 4KGXA 3RV4A 1Z17A 4W63A 3VR3D 4W5RA 1LBQA 1QQAA 3IVAA 3ORRA 1PT9A 3AO0B 4JNKA 3NDRA 3CH4B 2P6PA 1K98A 2DMRA 2IZ1A 4UBOA 3KXKA 2E6UX 2OORC 3WGGA 1XD2B 2CUKA 1NFRA 4BMVA 3L41A 3ZVMA 3BGOS 1ZD4A 2QW8A 4TPKA 1VJGA 5C4GB 4AZSA 4RZSA 4DLZA 2Q5IA 1M1UA 1XA0A 2C03A 2I6QA 4HGOA 3FWZA 4IQ0A 4K87A 4WQMA 1ZBDA 2AX4A 2V8BA 2RE8A 3AY7A 3D7LA 1KAGA 4X1KA 1PJRA 2O05A 2Y0CA 4CV0A 4DR2B 2RK3A 3KUCA 4YV0A 2O5EA 1PI3A 5ERYA 5K0NA 3K0HA 3OJLA 3LF2A 4O25A 4ND8B 4QA9A 4BQFA 2XA1A 1EQUA 4DIUA 1Y37A 1WHSB 5FV7A 4C4SA 2ACKA 3F8SA 4C0AC 3I6ZA 5HF6A 4KPUA 4RIGA 1OIWA 1QVRA 3RJZA 1WSDA 1E3JA 3B20A 3CNNA 3H2GA 4LYYA 4R98A 1CZKA 4RA9A 4H15A 4RGVA 3LMKA 5G0SA 5BSTA 3UB3A 3ZWKA 1ZMOA 4OQMA 4BWFB 1U0LA 2FN3A 4B84A 1CS0B 3F73A 1T4CA 4RM2A 3DHNA 5KOYA 5FBZA 5JXGA 2AN5A 2D3TA 3EGDA 4ZCQA 3DL4A 4ZIRA 4A0GA 2J32A 4BNLA 3I6BA 1FUIA 1I2MA 2JGEA 1Z2DA 3BJIC 4H7PA 1U80A 4MP3A 4UAUA 1CUUA 1CEQA 3GO4A 1PUJA 2WYVA 3JWPA 2RKOA 5KYYA 4WN9A 4DR4B 1ZN7A 2Z56A 1XO1A 4TT3A 4DLXA 5FFMA 2OZLA 1W8IA 4GNKA 2QLLA 1HDXA 3B5JA 3DVAB 3JQRA 3UUWA 4R0VA 1QHGA 2WJPA 2H52A 4R9NA 5CLIA 5E9QA 2R6GA 1ZVQA 2QIPA 3FGPA 4D4HA 3RHFA 2O0LA 4J0CA 1RQ7A 4L0MA 3G1WA 3D2AA 3B1ZA 1JPUA 3E4DA 3K09A 3PDIA 4FYJA 4K7JA 4DFDA 5KQMA 5J2UF 4WXHA 3TZKA 1PJ8A 1T4DA 4GI5A 2DAPA 2NYUA 1OZAA 4G41A 5JLAA 1L4HA 2QUBA 3SYKA 1O8CA 3DKRA 4D8WA 3R9XB 2X77A 4O4HF 2QLMA 1N7IA 2JFFA 2J0SA 3P32A 4LXTA 1OPXA 2YC4C 4PAWA 1FNBA 1TGYA 1VFNA 2WOJA 2YNMA 5FWYB 5HFJA 1H4QA 4KQJA 4G86A 3N58A 2PGAA 3T9AA 2IP2A 3DPIA 4M21A 5DTQA 2OV3A 4HDSA 1T3ZA 2I2BA 4ZO6A 1HQYE 3PHGA 1RI1A 2X58A 2BTQB 2P8JA 1Q1NA 2V8OA 1NJSA 4OKIA 2PT5A 4ADSG 4OI0A 3LK6A 3GFSA 5A7GA 2JIZD 1LX7A 1DFGA 2AYYA 2H7VA 1C7FA 1ISRA 1EI9A 2DR0A 4EQ6B 5K03A 3QELB 1I9GA 4Y1FA 4Q9LA 3CUYA 3RARA 1SUAA 3VYRB 2ZIVB 2QM7A 3GNSA 3NM5A 3S2ZA 1V9CA 1RPNA 4V3CA 1NVGA 2ANBA 3IHTA 1Z0FA 2QMEA 2Q41A 3WLOA 5C53B 1PS9A 5IT5A 1M2HA 3KQOA 3S29A 1QMGA 4AMBA 3HSYA 5DKFA 1INLA 4K9RA 4RESA 4IWXA 2XNDA 4HYEA 2AOUB 4IPTA 3W4IA 1FNNA 1C4WA 1E96A 1YQWA 5F4ZA 1DADA 3SQMA 1FRVA 4AWBA 5BYKA 2VRCD 1ZIXA 1NVBA 3H2ZA 4JFRA 3W8FA 2PRJA 2CVHA 5DGHA 2AG5A 1SB8A 2ZRLA 4LX8A 2P41A 3PWKA 4OGFA 1O6BA 3EXFB 4LBZA 4NH0A 5F7OA 2CSUA 5HZHA 1FFGA 4FC6A 4KO3S 2F1OA 2Y0DA 4YMLA 1VHDA 1QV9A 2WU1A 2X8AA 2ZROA 4GI7A 5P21A 3UWPA 5KNDH 3NMUF 2QKYA 2I6GA 3LNCA 3P0IA 4JL6A 3T7RA 1AUXA 1L4KA 2G5PA 1H2YA 1M6NA 3RIMA 1QIIA 3PUJA 3S2GA 5LUAA 2EIHA 4CEJB 4BBPA 2QAGB 1DO2A 1RLTA 4CG2A 1ZJWA 4OJNA 4PSCA 3ITNA 5TMEA 1JWAB 3SJUA 3T3MB 1YOVA 1UT6A 3ZV3A 4B3BA 4LI3X 3A4TA 4L3VA 5A9RA 2ODAA 1NRWA 3Q7SA 4UHDA 3G2JA 1VMEA 2MMCA 1C80A 5BSRA 4OGKA 4EPVA 3GVHA 5CFNA 1N6OA 3O3OB 4BQOA 5K4HA 1BQ3A 1FTSA 1YQTA 3KFXA 4GMFA 5CFRA 1KZ6A 4NMWA 1Z5WA 2Q0SA 1W4BA 4Q1BA 3C3JA 3R0QA 3CH6A 3NEAA 5G53C 5ITVA 1G38A 4MWSA 2IOQA 2SCUA 3U81A 4QSHA 2F2TA 3FZGA 1QIEA 1TCAA 1V2GA 3MJCA 3IIJA 2IF2A 2RAFA 1GTMA 3N53A 5DNEA 3RUAA 3EWSA 3KQMA 1JDNA 1O5OA 4CIVA 4DTIA 2X1MA 2ZJ4A 1N32B 3KQHA 1KBOA 3UHJA 1L7VC 2ZJBA 2QVCA 3R20A 2ZSDA 1VMAA 5REQA 4OQPA 4QU5A 4MPTA 1SKQA 1FSFA 2WJWA 3K3PA 3OI7A 5I6DA 1A76A 2RAPA 1JFLA 2WB2A 1RWNA 1C1HA 1NVUQ 2RKWA 1RCUA 3PBKA 2QVZX 4WLOA 2I7VA 3E3AA 3HCBA 1QXSA 3CLTD 5F1PA 4A2PA 3HKEA 5FOSA 2M6LA 4DJAA 2XOKA 3S44A 3AR9A 3D6JA 3DLTA 1XQXA 2RHBA 3UAVA 3C87A 3V34A 2DKOA 4JLUA 5B4UA 4GD3Q 1O54A 1TEHA 4MS1A 1KH2A 1DPFA 3CLHA 1PZMA 2GJ9A 5EOVA 3KJXA 1AF7A 3ZDYB 4RHEA 3RUPA 4D97A 1TYBE 2PLRA 4HFRA 4I2VA 1TC1A 4HPXB 5GJBA 1VG9B 5BO5A 2WLSA 4BLVA 2OCPA 5CXUA 2X40A 5SZJA 1JXOA 3RROA 1K0UA 2JDIA 1KJIA 3NI2A 3T3OA 3ROFA 3VKFA 4CIYA 5LQRA 5JAHA 4AY2A 2ECPA 3IULA 1DHRA 3HCEA 5CNMA 5LDHA 2H9AA 1TXGA 4KAAA 3SU8A 2VRNA 1CY2A 3VOBA 1H9CA 5DXFA 2UZ1A 3PPIA 1CQXA 3VR2D 4B0OA 5D3QA 1B42A 4KH1A 4PTZA 4K86A 1OLOA 2OQ2A 2ZJOA 4G2TA 5JWHA 2X0NA 3B1WA 5CM9C 1ZS9A 2VP6A 4AQYB 3NNSA 4CV3A 4IRXA 3MWKA 4D9NA 3SYMA 3PJEA 5ALPA 3TW0A 3NU1A 5AK5A 3KAPA 5DIZA 3ZK9A 4DLSA 4I1VA 4KXVA 3E8MA 5AQ1A 4EJMA 5AK4A 4B2PA 2O8EB 1EKXA 1PWEA 3WGTA 4DUPA 3HJCA 3A2KA 3QJGA 1BD3A 3JYNA 1Y9ZA 4R51A 5EJEA 1IZ9A 3C8UA 4NYIQ 4IJMA 4WCFC 2G6BA 1I7DA 4G85A 1Y7TA 2HQ1A 1LPMA 2WD7A 3LS2A 1U7HA 2BCGY 2VK1A 4AO7A 2QX7A 4TL8A 4IR7A 5GIOE 4L9WA 3AERB 1SC9A 3GJ3A 4GU5A 2IZZA 4U1RA 1ZNYA 3CCCA 1KEEA 1I7LA 3F4KA 4EKYA 2P7HA 4N4AA 4XSVA 4L4SA 4PYMA 5JNRA 4PYKA 1J9EA 2PR2A 3E5RA 2IGBA 1T0HB 4FM9A 4RY9A 1FP4A 2PUFA 4NOMA 2BMDA 1UBMS 5AHKA 4A5SA 1JIXA 5JO0A 1CUYA 3TL6A 1E4OA 2ZYAA 3ASUA 4EG7A 2BM0A 4LX0A 1WIWA 4OMUA 3PX7A 3HCFA 1JALA 1CR6A 3ESRA 4KVGA 4JR1A 4O1IA 3UXEA 2FA9A 1QE3A 5HR5A 2FRVA 5EI5A 3COWA 2MSNA 3FRJA 4M0CA 1OX6A 4K3VA 3LT1A 4QU0A 1R0KA 5EVJA 3OPMA 1WMFA 1MDBA 3W9BA 4DSNA 4BO2A 5EESA 3DPSA 6GPBA 4FMDF 5IN4A 4FGSA 1NLMA 1FYDA 3VR4D 2IX3A 1NMQA 4LDRA 3DM5A 2FWNA 2VUHB 1PL8A 2J5XA 5K3EA 1UMDB 4ENPA 4JV5B 2C92A 1ZUIA 4X1YB 1Z6YA 4QU9A 3KHSA 1YZLA 5KJCA 1P7CA 1LUAA 2DSTA 1ZSYA 3MCWA 4IILA 2C5BA 1ZO8A 2H2WA 3C0KA 3HJHA 1HZZC 1SEVA 1UBCA 2Y1OA 1QH9A 2IVFA 3KB8A 5JZOA 3VDNB 4O4LA 5KYGA 5E6SB 4ASUD 3LVQE 3TYXA 4PZCA 5KIAA 2V7TA 3BG5A 2QTBA 1Z6TA 4ITUA 3FPBA 1EHYA 1GCUA 2BDEA 2YCBA 4ZOBA 2LE0A 4BQPA 4EEZA 1P5ZB 1WDTA 4RK1A 4OQZA 1GDDA 2BR5A 1ZOOA 5DCYA 1K6IA 3LGAA 3O38A 3EGXB 3LA6A 1FDVA 2EIXA 3HACA 5JRDS 3Q3JB 1YJAA 1AUPA 3ZBTA 1JIJA 1Q83A 2B35A 2B82A 5CDUA 4NQRA 1QUEA 3UKJA 2A8YA 3PNPA 1YS7A 3MWGA 5LDDC 1E94E 1JU9A 3N0TA 2WPDD 1T29A 4YMWA 1E59A 3RVQA 4WBSA 3NWBA 3T54A 2B21A 3DMGA 3EA4A 5CPBA 4QYMA 4D6PA 2JLUA 4QDKA 2NP6A 4MLPA 3K09C 4EKGA 4ZI7F 1L6IA 2X41A 3C6MA 4FSDA 1IPEA 4WDRA 5LVAA 3TECE 3BDVA 1Q0PA 1JDBB 3BMQA 2VN8A 3OIUA 3FWKA 1QVVA 1CUVA 1L4MA 4BLQA 3OIWA 4JP8A 4F6CA 1T2AA 3BKXA 2EJVA 1M6YA 2B4RO 5K3DA 1TIPA 3FSRA 2YNMD 1NKSA 4JLMA 1CDEA 4JLNA 3R7AA 3H97A 3L1UA 1HY3A 1TUIA 5D5PA 1KQ3A 2VJCA 1QAMA 3OQHA 2IHTA 4ALMA 1OH5A 1DAKA 1IUKA 1OI3A 1W5FA 3UJCA 2G28A 2PRYA 4CEHA 1RQRA 3H04A 4K6FA 4MQ4A 2GSDA 1W36C 2R6HA 4N6GA 4B7CA 2QTCA 3AM3A 3DO8A 4L74A 4H1TA 4WFQA 4DIDA 4MP8A 1WM1A 3UJBA 1OBOA 3LL7A 1RSZA 2FQYA 2DPLA 3FPFA 1N5MA 1JJ7A 1IRIA 2KWIA 3GC6A 3I0ZA 5LDGA 4DLPA 5A02A 3IV7A 5JAZA 2UV8A 1YACA 1QDUA 3AV0B 4CLOB 1E62A 5J9FA 2YCLA 1ZU5A 3KT6A 3G17A 5DTJA 4ZICA 1JLSA 1ECCA 1N3BA 1XX6A 2D0DA 3FD8A 3KLMX 2P3LA 4NH4A 3OD1A 3DGFC 4K40A 1I32A 1YL7A 5G1NA 4YCBA 1JXAA 2R2AA 4PZZA 4D8VA 5JJCA 2VDLB 3QF4A 2ZT6A 4J43A 1R66A 5DT9A 4OHKA 2XV1A 2Y92A 2Q21A 5JHHB 5E6UA 3GPDG 5JBIA 5K0BA 3NNNA 3IO5A 2C1ZA 4E11A 5AM2A 2GN2A 1H69A 2WU4A 3KHKA 3H19A 4H1VA 1NULA 3CT4A 1E1CB 2BDTA 2FN8A 1B43A 4F2GA 3GFQA 3T4EA 4NCIA 1FVOA 3P26A 3UMCA 4TL6A 4YO8A 2XI4A 3OKPA 3RAGA 5DM70 2POCA 4BECA 1TFUA 1IU9A 3RUFA 3E23A 4TYWA 1SK8A 4DUYB 2Q28A 5AR1A 3WLRA 3HYRA 4BFUA 3A70A 2TMDA 1M67A 1U4OA 5HTOA 3EHEA 3DMTC 1CS0A 3W4KA 2PUAA 2GCOA 1XRJA 1BIFA 4QASA 3RTBA 4A03A 3ZGVA 4MZXA 5J4HA 5CDTA 3TR5A 1RFLA 2AKYA 4KN8A 5KSYA 5FEMA 4UM8B 1QHFA 2PT6A 5EKXA 1DUIA 3BFJA 1GYQA 2CCJA 1IN8A 4KK4A 4II2A 4HDOB 3K0CA 2UZ3A 3B12A 4GEGA 2DFNA 2BEJA 4OBWA 3GVIA 3S1SA 3LCUA 3TIGA 4KYIB 2JLZA 2BFNA 2I3BA 4G8DA 2RKBA 4QUGA 3PEUA 4FFNA 1GG9A 2MSDB 4XVCA 2CKMA 1Z8FA 1AB6A 1VCMA 4AJ1A 4X7RA 4Z1MA 5SYAA 5IVPA 3H65A 1JDPA 1RM0A 4MV9A 3U3OA 1S4MA 3JD2A 4JJFA 2AYZA 3S8EA 5EJ7A 2FN7A 3DDNA 4PQGA 1AKQA 3CX3A 3BWEA 4PN3A 5JISA 2HWWA 3JARB 5FOXA 3G2LA 1M1XB 3CNBA 1SZCA 1XTZA 2CBXA 5JDCC 1L7DA 2ZIWB 1GOTA 1LBIA 3BCSA 1Q0UA 1N75A 2I6XA 4TTPA 5A9TA 3CLVA 3VPSA 3E8SA 4EYGA 3HXQA 4KN6A 2GWRA 4XJXA 4W5JA 3MMXA 4IIXA 5T8KA 3ZEIA 2X9LA 5KYYB 3VZCA 3QLVC 4FFBA 1QYWA 3FJYA 2F43A 4TRJA 4BGDA 4IWYA 1KK2A 1UJ2A 5HKAA 3VC1A 4JYCA 4NXNB 1SBTA 1QWOA 2CMDA 2R8EA 4ZQGA 4M8KA 5B7PA 3G0HA 3WWYA 5DLYA 1V25A 4XVHA 1O94D 4WMLA 5CB8A 1DEOA 1ZM7A 5B2ZA 4HNVA 1JQEA 3G8CA 3L6CA 2Z4SA 1P1KA 3N2GB 1AB5A 4NFSA 1REQB 4Y6PA 1D8TA 3PWZA 4WH0A 7ADHA 5K3AA 1MENA 2HBYA 2ZR9A 3IUMA 4ZVVA 5KTTA 2H5EA 3EYAA 2QMOA 4UOZA 2OILA 3PPXA 3IQZA 3TDMA 4BNMA 4LOKA 4YV2A 1P81A 1YKGA 3ER6A 4JJIA 2OZKA 1JTFA 4Q3KA 1ISMA 3ZV4A 4U6NA 1CYDA 1U8EA 4IVRA 3X43A 3TNLA 1NPDA 1ODTC 4BB9A 2HQRA 5A0TA 2WK1A 5A05A 4P9NA 1A9TA 1TM7E 2EZ8A 4A36A 4Z7JA 5AOVA 3KQNA 4YJ2F 3HXTA 2VXBA 5HKLA 3PA6A 2DWUA 4R68A 1R0RE 2MYNA 2XHZA 4JR2A 4GUAA 4RW0A 2ZYHA 5GJVC 1C7EA 1EFHA 4PHFA 3H5OA 1R0YA 5JYEA 5B1DA 2V6FA 2X3UA 3CZPA 5DX8A 3U4DA 3UH0A 4ZDKA 5K05A 1UZLA 2NUPB 1P72A 2RBGA 3M4NA 2UYGA 4WT7A 4TV9B 3LYAA 4K9LA 3KSAC 3FDJA 4B2LA 1N2ZA 4OH7A 4HLUC 1H94A 2R47A 3AETB 4CIBA 3GIDA 3CM0A 2FEWB 1WKCA 3Q41A 1DJNA 1OT5A 1J2RA 1OLXA 1U7WA 2N47A 3GRPA 3HBNA 4N9WA 5CVCA 2HT6A 5ELMA 3FSGA 3ZHQA 1EK0A 4I55A 1GKLA 4O4JA 1BW9A 3Q3CA 3DUWA 4AZWA 2AR0A 3K94A 1NBIA 2A5LA 1GVHA 2GXUA 2QUJA 3WWPA 1ZUNB 3A4LA 1RZ3A 2PKQP 5EJFA 1H2ZA 4AAYA 3Q2IA 2H0RA 1BGVA 1FUKA 4ENSA 1C3OB 2PMEA 4EUFA 1E2HA 5ALJA 5AKGA 3EVDA 3VNRA 1M1YE 1ZR4A 1NG9A 1SCKA 1UL1X 2FZCA 5D01A 4DMHA 1JEYA 2ZBRA 5J63A 2XBUA 3SF8A 1H9AA 3CF2A 3D6HA 4KHZA 5EE9A 3CVXA 1UDBA 3AQIA 1CKEA 2GPTA 1Z4LA 3GFRA 4FSHA 4GDMA 4TV9F 4EHDA 1XPRA 1CQPA 4DMCA 4AS1A 1IXZA 2FEXA 2P4QA 1DARA 3D6NB 3FLAA 3H9JA 4G8BA 5LL6P 1AK2A 4X1IA 1GADO 1ZN2A 1LZKA 1TEXA 1IQUA 1GPNA 1X7ZA 3BDAA 3JVIA 3PHIA 4K9SA 2WHRA 4BGIA 2ZRKA 3IOYA 2VYVD 4L8YA 3ABSB 3EARA 3KPYA 1I7SB 2ERXA 5IUJC 1QKKA 5DHAA 1DJLA 4FIZA 4LOLA 221PA 1IN6A 4KIJA 2X7HA 1EUDB 3OT1A 3SK0A 1GZUA 1P7YA 1ZNXA 2R5FA 2Z08A 1FOEB 1PHPA 2GK7A 1W47A 4I9FA 1PEKE 2O8DB 2QJRA 4JCCA 2G0AA 3PJFA 4MQEB 5CFPA 3DPUA 3QEKA 1JIUA 1WOYA 2GO7A 3B38A 4YA6A 5ARDA 5IWCA 2GH1A 3ZWVA 1UK6A 4BKOA 4BN0A 3DZCA 4EL0A 1RI2A 3HYCA 1XZ8A 1DFHA 4R0NA 3S5JA 3FFTA 3G6WA 3TN7A 3ZIDA 5G0TA 3AM5A 2HGSA 3NASA 1PK8A 1UWKA 1GGJA 2RGDA 4KSBA 4Q1VA 1G3MA 5TQVA 4CR6A 2DBYA 3CG0A 5EG5A 3GRYA 5AO9A 1CRWG 4DDWA 1KIFA 1ZFNA 1ZMBA 2EW8A 4ZU3A 1FDUA 4NEHB 2MSCB 2O1EA 2XOKD 3W9YA 2QL6A 4UMDA 4DMMA 1WW8A 3PHHA 1Z5GA 2YQ5A 2WNIA 2HHAA 3OZDA 4FOLA 5IABA 5KHOC 4OB6A 2XQVA 5B4TA 4JYAB 3PDUA 3WB2A 1DTEA 2YJ5A 1CS4C 1T4MA 2W2KB 3D6UA 3LD9A 3PD7A 4KJZA 4QPNA 4D3ZA 1DCFA 4MW9A 4HB4A 3L18A 1Z4IA 2CC2A 3KQUA 1WCXA 4F7WA 3UJNA 2FN4A 3M4JA 4MEBA 5DNAA 4CE6A 3OT1B 2C2GA 4U7GA 4F4DA 3W9SA 1DMSA 2Q5JA 3UMSA 1DXYA 1T6YA 4NESA 4W9RA 1NI4A 2C7QA 1B76A 4KB5A 4OSPA 3NHPA 5CCBA 3EDCA 3TGWA 1VBNA 2Q0QA 3NLLA 2O7NA 1X1BA 4I8DA 3D6TB 2BV3A 3GDHA 3QZUA 4RS4A 3VR2A 2ZUWA 4KUEA 3R09A 3RC9A 3S2FA 2FLKA 2EW1A 2WDPA 3I4CA 1EK2A 1T8TA 3QHPA 3K05A 3KLBA 3QLJA 4TTVA 2C2KA 4CFZA 1Y6FA 3DB2A 3I2KA 4Q7KA 4D81A 1I24A 2OK8A 4MUXA 3PEWA 5DEIA 2SICE 3G5MA 2HDNB 4DWVA 4BYGA 4DIEA 3HZHA 1GQOA 4ZQHA 4ESHA 4TLAA 1RJEA 1EBFA 5L53A 1D8AA 1E2PA 2ZRNA 2Z98A 2NVWA 2QUKA 3GYGA 3MTJA 2N75A 2XVAA 3KVNA 3IXQA 4MRPA 4S2UA 4HTFB 2HV9A 2WV7A 3P7MA 3T06B 4F3NA 2PSSA 3NDIA 2JFGA 1HDOA 1TM1E 2Z2IA 3INYA 1KTIA 1YHNA 1EFVB 1OX4B 3P2MA 4LVOA 4P5EA 4REQA 2WI8A 2YJ6A 1H23A 1QE0A 3DMRA 3I1YA 3KPWA 4QUIA 3U37A 2KW5A 1H2FA 1UK7A 2VXOA 4O5AA 5JBNA 3TG8A 4CG3A 1IB6A 2B1JA 1NVMB 3TKYA 3ZY5A 4UTNA 4KN9S 4O5OA 5KU1A 3SBOA 1EPUA 4P53A 4ZMSA 3SEAA 4KXXA 1BDJA 5T57A 4PIPA 5H68A 1NVAA 3A9SA 2RJOA 5EKSA 2JGJA 4O0MA 1MG0A 1P2VA 1VSTA 1T24A 1JJVA 2C54A 2C95A 3GEEA 4HB2A 4KO4S 5EHNA 2EWMA 1KAQA 5BV2P 5TPWB 1HG0A 1TCUA 1IK4A 1WVGA 5GVRA 2PO5A 2ZQ5A 3Q11A 1J06A 2FU5C 2QRVA 4GT1A 4QOIA 2HIMA 1US8B 1W1IA 3GZJA 4IDCA 5KDOA 4YAFA 4X91A 4I1IA 1PYGA 1SBYA 4V0OA 4S05A 2HV8A 3O92A 2XNHA 4BQIA 5JO9A 4CKXA 3VTKA 1N2SA 3L1HA 3KEMA 1KPHA 2Y9PB 1G19A 4M9XA 3RKRA 1IIRA 5ITZB 2ATXA 3CSUA 4D0LB 2O4CA 4XD7D 3VO9A 3AI2A 3OA2A 2XT9A 4E5VA 5JNWA 2RGWA 5BNWA 3QTBA 1K3FA 1Z73A 3BSYA 3RVLA 8ABPA 1OWPA 3HUFA 2ZPUA 4IEFB 4DEYA 1LLFA 4UTXA 4GM1A 4RAOA 5GPBA 1U2GC 4ODIA 1RWOA 3DA8A 3ICVA 3A27A 3HCDA 1C1YA 2ZS8A 2WE7A 5F23A 10MHA 4X92A 2QR3A 1T0PA 1UKVY 2CLIB 2GETA 1XEXA 1C9MA 2RHDA 3L7OA 4YIKA 3S2EA 2D0OB 3HKEB 4EO4A 3MPOA 4TKVA 4M7RA 1EE1A 4W9MC 2HI0A 5JC8A 1C7IA 4UASA 3H87A 2Y4NA 2JH9A 5NLLA 2PUEA 3WWEA 4Z4GA 3A4MA 1Z6AA 2O2ZA 3Q3GE 2WIGA 3L7AA 1TIBA 4N5NA 2GVNA 2OB2A 1AXGA 1U1DA 4FMDB 3T0FA 4AJJA 5MDHA 4R2LA 2IHVA 1QZZA 1A69A 2QG4A 4LXIA 4ZREA 3EK2A 3IV9A 1KKUA 2R1TB 2A0KA 3E48A 3RUHA 3VC3A 3OO1A 5A0VA 1MMFB 5ALKA 5JRZA 4BQSA 1D6SA 5KOJB 2EHJA 3QXGA 1JEEA 1MQ9A 1TVMA 5C3UA 2JARA 3VX4A 1WY7A 1Z47A 3ET5A 3IXMA 4JOBA 2QMZA 5DFAA 2Y1LA 3SJBA 3V8RA 4L2IA 2PX4A 3ZQ4A 1HQDA 2QRKA 5JJ5A 4YUVA 4WE3A 3WK8A 4IF4A 1IZ7A 4F92B 2HN9A 3DBHB 2J7KA 3HCCA 4UW9A 5LXTA 2QUIA 1IOVA 5H9VA 4DF3A 3STWA 4BVLA 5KX5F 1L5HA 2R68A 4IJQA 5JSYA 3V7WA 3GJ0A 1JL3A 1KMQA 1HGXA 2PT9A 3PYXA 5COBA 5IK2D 4H7KA 4C87A 5JJKA 2VATA 2QD2A 1OROA 3VTFA 3TRFA 3P9KA 1AUVA 1KHHA 3SIRA 1XU9A 3VKWA 2GXSA 2VH5R 4G8JA 3ND8A 1NBMD 4EG0A 3I8XA 1K88A 4BBAA 5T6BA 3EFHA 2PH1A 2EU8A 3FY4A 3LTEA 4LSMA 2YW9A 4N3AA 3SFVA 3SPXA 4CTJA 5A5GA 3AP3A 3RAFC 2L17A 3OIYA 5HX7A 2YQ4A 1JW9B 3B7PA 3R6DA 1MOQA 1ZH8A 2AEJA 4CQMA 2AVDA 1UXHA 2R79A 2LR0A 2O9JA 2ZANA 4JJEA 3RUEA 4QGSA 2D7JA 1T15A 2YJGA 3QE3A 3WGOA 4MYCA 3ER9A 2GF9A 3OTQA 1JAYA 1CY0A 4UTPA 3SZ3A 1NU8A 2LBPA 2VR1A 2WFLA 1GV0A 1BDMA 2YICA 1E18A 3B6EA 2Q4BA 3H1PA 3PU6A 4NEQA 4FOPA 1JB1A 5E1BA 3ZZNA 3LWZA 2B37A 4FOOA 4L4RA 4PX5A 4EGQA 4II3A 1KXJA 1QYXA 1T1EA 4DQDA 3LC2O 4N65A 2MDTA 2QJWA 3HGTA 3UATA 2B4QA 4HDNA 5CHYA 4AMZA 4HS4A 3BHNA 2VWQA 2HSGA 1NE2A 2BP7A 3NR2A 4NCHA 4ARBA 1QE5A 4Q3LA 3DW1X 3AV3A 1R7RA 3V46A 5CDFE 3VNVA 4URHA 4R0MA 1GZSA 2OO5C 2EARA 3RGWS 2PZGA 1NBHA 2QDKA 1ACLA 2FQQA 4UQPA 3GH1A 3RBVA 3W7AA 5I5GA 2W2PA 4C0LA 4BX9A 1XTRA 5J4YA 5JVDF 4MHTA 1L3CA 1W30A 1KVRA 3JSAA 3B3FA 1P1FA 1TZKA 1VSQA 2LTAA 3G5UA 1NBAA 1P4GA 2VJMA 3ZH9B 5BVGB 3GCDA 3ZKWB 3GCXA 3GWZA 2I62A 2P3QA 3AF2A 4DEXA 2YW2A 3PC6A 4B6SA 2J3MA 3Q0IA 1CNEA 1W19A 4LHYA 1WBBA 4MAFA 3BJEA 4WJZA 1LLCA 2IUTA 1V3QE 2OBBA 2WWRA 1RLMA 5FI1B 4TUYA 1C30B 4IRMA 2JKZA 3FAZA 1IY9A 3SC2B 4CKWB 2QNIA 2PR7A 5FULA 2GBLC 4WESB 3K9FC 1BVUA 3OC0A 4Y2RA 3NUGA 3C3WA 1NUHA 4NNPA 4XW2A 1K2VN 2YBEA 3DFUA 3H8WA 5KTNA 1QGUA 3VOTA 3C4JA 4MB0A 2ZWIA 1G20A 1UZUA 1ZQ9A 1CY6A 1IRXA 1ORRA 4WCDA 5KWIA 1Y4UA 4Y9DA 3RWOA 1KYVA 3I05A 4HPWA 4YR9A 1Z4NA 2H4JA 3BBPA 5EIBC 3N5CA 2XDQA 2BFDA 1GJRA 2BE9A 2BMWA 4HWSA 1LJ8A 3OWOA 2J4CA 4B4OA 4EDHA 4Y9UA 5J58A 1CX9B 4HVLA 2WQ7A 5F2KA 3TW4A 2QSYA 2Q2OA 4E6PA 1HTBA 5EN4A 4WLUA 5F3WB 1BVRA 2ADOA 2YVQA 2I7TA 2JA2A 3EXAA 4RDIA 5HW0A 2VJMB 1N6KA 4GLJA 3OTOB 3LOUA 3DYVA 3I01A 3BHIA 4FTWA 3RCBA 5C5EA 3UUFA 4GP7A 5IXYA 3PEFA 1KYQA 6ABPA 1WPRA 4LHSA 3V1KA 2E2WA 3E81A 3JQ7A 3M3HA 2QTFA 3WAKA 2WU8A 1O95D 3W0LB 2G63A 3K6SB 1SG0A 1W96A 3GRAA 4B17A 3MD0A 3FYDA 1GQYA 1PQUA 5CYGA 2WNSA 4QUJA 4EFMA 1F51E 4ZN6A 1D1TA 3JD1A 1Y8ZA 4L8LA 1W48A 3N2EA 4RY0A 3EULA 4NDAA 3AKCA 5F2EA 5BMVF 2ZE5A 4B8ZA 1KI7A 2YV2A 3G5LA 3O47A 5LUBA 3IFSA 1V45E 4Q3CA 1GL7A 1K75A 5CXQA 4ACBA 1FU4A 3O7MA 2QQEA 3G5AA 4P92A 2IYAA 4XDHA 5CYPA 1S2GA 2R2GA 1EH5A 1WW2A 1YU9A 2VPZA 3FNHA 3Q1LA 2R4QA 4Q37A 1F8FA 2FMUA 2VUIB 3D3JA 4NLLA 4NS1A 3RV3A 4F72A 4IVQA 2G9VA 5ALFA 4FD3A 5DU2A 3PITA 5DRTA 5GZ6A 1N57A 4FE4A 1AU9A 3HL0A 3CKMA 5TRTA 4DB4A 4R3UC 1Y1LA 4R41A 2QQFA 3ELWA 3IERA 4BUZA 1P61B 1E3MA 2J85A 1KYZA 1MAUA 2GZ3A 4P93A 1G60A 4RIHA 2RCNA 4FMPA 2OLJA 1U4SA 1LFAA 2OP0A 3TLJA 3SDBA 1QTRA 4WZAE 1F5NA 4LZNA 3B6JA 3I5YA 1Y0BA 3EH1A 2I22A 4DBLE 1WF6A 1Z0AA 4JI8B 1VZ2A 3ITEA 4RCZA 3HKBB 4F56A 1Y3DE 2II6A 2J9YB 1ISGA 3EASA 3QOXA 3UWSA 3ZZ1A 3ICEA 2XMQA 1GVNB 1GYPA 3V9AA 3RRZA 1GLVA 3IEXA 1VHJA 2B2NA 4O2AB 4X1OA 3VJLA 5JVDA 2O4UX 5HG0A 3T5CA 4MA5A 5LNK1 4Q66C 5D7NA 5LSAA 1FUYB 2MSWA 1O0BA 1LPAB 2XVXA 5GY7A 2AF4C 3AHFA 2H1WA 1VGRA 2FW6A 2P3OA 3OEED 3TNDA 1OASA 2AR7A 1X8XA 2C9YA 1GIAA 4Q03A 4Y1RA 1QMPA 1APBA 2H6EA 2PWZA 2LW7A 4UD2A 5F78A 1IHDA 1G4AE 2GDZA 1NXSA 4L02A 1IBSA 4M3NA 1W0CA 4QX6A 5ESWA 3U4HA 4CMBA 2G0TA 1X1QA 2BMVA 5IEBA 4KKXB 2X0FA 3K73O 4J94A 3U9LA 3UV7A 4CI0B 1B8VA 2I29A 2PSFA 1W29A 3M0EA 3QYAA 4LJKA 5CK5A 5IC4A 4JLSA 1CF9A 2VOJA 4JKYA 4QBTA 4EMSA 2DP4E 3FUUA 1F12A 4J76A 4JU9A 4M37A 2DE0X 4TXJA 5DEOA 3TXAA 5JQWA 3UGQA 4A0QA 5FNVF 2WF8A 2X9GA 1DAEA 3ZJYA 4DIFA 3H2HA 5AJWA 1ZK4A 2Z3VA 2AUTA 3R7WB 4MVJI 4QDTA 2NACA 3UH1A 1U1IA 2FG6C 2G4LA 1NQAO 2NNLD 2VJAA 2XNSA 3BB4A 3O2NA 3IKMB 4MUFA 3T8YA 2WQ6A 1K7SN 2YMLA 3FUCA 4NZ9A 4LAFA 3VR5H 4WRRA 4PG4A 1UC8A 1GPAA 1N2HA 2GRJA 2IA5A 3WO0A 1F4PA 2VNKA 1TMYA 2Q5FA 3AR3A 1Y7HA 4LF8B 5G02A 2GBLA 2X7JA 2O8BB 1Z4OA 2WFZA 3BC1A 1MB0A 1ODCA 4C08A 4ARSA 2B7BA 2FG7C 2J5QA 2GI4A 4OP2A 5DXJA 1YZFA 3OQJA 5E9AA 5L3ZA 2DR2A 3VH3A 1QYRA 4KQ6A 2CUTA 2GPAA 3ZCRA 4QJ4A 3QU4A 5ALIA 2GN1A 3TNFA 4CMAA 3KV3O 1OMOA 3THXB 4O4IA 1BROA 1Y9AA 4FZJA 5AXDA 3JD0A 3WYGA 2ACVA 2E89A 1R5OA 2VOEA 1XMOB 1LLDA 2QIOA 3HA7A 4BFLA 3KZXA 4FJ0A 1JPJA 2V5AA 3F78A 3I45A 3AKDA 3BGIA 2R6CA 3M1IA 3ZY6A 2YN0A 2YY7A 4YCCA 2OV4A 3B8EA 3GFTA 1Z5UA 2FKAA 2J9ZB 1N3YA 4J3NA 2ZZKA 3HEBA 2GEJA 4M7OA 5EQDA 5F35A 3ILSA 3PF8A 2QROA 4HAOA 5CIYA 3IALA 1JQJC 2C82A 5M2QA 2PWBA 5IT4A 1VPVA 2O2XA 1NY6A 3ICPA 3QKIA 1CJBA 1C4OA 3F4LA 3C1TA 1TADA 2QYHA 3DAGA 3T5PA 4PLVA 3T3DA 1O95A 3KXIA 3BMXA 3C3AA 2HJRA 2V4ZA 2FVYA 1UH5A 3I5MA 1VTKA 1X8KA 4MXDA 1CVIA 2ECQA 1JRLA 2Q3MA 2RARA 3IJ5A 4HXEB 5HCNA 4AY4A 3QA3E 1U9CA 2X1HA 3NHWA 2ZUUA 2E4AA 1P44A 1D0IA 3BGSA 3CRRA 2CWWA 3ZJ4A 2Z1MA 5FTJA 4TKLA 1LU9A 2IHUA 2ASEA 1L5QA 2GPNA 4QYXA 1SVMA 3KG2A 2DH6A 3PHBE 2BBSA 2ZBGA 5LZ9A 5G3YA 2EGGA 1XJQA 2AA3A 2H8GA 3HCRA 2A9JA 3JWIA 4RZ3A 3G1UA 3PV0A 4XSHA 5ALTA 3WXMA 4QKQA 4EX6A 1YR3A 2OYSA 2OC4A 3U2QA 3QEOA 1I33A 4XYLA 5ITSA 1Z7BA 2Z8YA 3W90A 1S8OA 3KKNA 5ECWA 3PGVA 5AXAA 3DOIA 2ZCVA 4PAGA 1FDWA 4YV7A 1WBDA 4C3ZA 3GPBA 1RZUA 4B7XA 3AW9A 3EFOA 3MT8A 1G7CA 1ZNWA 2OEPA 3ZZTA 4EO9A 1I4WA 1P2GA 5TT0A 3PKJA 4JC0A 3I2JA 3RU7A 4ECEA 1A5TA 3RT1A 5B4VA 1FFEA 1G0OA 1U2PA 2XZLA 2ZU6A 4IOJA 1H4VB 3ZHZA 5C8YA 4MYHA 3ENZA 4MYRA 1YBVA 1N5KA 1P0QA 2XE4A 1S0UA 2ZAMA 2ZIZA 4RL6A 4EL5A 3GRCA 3O0TA 3V4RA 4G0VA 2PS1A 4AG3A 5J5AA 1PS8A 3N5KA 4YJHA 4BLWA 3R0ZA 4BFZA 5JADA 3K70C 3ZHTA 3OEHD 4ZQIA 1KYIA 3SHVA 5AIBA 1K4KA 2WWXA 1KY2A 3KEGA 1C9YA 3TZLA 3QELA 2KB0A 1U1EA 3I8SA 1IE3A 2X9NA 2QL5A 3C98A 3VPHA 1FRZA 4B80A 1UPBA 1A9OA 4JK3A 4MPJA 4B3HA 1G5IA 3OEEA 4PYNA 1GGKA 4F11A 1P4JA 4QAJA 4N9QA 1DC5A 4RO0A 1A77A 3IMKA 3O21A 4JZKA 2E4YA 2DM6A 3BJRA 3FOWA 2Y1EA 1TFRA 2YL2A 3CZQA 2QV0A 2CHFA 4XOIA 1V3TA 4Z7OB 4I81A 1EG2A 4YYEA 4FX5A 3ZD6A 4U2FA 3EW9A 4Z4HA 1DX9A 1E9SA 2FMXA 3AYZB 1E1RD 1E2NA 2YRFA 4CEHB 1L5SA 1H0SA 2XCLA 5EA2A 4DRXB 3AESA 5FPTA 3IX7A 2O19A 1GFWA 3JQCA 1IXRC 5ARCA 4H1HA 3TZQA 3F96A 4KHPB 3BCRA 3K9GA 4UJ3A 3IR7A 3QWFA 4DV6B 2OCAA 4OQYA 4QGGA 5EQFA 1XCOA 2A0FA 2YRWA 3ONNA 2HCRA 4IS2A 2OG1A 4DA4A 3VPXA 3CVJA 1DDIA 2O2YA 5BYJA 1Y5RA 3GJ4A 3PQ8A 4XRRA 1VLMA 1AN9A 1MU0A 3O8DA 1GPDG 1MNAA 1WLYA 2OWEA 5CH8A 5AVRA 3H9UA 3OD5A 3GEPA 1ADCA 5KAMA 1MHPA 4I19A 3FVQA 5KYXB 2EKQA 3Q4GA 1DZ3A 1ZXLA 2FZ4A 3FNIA 4YRFA 4AZTA 5LQJA 1GA4A 3WVNA 4MWTA 3ANXA 1SBZA 5B58C 3QBEA 4QWWA 4WVFA 3GAFA 1F06A 2HIHA 1BXGB 4U9UA 5D1HA 3PUKA 3UGTA 2IHNA 2B9VA 3CUSA 4ND2A 1P0FA 4UUPA 1Z2NX 3PA8A 4FEAA 4GOND 3BIFA 3HEAA 4KWEA 3NHRA 4EUHA 1FL9A 2ZUBA 4UBJA 4X8OA 4LBYA 1JYFA 1EHCA 1OAOA 1ZVJA 2P1ZA 2W2MA 2QSUA 3INRA 4IUCS 3HSSA 2KJQA 1ZD1A 5BN5B 1P8AA 2H2HA 2WYWA 2EBWA 2PL5A 3BD6A 3I30X 2N9UA 3ILYA 1F7UA 4FCVA 1R8QA 2ECKA 4NYJQ 4ZYZA 3KAKA 4B40A 2V3WA 4JGGA 4W99A 4DMUB 1OHHA 5K3SA 1DC8A 2G09A 2XTJA 3X1DA 1RKBA 2M1XA 3EIUA 2QUHA 3IPYA 4DDVA 5CIWA 5JWRA 3HSKA 2Z30A 4ZHQA 3PXGA 1HXHA 1NUTA 3AHGA 3DT8A 5JQGB 1SUEA 2WU3A 4JZYA 1N34B 4KTVE 4ZVOA 3EQ8A 1PLKA 1WJGA 1XEWY 4XASA 1T3SA 4UM5A 4Q1CA 3EWAA 4OHYA 3GHHA 2P78A 1ZC3A 2QPLA 3FCCA 1T36A 1Q1AA 3DONA 2P91A 1H6CA 1ILWA 1VE9A 1M75A 2FMHA 2XMRA 3OVMA 4IIHA 4KR3A 2EJTA 1R88A 3ESZA 1X1RA 3HABA 3WXBA 1BWQA 5DNDA 4E4YA 1JLRA 2Z8YM 3M1YA 3U5ZB 3AR6A 3LW8A 3KB2A 5DHRA 1WZIA 5KYKA 4GBMA 2OCKA 5K0JA 4P4SB 2FPGA 2VBGA 2Z83A 4R2IA 5CLGA 1X14A 5F64A 5LU8A 2HMAA 1M2JA 1PW7A 1UKBA 3WGJA 2GHTA 3AIKA 3GLKA 5F3RA 4EH1A 5KPJA 3THXA 2OLEA 2BD0A 3N7UA 3BH6A 1EE2A 3BF7A 5DCWA 5TMBA 3EGVA 3ZGYA 1I8TA 4C76A 1N78A 1QO0D 4TQ9A 3ZWYA 5LQKA 3DZJA 3GAAA 1M6VA 5CNKA 3T9EA 4RHCA 4W7HA 3HNPA 3U44A 4TMTA 5KJ1A 5IXJA 1LPNA 2JAXA 1Z45A 1N6IA 3W77A 4E09A 1FU7A 4C2UA 1YZQA 2OLKA 3WLFA 1WPQA 4YJFA 3RHZA 3FIUA 1TTQB 1U0JA 2VDUE 5LB4A 5T64A 5C7OO 5I4BA 3RRYA 3T1NA 3WL7A 4CKBB 4PG8A 2F17A 4BNYA 3F6CA 3Q0EA 4WY2A 1FXWA 1DIOB 4W5HA 2CHUA 5CNIA 1KSGA 4DUGA 3AEUA 1SVOA 3NAQA 1IL0A 1YK1A 2FW8A 4YVFA 2JIRA 3BCUA 4K8RB 5CT5A 2COKA 3FPCA 4M88A 4C2BA 3OJ0A 2QN6A 1CQIB 4IKOA 1Z37A 5F77A 4A2QA 2XWSA 4OHVA 5ENVA 5LIPA 4D25A 5KNBD 1W5AA 4YUXA 1WU7A 1IJBA 3WYFA 2PQ6A 5J47A 3FHTA 1U6IA 3RYHB 3AVYA 1V48A 1D0VA 2JK1A 2UZ1B 3EE6A 3K1YA 3P9PA 1AKNA 1G9SA 1BTOA 2WEKA 4U7WA 3WFJA 3B5EA 3HEMA 5E2BA 3D4LA 4BKMA 3VTAA 4CIWA 1G1MA 3BMOB 3IO3A 4QGAA 1B14A 2QAGC 1G7SA 1AX9A 2EZ4A 2QENA 1HDIA 2K2WA 2PUJA 5GV7A 4DLBA 3B2QA 3OFSA 4NBWA 3WK9A 4B73A 3O8CA 3G6KA 5CX4A 4IIJB 5JQGA 2V97A 5JAIA 2QTVB 2ZIAA 3E7PA 2FCRA 2LUOA 3TLCA 2H07A 2Q1WA 1P5RA 1FX0A 1KXZA 4D44A 2CNWA 2XDQB 2VUUA 2ZW9A 3ZY2A 2Y0BA 4I50F 3O9ZA 1PFUA 1IZ0A 1FP1D 2WHYA 2JLXA 3RK4A 2RHRA 3GDGA 4MUMA 4Z3OA 3AVOA 1EX7A 5A6SB 4QJ5A 3VPGA 1LLUA 1WKVA 2RB5A 2RI1A 1BCRA 3M6LA 5ENZA 4KH0A 3SHTA 3VSCA 4BX0A 1XZHA 5WRFA 1NXXA 3R4CA 4XB1A 1AHPA 4BKRA 2PWYA 3FDIA 3MGBA 5HS6A 1UOQA 4TXNA 3QJYA 3RVNA 1JXQA 1UANA 1JAIA 4B9EA 4RVGA 1DJQA 3V2HA 3FPKA 3IUSA 4PIVA 1BCSB 2VBCA 3TRHA 2CB0A 2ZR8A 3ADPA 1KP2A 4GXTA 2LRHA 3CMMA 4G26A 3NJ8A 4JIGA 3USZA 3ZE7A 4AMVA 2I2FA 2OK7A 3NHMA 1KMNA 1MUUA 3PG5A 1PWXA 2I0FA 2J6CA 3GZNA 3IIIA 2UVPA 1SVWA 4G2NA 4LKRA 1DOZA 2OV1A 5IMSA 2QX9A 3AI7A 3H0KA 4IY1A 3PGMA 3LQKA 1QHSA 3R8CA 1OU0A 4BEJA 3R4VA 4Q3OA 4UPEA 3BD8A 2ZJ0A 4JJ6A 5KC9A 3MWYW 4Q9JA 1QIJA 2ECOA 2Y4OA 1QIDA 4YLYA 1FYVA 1NW5A 4L7QA 1E2KA 1I0LA 3RJ5A 4KNVA 2OCYC 3BQ9A 3RRMA 2D2IA 4D5EA 1N7GA 1IJEA 1MQAA 4NZPA 1A0OA 4P7KA 1BOOA 5HRUA 3PCTA 4GWKA 3BXPA 1UFKA 2GK3A 3U1BA 2D54A 2GN4A 2GOYA 3NM6B 4UREA 3NW9A 2ZI5A 1GNSA 3CLTC 1T34A 2DH5A 4RWZA 1F14A 1Y48E 5TMDA 1F0KA 1FQOA 1U8XX 2ZSBA 4LC1A 1WVMA 3RD5A 4FB4A 4AP9A 3PHCA 1UQUA 1MORA 3ETDA 3UMYA 2O7QA 2BUAA 3NFYA 2F1IA 4B6GA 1EAYA 4JA0A 4OVKA 4C4RA 2LKDA 2WWVD 4HHEA 1HUQA 1VL8A 5LB2A 1ZW6A 5EY5B 3MF4A 4EHAA 2E7ZA 4XDGA 3JALB 3ZGXA 1L5OA 4CHGA 5JSHA 4UAVA 1BE0A 2G40A 2OESA 4J0FA 2VRWA 3U13A 3U7RA 5KNCH 1BKDR 1FUEA 1MQ8B 1UJBA 2FPIB 2C3PA 2GPJA 3KJIA 2ZTSA 4Y7DA 1N5RA 3SSNA 3ZE2B 3ZE8A 4FWTA 2E6KA 2P9EA 2CJPA 2ZP1A 3DVAA 3STYA 4KLAA 4ZYUA 4A26A 3ZDXB 3AR5A 1W581 2WHQA 2O20A 1HYQA 4NONA 3TE6A 3UJ7A 2EQAA 3ABOB 5M29A 2NO7A 4F5YA 2FVXA 5DGDA 1Q3TA 1R5JA 5ILGA 2ISSD 3AIIA 1YK0A 4KP7A 5MN4A 2PBFA 2Z1DA 4PG5A 1COZA 1OAAA 4P7GA 3SF0A 2RHCA 3ND9A 1CEYA 1KOJA 1KJQA 2BMAA 4LMRA 2AQIA 2ORWA 4PC3A 2ZSJA 4QOEA 3LLSA 3A3NA 3UT5B 3UAYA 2WIAA 4O4IB 3QX3A 4CN9A 1NXWA 2EFHB 2AI2A 3GT4A 3V1YA 5AVQA 1N2XA 4P32A 5I9TA 2JRLA 5HM8A 2I6UA 4BHTA 3INTA 1J2EA 1NYTA 2Q5OA 3IEPA 2C3MA 4LJ4A 1H2BA 1RLOA 4N8EA 4NV1A 2IP4A 4PQRA 1A1VA 2UXBB 3Q7QA 1USWA 1EFVA 1S01A 3JAWA 4REQB 1RMYA 4LZZA 3EPJA 2WTBA 2V6BA 4MW6A 3S70A 2P9CA 1K5DA 2UVQA 3IIEA 3LHIA 3FFBA 2P2YA 3VU0A 1AQUA 4I50A 3NAMA 1NOKA 3S4YA 2VF7A 1GRNA 4QARA 1GLGA 4OOFA 4PNZA 3IAXA 3TJMA 3OPNA 3WNVA 3ILVA 2A14A 1R8JA 1Q91A 2XA9A 4IXTA 3SHOA 1D2HA 1OFUX 1T91A 3IVCA 3O94A 4R16A 5FA6A 5A3SA 2MINA 3IE2A 3RRNA 3TG2A 2CXPA 3VU9A 1DBVO 4DHEA 3LIPA 3WJ7A 3H6GA 2PK3A 3NHBA 1KEVA 2QTWB 3ZHVA 3DTVD 4CKBA 1QCCA 3FXAA 2AZ4A 3SNHA 2OGZA 4A6XA 5DDIP 1FX0B 1I51A 1NXQA 2WAOA 4LXXA 4NI5A 1KYTA 1V11A 3ADKA 1KFCB 3F2VA 3PXBA 4IZ6A 2AJCA 5EJGA 4PYJA 3G0CA 2QT9A 3QEJA 3F47A 5CA0F 2BI7A 4RJLA 3MELA 2GS9A 1NMXA 2J8ZA 3O93A 1A5ZA 2A30A 2Q1SA 1I14A 1T3LA 3R24A 4AUKA 2PX5A 2X2EA 1G5FA 3WK6A 4DWWA 1Q6YA 2ZCJA 4KNYA 1LPOA 1W75A 1ZNQO 3NEYA 4DMGA 4XGQA 1YE3A 5ALZA 4K9NA 4X8LA 5DLQC 2FDRA 2PXAA 1RYFA 1TF7A 2NAFA 2BRUC 2H08A 2GYWA 2CFRA 1BE6A 1U8ZA 1U8YA 2C4HA 5I8WA 4J16C 3S40A 1QLJA 1J5PA 3KOOA 3ZCUA 3O03A 4DNQA 4B3TB 4HDKB 3O7WA 5IZ4A 3HFSA 1F5SA 1XMSA 2CJXA 4PHGA 3F4BA 2QXTA 4TWZA 4ZV9A 5KYUB 5A7HA 2PD3A 2YZ7A 1P31A 3EMBA 1J8MF 3R7DA 4M6WA 3R6TA 1ISJA 4COKA 1R0BA 4LPKA 5GP1A 3RRBA 4PX2A 4D45A 2B5WA 4XOUA 1WCV1 2C5SA 5B57C 3GGGA 1MJNA 1AIPA 3M7IA 1Z0IA 4LOHA 4HTAA 1VI5A 1J23A 1KS9A 1YV9A 3Q87B 1A71A 1TW2A 2HSZA 3J81k 2YZNA 4H35A 3OEHA 4GG1A 5COAA 1OZ0A 1GUFA 1SCBA 3KOWA 3CE9A 2H1OA 1RKVA 4N49A 4CEIB 1G3IA 4MB2A 3IUBA 3LZCA 1Y42X 4FYWA 4IYRA 1H5QA 4IYJA 3ZWOA 1ZAYA 3NHJA 3MJFA 3SKVA 2ROQA 2AS0A 4KL8S 4PPFA 3CKYA 3W2TA 3RT7A 5DBOA 3VI4B 3DE2X 1NVDA 1OXXK 4OAQA 1UXJA 4FLMA 2QGNA 4OJQA 3TQQA 4IHJB 1F0NA 5E95A 3N28A 2B4YA 3SR0A 4O3FA 3DXYA 3EBOA 4HN9A 2W70A 4X3OA 4A8PA 3UNXA 2R3SA 1TNDA 4B3FX 5F5NA 4FZRA 4OLFA 4P80A 1MOSA 2WWGA 3OPQA 4ND5A 3IOBA 3C85A 2A67A 4B5LA 5JS6A 1UM8A 3CZMA 4GYKA 2WWYA 1G63A 1KZ1A 1UM9B 1T5OA 2XUPA 5CX1A 3U9TA 1B74A 5FTNA 2VP2A 2CFSA 2W8ZA 4JI1B 1IWOA 2XCRB 1ZSNA 1GZ6A 4FT4A 4MCHA 3CGWA 4TMVA 5FAKA 2YHBA 1WR8A 2VLIA 2I87A 1AZTA 4AJNA 1YTUA 1L5VA 4MS4A 3GV0A 3E9QA 2A1IA 4MKGA 4XI9A 2ZXEA 1N3LA 3DEJA 1NNLA 3QUBA 1L5LA 4CKEB 4US2R 3THWA 3B3JA 4CMHA 1KSJA 2ZDGA 4KGVA 4L6CA 3EZ7A 3ZTTA 3H4IA 1L0BA 1MVOA 2Q5EA 4WTOA 4FYXA 4H2DA 3NDJA 4HAXA 2WYOA 5TLSA 4MYTA 3HCWA 4BO6A 1TJ3A 2C2BA 2OPBA 3MGKA 1E5LA 3HK2A 2WVJA 1SBHA 3H18A 2JJ2A 2QUAA 2C04A 4RE6A 1NIPA 4Y6SA 1CRPA 1CJTC 4BVBA 1PGQA 5KJFA 3PEYA 2B78A 3CMCO 4RK6A 1F9AA 2ZJ5A 4E4TA 3R6GA 2NUTB 3NOVA 2WNHA 2JIOA 2XMSA 4NJMB 4J75A 4XAQA 3HJAA 4AICA 4JLDA 1II8B 1XNJA 4JP3A 3W5IA 4RAQA 1DWQA 5DBEX 4KIUA 5DULA 5K0TA 3WHKA 3RVPA 2AFRA 2EP8A 5DLEA 2C9OA 3F7OA 3BHMA 4QOFA 2ZI4A 4NENA 5EEGA 2XMDA 1XTPA 4E5MA 4AY6A 3ZGZA 2MR6A 5EWMB 1VG8A 2PTGA 5CD1A 1R0ZA 1XLUA 4I1UA 2O57A 3HKCB 5M7EA 4PSUA 2YINC 4OHFA 5IULC 3TFOA 2IHKA 3M6XA 3EDYA 5HF5A 1XZMA 5EIOA 1K8RA 2VVTA 1J33A 2A0UA 3IUJA 3QFTA 1IUPA 4H7IA 1CZHA 1GZHB 5HQ3B 1SCJA 1MJHA 4JSTA 3TZBA 2AFIB 2QZPA 3HR8A 2D2XA 2IHBA 4J9VA 3RWMB 1GCOA 1RWPA 1XZJA 2IDMA 4KX3A 4JI6B 4YT8A 3H2SA 5AW7A 3DXZA 4QLAA 2YVUA 4L27A 4IXMA 4ZAXA 2GN9A 3LPLA 1BN7A 5C80A 2YZGA 2HGZA 1RRVA 3LLUA 4DPLA 1V8BA 2VH2A 2AIRA 2XEDA 3PVCA 5GV8A 3AF6A 1X7ZB 4W82A 1VCNA 1DC6A 2GPBA 1IATA 3AESB 1GUYA 1Y98A 1FFWA 4HQLA 3K0FB 5CLLA 5C1OA 4IOMA 5TXGA 5AVSA 4G5OA 4UTVA 2QPTA 3L7MA 1W1UA 2FSFA 1KMHB 1BG6A 1RHKA 3DDWA 4L78A 3MJRA 4FHCA 2FOLA 1H0RA 1OBHA 3OP1A 2OORA 1BS9A 5D84A 4MROA 3SC2A 3HBFA 4WY8A 4X45A 4Y9RA 3QKTA 4JAVC 5HEKA 3HDQA 1A9SA 3AKYA 4KI0A 4WX2B 3LBHA 4RDXA 5K6AA 1I5EA 3MERA 1SXJA 3O91A 3FE2A 1E7WA 1LNZA 2RH8A 2Z57A 4IVNA 1TLLA 4C0BA 8OHMA 3NVAA 4H27A 4DPMA 1AG9A 2J3IA 2JJYA 2Z3ZA 2B8EA 3WIVA 4ZTUB 1NRXA 1I6MA 1N36B 1VIYA 3CG4A 4KXLA 1W0JD 2B92A 2G80A 2RGNC 5F1OA 3AUTA 1L6RA 1XU4A 2X5OA 1QQTA 3D0OA 3LKDA 3M49A 5F2OA 4D9JA 5LZ8A 1A2QA 3CR8A 4KLZA 3LXUX 1T26A 2HPVA 1JBEA 3IBYA 2WYHA 4UEOA 2P5TB 1VG1A 2PX8A 3RHSA 2A0XA 4FLEA 2IQIA 1EUDA 3IPCA 1JKXA 1BNCA 1CHNA 3LECA 2HWUA 3JZIA 3LVFO 1PSZA 3KZKA 3NV9A 1J8FA 3Q72A 5JCJD 2ZXUA 3MUNA 2HF2A 3ISTA 4X00A 1ZWKA 3I72A 5F21A 4EK9A 1YUBA 2NUBA 2HDHA 2WT8A 4CIXA 1VIVA 1PNTA 2ZLBA 2V45A 2PRIA 1O57A 4GW3A 3RIHA 1RWWA 2XWBF 1OW3B 2HRDA 3V1UA 2NUAA 1JMVA 3MINA 1YR2A 1TM3E 4RCYA 4HSGA 2RHJA 3ZW9A 4U7DA 4CQMD 3V5NA 1W88B 3KEOA 4JN6B 1U0HC 4X60A 3WICA 3BRWA 4RF4A 1V8DA 5D85A 1YDFA 5C8YF 3LT4A 3S6JA 1FBTA 2HSWA 4F2HA 2PEZA 3OCUA 3PQ5A 1Z56C 1Z6QA 4EMUA 3LQRA 4IJUA 3UIEA 3I9V6 3H9GA 4Q3BA 5ENDA 4U2KA 2H2AA 2I4NA 4LSWA 4MTLA 1JJBA 1UBGA 4GSYA 3L0DA 1KRWA 4EMBA 1I3MA 4UHCA 5IKEA 3F1KA 3QMMA 3QPUA 4D74A 3P4YA 1WDKA 2YVKA 1VB5A 2G5CA 2BM1A 4RFSA 1MABB 2JH3A 5DYWA 4BNWA 3F6EX 1E6EA 1VKRA 2ZRMA 1J25A 3DAPA 5FBRB 4DBLC 1RM4A 3WYEA 3FPHA 4IRUB 2ZIFA 1IM8A 2GHQA 3AVTA 3OUTA 4DYVA 1GPH1 3K8YA 4RF3A 2BH2A 3E22A 1PGJA 2OQIA 3ICQB 1O5IA 4YP5A 2QE6A 3I1FA 2IC5A 4XGRA 3WJAA 4D3XA 5AVTA 4XQCA 3SSOA 1C3EA 2JASA 1FS5A 1GGEA 2ZT7A 3IB3A 2VTBB 1EFPA 2BGIA 3EC1A 1XR3A 2IHJA 2J3KA 4KVAA 4RSMA 2VF8A 4O2BF 1C9JA 4OY3A 4B4WA 1XPOA 1GGNA 1LRJA 1R6DA 1FQKA 2OZEA 3TQOA 1V16B 2WJVA 1IB0A 4KVZA 4E15A 4YHBA 3IBSA 4C43A 4RTMA 2ZWOA 3ZGLA 3VOAA 1V37A 4IO1A 1NSTA 1P80A 1I1OA 1NF9A 1JAHA 4J3JA 3VGPA 3DMDA 2C83A 4BQRA 4MZDA 4ZZIA 1M2KA 2ZRCA 1ZC4A 2DJ5A 4QREA 4EIWA 4DQKA 1ZM9A 4H9GA 4M1QA 1C29B 3IMCA 2GEDA 1XZQA 2I3DA 3N3BC 1LNQA 3T1YB 3G2MA 3RG8A 1WTAA 3ZDAA 2ID7A 3TLZA 3QTLA 2C8KA 1ZGGA 1XHFA 2FF5A 2NQ2C 2Y1WA 3PFIA 5AUOB 3SQLA 5ESRA 2VCHA 2CFCA 4DHWA 5K0EA 1X3SA 2XWPA 5BSWA 2NLOA 2P1DA 1EDEA 2QMUA 4A8JA 1V7QA 3NANA 1ZCAA 5HBRA 3ZXUB 2BSXA 2J0EA 1M73E 2ZJ1A 1DKLA 4KQ2A 2CVFA 2DWPA 5I47A 2GM4A 4ECAA 4A6PA 1UMCB 1RHUA 3DVQX 4JX8A 4MR7B 2VF4X 1GRRA 2VJDA 4J03A 4F46A 5DMHA 6REQB 2F9MA 2QE7D 2GK6A 1XBTA 3IP7A 2LZ0A 4OP1A 1MZVA 2L2QA 4AIIA 3PX2A 1X7WB 3WO1A 1RLIA 1YS1X 4YACA 4AN4A 3ENQA 3ROMA 2PRSA 2HADA 3E03A 4OM7A 1KMHA 2FZEA 3TMKA 1GT91 3C3YA 2REXB 3PTZA 3VVCA 2YXBA 4RVCA 2QTTA 2F67A 2L18A 4HDNB 1U28C 4R2HA 5LWQA 1DC3A 4OU5A 5AKZA 5B3JC 3RLIA 4NZNA 5CCXA 2P9ZA 1XDZA 2PMFA 3ENNA 1WZEA 1CNFA 1RP7A 3E2PA 2J6IA 3SDSA 5K8CA 2INGX 5IP5A 4AS3A 1Q7TA 4X41A 3T0IA 4MUBA 3T1OA 5J23A 4IMPA 4EZEA 3SLGA 3LOQA 1P2SA 2RG1A 5ER6A 3OQ6A 1CQWA 4O2BB 5CITA 3MTQA 1V3VA 1DRWA 1T1IA 4G0MA 4LZAA 2G72A 3A3YA 1KAMA 4NEGA 4Y67A 1G21E 1S4QA 2VZ0A 1KC3A 3I2IA 3SX0A 1Q12A 2WB4A 2WSLA 4UCQA 3WV5A 4CI9A 2VHJA 1SVKA 2QLFA 2ZR0A 4YXWD 1GPKA 5DWDA 2OHOA 2QL9A 3N07A 3IPLA 2HJ9A 2VHQA 2BHNA 4FR5A 1Y8QB 3D4BA 2Y76A 5T41A 4D26A 1GU1A 1I6KA 4DXHA 2R60A 4YMIA 1OYWA 3L0SA 3FTPA 3LSTA 2G4CA 1P6XA 5EMHA 3CSSA 3H2JA 4BNZA 1U3WA 1G8JA 3ZKWA 4KMMA 4XWKA 5JUWA 3D1LA 4PO1A 3LHDA 4V02A 4UTOA 4JASB 5GZ3A 4LWZA 1E0SA 2EKDA 2W4MA 5EGSA 3W3AA 4HLNA 4O4LB 4HDQB 4GOJA 1UBEA 2EGUA 2Q5QA 4A8HA 1WF3A 4FDTA 2JAPA 4DR6B 2H7CA 3LCJA 2BFFA 3EOBI 3VR0A 3EF1A 1GL6A 4YBRA 2B25A 2GM5A 3TO5A 3DM9B 2EW2A 2ZWMA 3WNDA 1U9ZA 1G21A 2YMMA 3JX9A 5EP3A 1W0JA 1VJTA 5LP6A 4TLCA 2O23A 1HSOA 2YWCA 4L57A 4OU4A 2WUEA 1G20B 1PFQA 3M2TA 2B94A 4HC4A 5HP4A 1Q7EA 2TS1A 3MWDA 4HAUA 3QKSA 4RGQA 3PFCA 4BNFA 1M66A 1I4DD 1E1MA 3EISA 5EKTA 1SUFA 4R1SA 4WWHA 1NBME 3SS8A 2HW8A 3MILA 2WHPA 2EV9A 5H3CA 4AX8A 2R00C 3KXDA 1KO4A 2L19A 1V6AA 4TMYA 2AUMA 1TA0A 3JTMA 4I9UA 2JIBA 4YJKA 2I03A 5G4KB 2Q50A 1MBZA 3TR6A 3L8CA 1MR3F 1SR8A 2JAHA 4BQQA 5K6RA 2FRDA 3CBGA 1L8AA 4HDAA 4Z9YA 3ZK8A 3LO5A 4EG8A 1XL0A 2PGJA 5CVVA 2F9FA 2FOIA 5TVGA 5JZVA 1XL1A 4K9QA 5ALVA 2QRGA 2WJYA 4UD6A 5JARA 2PLWA 4TMXA 1XQWA 1YUNA 3YASA 2BIFA 3IJEB 1NM5A 3CRW1 1R4NA 4IG9A 4D41A 1O4WA 1FC0A 1GT6A 1WZUA 3ICCA 1SKYE 1RBYA 3VMFA 3ZHOA 3F3MA 5IF3A 5MGBA 5FUBA 4PZUA 4MPPA 1VMDA 1UBUS 2HM7A 3EMVA 2GD0A 4QYSA 4C89A 3VC2A 3A9WA 4XLLA 3V80A 3SC4A 3DC2A 4CM8B 3LBNA 4LMPA 2WILA 3H5TA 1T0UA 4P7JA 5JBQA 1Q0QA 1DC4A 1NXOA 2BL4A 4ZDJA 4QELA 2GN0A 3LRTA 3L0PA 1ZCZA 2X0EA 4UUOA 1E7YA 4KWTA 4I50B 4GX5A 4M9RA 5LYJA 4P86A 4DG8A 1JEOA 1OOEA 1HEYA 1A5AB 1YFKA 4RABA 2XITA 3D3KA 3RVOA 1CJCA 2M6SA 3HYSA 3DUFB 3T7TA 4CF6A 1I1HA 1HFWA 3ONFA 5DM2A 2HSEA 1GGMA 4FNOA 3W78A 4H16A 4OQLA 1L4BA 5IM5A 1DEKA 5TQ0B 3O1HB 2C4VA 5LU9A 2QMYA 4C5BA 1RR6A 4I6EA 1G8YA 1QGED 1GZ4A 4L8FA 2O14A 4TOIA 4ZEXA 1B23P 2NXNA 1NVTA 3MLBA 4C29A 1WY5A 1RWQA 5IBCA 3MLAA 3SI7A 2RFLA 3RH0A 1OXBB 1FFXA 4PAOA 5HF9A 4PYLA 1Z15A 5LCXA 1A9PA 1SMKA 3G0DA 3KOYA 4PANA 3WFZA 3ZU3A 1R6VA 1A8UA 2EBHX 5DGXA 3LUJA 3I5XA 3HS3A 4ND3A 3RFVA 2GD2A 2XCIA 1YASA 1FU8A 4RDHA 5JNSA 5JLJA 1SD5A 3IR6A 4RHYA 3UYKA 1J00A 2GARA 3CONA 1Q16A 3SG0A 1Z28A 5BW4A 5L6LB 3DCYA 5J4KA 3LX5A 1VMIA 1JH9A 4HDMB 3ZJ5A 3IPXA 4ZRMA 1CF4A 3COYA 3L92A 2G07A 1NIJA 3L6BA 4RGBA 4BP8A 1OH6A 4XFDA 4MNTA 1U0EA 3KLPX 1OZHA 5HPYB 4EGSA 3O4HA 2XODA 2CLLB 3UAOA 2Y05A 5JH7A 2V7QD 3UA4A 1LDYA 2FYTA 2WZQA 4NJEA 3FN4A 2OGSA 5LD2C 2HJHA 3AXSA 3IHWA 3WLKX 1YI0A 1QFJA 4GOXA 5J4VA 4E2FA 1CY1A 1VHTA 2SKEA 1JECA 1GKYA 3WY9A 1M2VA 5LXTF 3KLNA 4K28A 3FF4A 4V39A 2WMDA 3WYNA 4CODB 1D7OA 4UHJA 4R01A 2V5VA 1V8OA 1BVHA 4KXFB 5DWQA 1NAIA 2GAOA 4B6EA 2HK8A 1GN9A 5LNK6 2RGNA 3TIFA 1OYOA 3A9TA 4NFLA 1M1NB 4I7EA 1N1EA 2PSDA 1IBRA 1L1EA 9LDBA 4PU0A 4CL2A 1X7HA 3K0SA 2IJGX 1Z5PA 2O59A 2OZVA 1Q50A 2CW5A 4BMPB 1CG6A 5DHFA 2ONKA 3FBGA 3OZUA 3Q40A 3QLUA 4H59A 3HH8A 4J1TA 4QQFA 5DM4A 4ZC8A 4Z0TA 2GM3A 4CUZA 2XCTB 4LVCA 5CAEB 4DR7B 1TVKA 5FO1A 3T95A 3QUSA 1QHXA 4LCBA 3PDWA 1B3RA 2QPOA 3CF4G 1JLLB 5L3VA 4ZRNA 1M8GA 2Z5FA 3Q3IA 4NABA 3EXEB 4YJFB 5CDGA 1QH1B 2X5KO 3F6YA 3W2FA 2FW7A 5FUMA 1HQKA 1XEXB 1MVLA 3PDJA 3PPWA 3WHLA 4QVIA 1EE9A 2OM2A 3WI7A 1U99A 2ZUSA 3MRTA 5G4KA 3HUDA 4YUYA 3PL5A 3L7LA 2DHEA 1DTSA 1B8PA 1JEQA 1EQ2A 4QICA 2HA4A 1V7PC 2VIIA 2R4UA 1K4MA 4RK5A 4XXHA 2VDOB 1ZMTA 3ZYCA 4EP1A 2XRMA 4PHTA 2JBWA 5C0OE 1L7QA 1CUZA 4HLDA 1MEOA 4MGHA 2HPHA 1T8YA 3I3OA 1OX4A 5KTSA 4JXZA 2BGUA 3NBAA 2IDKA 4ML3A 4G5QA 1A7AA 2H3EA 4KMRA 3V7YA 3O82A 4CMIB 1NP3A 4DEVA 2ODPA 4KEAA 4HL6A